--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:46:51 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1099/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -824.48 -828.10
2 -824.43 -832.81
--------------------------------------
TOTAL -824.45 -832.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902062 0.090375 0.375774 1.494995 0.862235 1167.24 1209.83 1.000
r(A<->C){all} 0.171222 0.021477 0.000015 0.458164 0.133241 103.90 142.99 1.000
r(A<->G){all} 0.160730 0.018244 0.000001 0.425366 0.123770 217.48 243.95 1.005
r(A<->T){all} 0.165640 0.020777 0.000012 0.452990 0.124760 146.44 173.61 1.008
r(C<->G){all} 0.168381 0.019257 0.000001 0.446332 0.132605 136.62 221.24 1.000
r(C<->T){all} 0.173742 0.022424 0.000084 0.483896 0.134587 109.56 140.07 1.000
r(G<->T){all} 0.160285 0.018903 0.000106 0.445578 0.120189 215.69 254.79 1.000
pi(A){all} 0.204833 0.000266 0.171000 0.235488 0.204575 1346.96 1373.97 1.000
pi(C){all} 0.342839 0.000353 0.305697 0.378751 0.342688 1311.50 1326.57 1.001
pi(G){all} 0.263805 0.000316 0.229447 0.297174 0.263101 1188.49 1193.46 1.000
pi(T){all} 0.188524 0.000251 0.159156 0.221013 0.188565 989.34 1125.90 1.000
alpha{1,2} 0.402391 0.212236 0.000183 1.345854 0.234310 1165.12 1229.13 1.001
alpha{3} 0.451294 0.245016 0.000105 1.441277 0.285330 1225.64 1276.78 1.001
pinvar{all} 0.997418 0.000010 0.991361 0.999999 0.998367 1304.64 1324.27 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -800.055254
Model 2: PositiveSelection -800.055253
Model 0: one-ratio -800.055262
Model 7: beta -800.055254
Model 8: beta&w>1 -800.055256
Model 0 vs 1 1.5999999959603883E-5
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 3.999999989900971E-6
>C1
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C2
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C3
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C4
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C5
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C6
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=202
C1 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C2 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C3 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C4 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C5 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C6 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
**************************************************
C1 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C2 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C3 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C4 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C5 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C6 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
**************************************************
C1 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C2 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C3 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C4 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C5 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C6 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
**************************************************
C1 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C2 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C3 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C4 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C5 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C6 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
**************************************************
C1 GG
C2 GG
C3 GG
C4 GG
C5 GG
C6 GG
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6060]--->[6060]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.740 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C2 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C3 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C4 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C5 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
C6 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
**************************************************
C1 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C2 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C3 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C4 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C5 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
C6 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
**************************************************
C1 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C2 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C3 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C4 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C5 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
C6 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
**************************************************
C1 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C2 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C3 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C4 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C5 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
C6 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
**************************************************
C1 GG
C2 GG
C3 GG
C4 GG
C5 GG
C6 GG
**
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
C2 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
C3 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
C4 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
C5 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
C6 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
**************************************************
C1 AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
C2 AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
C3 AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
C4 AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
C5 AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
C6 AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
**************************************************
C1 CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
C2 CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
C3 CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
C4 CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
C5 CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
C6 CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
**************************************************
C1 TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
C2 TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
C3 TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
C4 TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
C5 TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
C6 TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
**************************************************
C1 GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
C2 GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
C3 GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
C4 GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
C5 GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
C6 GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
**************************************************
C1 CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
C2 CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
C3 CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
C4 CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
C5 CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
C6 CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
**************************************************
C1 GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
C2 GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
C3 GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
C4 GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
C5 GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
C6 GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
**************************************************
C1 TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
C2 TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
C3 TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
C4 TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
C5 TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
C6 TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
**************************************************
C1 CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
C2 CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
C3 CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
C4 CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
C5 CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
C6 CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
**************************************************
C1 CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
C2 CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
C3 CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
C4 CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
C5 CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
C6 CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
**************************************************
C1 CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
C2 CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
C3 CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
C4 CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
C5 CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
C6 CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
**************************************************
C1 TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
C2 TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
C3 TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
C4 TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
C5 TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
C6 TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
**************************************************
C1 GGCGGC
C2 GGCGGC
C3 GGCGGC
C4 GGCGGC
C5 GGCGGC
C6 GGCGGC
******
>C1
GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
GGCGGC
>C2
GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
GGCGGC
>C3
GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
GGCGGC
>C4
GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
GGCGGC
>C5
GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
GGCGGC
>C6
GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC
AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT
CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT
TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC
GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT
CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT
GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC
TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA
CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT
CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA
CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG
TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC
GGCGGC
>C1
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C2
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C3
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C4
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C5
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
>C6
VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
GG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 606 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855539
Setting output file names to "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1897289520
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5153035139
Seed = 1356806583
Swapseed = 1579855539
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1356.257057 -- -24.965149
Chain 2 -- -1356.257057 -- -24.965149
Chain 3 -- -1356.256979 -- -24.965149
Chain 4 -- -1356.257057 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1356.257057 -- -24.965149
Chain 2 -- -1356.257057 -- -24.965149
Chain 3 -- -1356.257057 -- -24.965149
Chain 4 -- -1356.257057 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1356.257] (-1356.257) (-1356.257) (-1356.257) * [-1356.257] (-1356.257) (-1356.257) (-1356.257)
500 -- [-834.653] (-836.573) (-842.618) (-835.032) * (-844.973) (-839.094) [-833.321] (-843.885) -- 0:00:00
1000 -- (-832.369) [-832.494] (-834.166) (-837.561) * (-828.888) (-837.934) [-831.616] (-836.001) -- 0:00:00
1500 -- (-831.298) (-827.581) (-846.271) [-833.106] * (-832.755) (-838.041) [-841.989] (-836.153) -- 0:11:05
2000 -- (-838.635) [-830.398] (-848.236) (-832.010) * (-844.273) (-833.243) (-832.311) [-830.964] -- 0:08:19
2500 -- [-837.739] (-839.469) (-837.021) (-830.255) * (-832.961) [-834.903] (-831.890) (-836.510) -- 0:06:39
3000 -- (-839.347) [-837.281] (-839.612) (-829.449) * [-831.223] (-835.111) (-832.908) (-831.975) -- 0:05:32
3500 -- [-836.360] (-838.557) (-833.973) (-836.645) * (-840.940) (-828.173) (-829.411) [-828.350] -- 0:04:44
4000 -- (-841.185) [-832.737] (-838.592) (-831.169) * [-836.719] (-836.963) (-836.370) (-845.085) -- 0:04:09
4500 -- (-836.640) (-831.769) (-831.905) [-831.452] * (-836.337) (-836.117) (-829.088) [-838.334] -- 0:03:41
5000 -- [-828.920] (-840.365) (-836.367) (-834.000) * (-840.133) (-831.217) (-840.740) [-831.283] -- 0:03:19
Average standard deviation of split frequencies: 0.094281
5500 -- (-834.386) (-844.351) (-836.547) [-837.173] * [-834.021] (-834.708) (-834.116) (-835.374) -- 0:03:00
6000 -- [-837.901] (-833.005) (-831.460) (-835.818) * (-831.658) (-834.334) (-835.160) [-833.622] -- 0:02:45
6500 -- (-829.505) (-838.650) (-833.765) [-835.320] * (-830.191) (-831.946) (-837.038) [-826.929] -- 0:02:32
7000 -- [-833.659] (-832.217) (-838.040) (-833.406) * (-835.138) (-844.854) (-839.366) [-831.895] -- 0:02:21
7500 -- [-838.110] (-832.347) (-827.200) (-835.452) * (-837.966) (-832.900) [-839.595] (-836.140) -- 0:02:12
8000 -- (-834.431) (-837.602) [-828.456] (-832.682) * (-835.745) (-832.996) [-834.469] (-837.382) -- 0:02:04
8500 -- [-836.257] (-835.343) (-827.003) (-829.473) * (-830.512) (-838.925) [-833.596] (-830.645) -- 0:01:56
9000 -- (-828.013) [-839.376] (-827.402) (-838.103) * (-824.104) [-832.821] (-827.606) (-851.845) -- 0:01:50
9500 -- (-833.336) [-833.747] (-825.131) (-840.796) * (-828.387) (-839.478) [-835.665] (-831.899) -- 0:01:44
10000 -- (-828.759) (-836.433) [-826.873] (-838.102) * (-829.498) (-839.556) [-829.906] (-833.612) -- 0:01:39
Average standard deviation of split frequencies: 0.056247
10500 -- (-840.005) [-832.286] (-827.105) (-837.844) * (-824.331) [-833.280] (-840.701) (-834.385) -- 0:01:34
11000 -- (-836.696) [-832.403] (-831.196) (-832.624) * (-826.681) (-833.144) (-831.037) [-833.717] -- 0:01:29
11500 -- (-830.846) [-835.776] (-826.492) (-842.152) * (-825.072) (-832.153) (-833.753) [-830.126] -- 0:01:25
12000 -- (-835.956) [-828.193] (-824.777) (-831.487) * (-824.016) (-827.973) [-827.444] (-848.329) -- 0:01:22
12500 -- (-831.448) (-836.013) [-823.464] (-837.868) * (-823.698) (-826.589) (-827.827) [-827.383] -- 0:01:19
13000 -- (-833.651) (-831.039) (-826.341) [-827.122] * (-824.430) (-824.434) (-836.799) [-825.767] -- 0:01:15
13500 -- [-835.044] (-833.362) (-825.965) (-835.434) * (-823.730) (-826.844) [-833.870] (-824.281) -- 0:01:13
14000 -- (-833.325) (-828.000) [-825.120] (-840.372) * (-826.424) (-827.624) [-832.775] (-825.901) -- 0:01:10
14500 -- (-842.322) (-831.685) (-826.281) [-837.724] * (-831.645) [-825.727] (-832.297) (-824.953) -- 0:01:07
15000 -- [-831.848] (-849.268) (-824.222) (-833.976) * (-828.641) (-832.019) (-832.456) [-824.501] -- 0:01:05
Average standard deviation of split frequencies: 0.041248
15500 -- (-833.008) (-825.009) [-826.376] (-837.418) * (-825.294) (-827.091) [-831.732] (-826.912) -- 0:01:03
16000 -- (-832.420) (-823.831) (-826.305) [-832.503] * (-825.405) (-823.387) [-831.396] (-825.396) -- 0:01:01
16500 -- (-835.921) (-823.314) (-825.166) [-829.155] * (-823.237) [-823.261] (-831.689) (-827.141) -- 0:00:59
17000 -- (-836.376) (-825.430) (-826.811) [-832.581] * (-825.263) (-823.408) (-833.462) [-823.174] -- 0:01:55
17500 -- (-831.929) (-826.354) (-826.319) [-827.852] * (-825.511) [-825.400] (-844.675) (-823.371) -- 0:01:52
18000 -- (-834.904) [-824.065] (-825.407) (-838.836) * (-823.669) (-825.407) [-828.887] (-823.835) -- 0:01:49
18500 -- (-836.569) [-823.439] (-825.323) (-841.877) * (-823.669) (-828.255) [-832.669] (-824.341) -- 0:01:46
19000 -- (-844.309) (-824.590) (-825.130) [-832.267] * [-825.677] (-828.507) (-835.590) (-823.524) -- 0:01:43
19500 -- (-831.495) [-824.952] (-825.538) (-830.092) * [-824.131] (-830.905) (-836.871) (-823.426) -- 0:01:40
20000 -- (-829.912) (-825.669) (-826.355) [-829.501] * (-824.229) (-830.574) (-833.485) [-823.326] -- 0:01:38
Average standard deviation of split frequencies: 0.042198
20500 -- (-837.361) (-826.762) (-824.419) [-832.234] * (-823.591) (-825.030) [-830.877] (-824.025) -- 0:01:35
21000 -- [-834.155] (-826.842) (-830.246) (-833.913) * (-826.467) (-824.175) (-829.403) [-824.193] -- 0:01:33
21500 -- (-838.825) (-827.901) (-825.319) [-832.559] * (-824.254) (-823.939) [-828.358] (-824.201) -- 0:01:31
22000 -- [-832.546] (-826.882) (-825.933) (-846.806) * [-825.278] (-827.338) (-832.353) (-824.415) -- 0:01:28
22500 -- (-833.478) (-826.051) (-826.582) [-832.794] * (-825.972) (-824.134) [-835.746] (-823.736) -- 0:01:26
23000 -- (-838.343) [-826.867] (-824.541) (-834.767) * (-825.646) [-826.769] (-835.709) (-823.262) -- 0:01:24
23500 -- [-831.777] (-826.261) (-824.807) (-829.006) * (-824.364) (-827.240) (-839.987) [-825.593] -- 0:01:23
24000 -- [-835.861] (-825.094) (-825.045) (-831.871) * (-824.119) (-824.444) [-835.150] (-828.040) -- 0:01:21
24500 -- [-830.969] (-824.146) (-826.937) (-833.616) * [-823.979] (-827.658) (-832.477) (-829.064) -- 0:01:19
25000 -- [-836.799] (-824.783) (-825.311) (-826.818) * [-825.186] (-829.465) (-836.642) (-826.307) -- 0:01:18
Average standard deviation of split frequencies: 0.037910
25500 -- [-832.750] (-824.713) (-827.228) (-831.966) * [-825.770] (-827.413) (-839.003) (-824.393) -- 0:01:16
26000 -- [-828.516] (-827.427) (-823.082) (-834.351) * (-825.565) (-826.903) [-829.873] (-829.311) -- 0:01:14
26500 -- (-839.610) [-824.817] (-824.658) (-829.486) * [-825.158] (-827.049) (-837.494) (-823.901) -- 0:01:13
27000 -- [-826.019] (-825.039) (-825.242) (-831.314) * (-828.622) (-825.396) [-834.121] (-824.113) -- 0:01:12
27500 -- [-828.228] (-826.779) (-825.144) (-830.196) * (-829.416) (-823.003) [-831.069] (-827.097) -- 0:01:10
28000 -- (-830.054) [-824.863] (-823.781) (-833.808) * (-827.330) [-823.271] (-830.283) (-826.349) -- 0:01:09
28500 -- [-825.901] (-823.838) (-827.424) (-838.067) * [-823.715] (-823.976) (-831.784) (-827.848) -- 0:01:08
29000 -- (-828.916) [-824.566] (-829.804) (-833.302) * (-828.143) (-824.771) (-831.284) [-826.135] -- 0:01:06
29500 -- (-826.355) [-825.555] (-826.059) (-839.281) * (-826.923) (-826.903) (-831.222) [-827.485] -- 0:01:05
30000 -- (-825.260) (-824.040) (-825.621) [-834.702] * (-828.530) (-827.812) (-834.228) [-823.725] -- 0:01:04
Average standard deviation of split frequencies: 0.031476
30500 -- (-827.938) (-825.531) (-826.759) [-838.608] * (-826.857) (-827.262) [-829.780] (-824.079) -- 0:01:03
31000 -- (-828.990) (-824.878) [-823.286] (-834.255) * [-824.325] (-826.253) (-835.192) (-823.578) -- 0:01:02
31500 -- (-827.415) (-830.316) [-823.037] (-836.395) * (-824.792) [-823.275] (-833.252) (-823.932) -- 0:01:01
32000 -- (-826.181) (-825.222) (-824.110) [-830.342] * (-823.546) [-823.607] (-832.852) (-824.869) -- 0:01:00
32500 -- (-825.818) (-825.882) (-824.007) [-834.040] * (-827.823) (-823.611) (-840.038) [-826.287] -- 0:00:59
33000 -- (-826.471) (-825.428) (-824.758) [-832.287] * [-825.150] (-824.844) (-837.519) (-828.559) -- 0:01:27
33500 -- (-830.168) (-826.837) (-823.550) [-834.575] * [-828.730] (-826.863) (-837.191) (-825.713) -- 0:01:26
34000 -- (-825.523) (-824.376) (-824.695) [-829.903] * (-828.063) (-823.938) (-838.605) [-824.319] -- 0:01:25
34500 -- [-824.935] (-828.851) (-827.318) (-844.365) * (-828.078) (-823.817) [-839.586] (-824.944) -- 0:01:23
35000 -- (-824.805) [-827.164] (-825.886) (-833.806) * [-828.080] (-823.732) (-831.457) (-824.487) -- 0:01:22
Average standard deviation of split frequencies: 0.031178
35500 -- (-823.899) [-823.992] (-829.633) (-832.197) * (-829.467) (-824.728) [-844.381] (-824.628) -- 0:01:21
36000 -- (-824.154) (-830.142) (-823.018) [-828.782] * (-826.276) [-825.069] (-828.960) (-825.980) -- 0:01:20
36500 -- (-825.244) (-824.124) [-824.860] (-835.643) * (-825.619) (-828.554) [-838.144] (-827.317) -- 0:01:19
37000 -- (-824.487) [-823.806] (-826.339) (-833.924) * (-825.198) [-826.122] (-837.661) (-825.042) -- 0:01:18
37500 -- (-826.621) (-825.472) (-828.460) [-829.708] * [-823.863] (-825.142) (-843.191) (-824.695) -- 0:01:17
38000 -- (-824.637) [-826.564] (-827.750) (-833.313) * (-827.767) [-824.048] (-837.504) (-826.981) -- 0:01:15
38500 -- [-826.345] (-825.400) (-824.923) (-830.407) * [-827.448] (-823.943) (-840.551) (-824.297) -- 0:01:14
39000 -- [-827.892] (-832.524) (-823.613) (-835.278) * [-826.764] (-824.993) (-838.956) (-823.820) -- 0:01:13
39500 -- [-825.780] (-825.059) (-823.563) (-832.430) * (-825.484) [-824.724] (-828.325) (-825.880) -- 0:01:12
40000 -- [-827.571] (-824.496) (-826.467) (-832.139) * (-824.294) (-826.275) [-834.251] (-833.331) -- 0:01:12
Average standard deviation of split frequencies: 0.029895
40500 -- (-830.222) (-824.613) [-824.723] (-844.574) * (-823.230) [-825.002] (-839.695) (-825.887) -- 0:01:11
41000 -- (-825.961) (-825.450) (-823.644) [-828.939] * [-823.057] (-826.350) (-828.556) (-825.275) -- 0:01:10
41500 -- [-830.680] (-825.216) (-823.759) (-830.575) * (-824.640) (-831.602) [-835.548] (-825.135) -- 0:01:09
42000 -- (-827.537) (-823.226) (-824.606) [-835.621] * (-823.842) (-828.278) [-833.997] (-826.415) -- 0:01:08
42500 -- [-826.404] (-824.290) (-824.266) (-836.174) * [-823.738] (-826.759) (-829.982) (-829.096) -- 0:01:07
43000 -- (-824.071) (-826.700) [-825.665] (-847.044) * (-823.663) (-831.859) [-828.051] (-827.840) -- 0:01:06
43500 -- (-826.707) (-826.412) (-826.475) [-829.899] * (-823.344) (-825.762) [-833.438] (-826.843) -- 0:01:05
44000 -- (-825.620) (-824.232) (-825.104) [-828.542] * (-823.422) (-826.279) [-830.344] (-824.944) -- 0:01:05
44500 -- (-824.672) (-827.581) [-823.741] (-833.088) * (-826.013) (-825.135) [-833.853] (-824.640) -- 0:01:04
45000 -- (-826.219) (-825.713) (-824.669) [-833.490] * (-825.899) (-826.237) [-839.410] (-826.947) -- 0:01:03
Average standard deviation of split frequencies: 0.026840
45500 -- (-823.797) (-832.247) [-824.448] (-839.475) * [-825.272] (-824.134) (-836.913) (-824.279) -- 0:01:02
46000 -- (-829.047) (-825.366) (-825.502) [-836.128] * (-824.888) (-824.469) (-838.522) [-824.105] -- 0:01:02
46500 -- (-824.282) (-824.933) [-829.190] (-842.364) * [-823.108] (-825.753) (-830.385) (-824.199) -- 0:01:01
47000 -- [-826.358] (-826.460) (-824.527) (-836.380) * (-823.616) (-823.899) [-827.411] (-824.566) -- 0:01:00
47500 -- (-823.855) (-828.442) (-824.911) [-833.492] * [-824.276] (-826.618) (-834.650) (-826.575) -- 0:01:00
48000 -- [-823.868] (-830.238) (-826.103) (-830.007) * (-824.126) [-824.518] (-834.704) (-824.873) -- 0:00:59
48500 -- (-824.793) (-827.883) (-827.851) [-836.127] * (-824.938) (-826.047) [-834.576] (-826.456) -- 0:00:58
49000 -- (-823.535) [-822.932] (-827.530) (-834.188) * (-825.018) (-824.435) [-834.205] (-825.797) -- 0:00:58
49500 -- (-823.373) (-823.957) [-825.394] (-833.828) * [-825.084] (-826.211) (-838.601) (-829.145) -- 0:01:16
50000 -- [-824.596] (-825.682) (-830.152) (-833.171) * (-825.057) [-825.008] (-833.550) (-834.283) -- 0:01:16
Average standard deviation of split frequencies: 0.028355
50500 -- (-825.990) (-827.793) [-825.074] (-836.425) * (-823.819) [-827.407] (-829.947) (-824.972) -- 0:01:15
51000 -- (-824.986) (-828.357) (-826.356) [-829.342] * [-825.415] (-826.954) (-830.283) (-825.267) -- 0:01:14
51500 -- (-824.741) [-823.699] (-825.915) (-831.543) * (-827.995) (-826.469) [-830.222] (-825.985) -- 0:01:13
52000 -- (-827.288) (-824.035) (-823.110) [-835.728] * (-826.533) [-825.394] (-837.941) (-827.385) -- 0:01:12
52500 -- (-830.357) [-824.476] (-825.720) (-832.325) * (-824.014) (-823.840) (-836.822) [-829.384] -- 0:01:12
53000 -- (-826.391) [-824.079] (-823.455) (-837.109) * (-824.143) (-823.361) [-833.071] (-828.004) -- 0:01:11
53500 -- [-824.488] (-824.139) (-824.593) (-826.158) * (-823.321) (-825.506) [-830.760] (-825.987) -- 0:01:10
54000 -- (-826.721) (-829.797) (-827.032) [-828.422] * (-824.667) (-828.415) [-834.976] (-823.552) -- 0:01:10
54500 -- (-824.777) [-823.111] (-825.910) (-837.657) * (-826.816) (-824.712) [-828.071] (-823.939) -- 0:01:09
55000 -- (-827.190) [-827.835] (-829.683) (-842.185) * (-829.149) (-825.684) (-831.358) [-828.185] -- 0:01:08
Average standard deviation of split frequencies: 0.028798
55500 -- (-825.611) (-826.055) [-823.006] (-840.094) * (-824.039) [-828.464] (-826.981) (-823.998) -- 0:01:08
56000 -- (-831.669) (-823.570) [-823.464] (-837.108) * [-824.586] (-832.632) (-836.643) (-824.249) -- 0:01:07
56500 -- [-828.877] (-829.927) (-824.013) (-837.047) * (-824.548) (-824.109) (-849.735) [-823.971] -- 0:01:06
57000 -- [-823.999] (-824.767) (-823.096) (-834.477) * (-824.792) [-824.523] (-834.557) (-825.469) -- 0:01:06
57500 -- (-830.386) [-823.078] (-824.684) (-828.046) * (-826.724) [-825.873] (-834.088) (-824.163) -- 0:01:05
58000 -- (-828.219) (-823.278) (-827.477) [-831.617] * [-826.069] (-824.034) (-838.523) (-825.701) -- 0:01:04
58500 -- (-827.125) (-824.439) (-825.034) [-832.552] * (-823.968) (-824.382) (-830.994) [-829.862] -- 0:01:04
59000 -- [-828.562] (-823.843) (-824.699) (-835.563) * [-823.526] (-826.080) (-838.070) (-830.499) -- 0:01:03
59500 -- (-827.937) (-823.819) (-823.828) [-829.237] * (-824.094) [-824.628] (-837.778) (-834.474) -- 0:01:03
60000 -- (-826.782) [-823.169] (-824.242) (-833.833) * (-826.848) (-825.671) (-832.861) [-825.963] -- 0:01:02
Average standard deviation of split frequencies: 0.025765
60500 -- (-826.840) (-825.242) (-823.767) [-831.256] * (-826.336) [-825.841] (-832.378) (-825.469) -- 0:01:02
61000 -- [-826.415] (-829.135) (-825.726) (-848.363) * [-823.985] (-825.059) (-826.796) (-825.160) -- 0:01:01
61500 -- (-826.673) (-826.945) (-826.244) [-832.112] * (-824.735) (-830.151) (-832.706) [-826.552] -- 0:01:01
62000 -- (-825.712) (-826.825) [-826.647] (-835.272) * (-824.741) (-830.539) [-832.051] (-826.857) -- 0:01:00
62500 -- (-824.161) (-825.918) (-827.162) [-832.347] * (-826.551) [-825.404] (-837.200) (-826.213) -- 0:01:00
63000 -- (-827.204) [-825.947] (-825.303) (-841.378) * (-827.268) (-823.801) (-838.172) [-827.862] -- 0:00:59
63500 -- [-831.809] (-826.463) (-826.810) (-850.531) * (-824.659) (-823.105) (-835.101) [-823.412] -- 0:00:58
64000 -- (-828.166) [-824.981] (-824.567) (-834.763) * [-824.766] (-824.894) (-836.020) (-823.416) -- 0:00:58
64500 -- (-823.646) (-825.067) (-825.036) [-832.031] * [-824.096] (-824.554) (-840.365) (-824.386) -- 0:00:58
65000 -- [-823.409] (-825.971) (-823.752) (-833.010) * [-826.398] (-826.196) (-840.730) (-827.838) -- 0:01:11
Average standard deviation of split frequencies: 0.023808
65500 -- (-823.498) (-828.059) [-824.469] (-829.571) * [-824.162] (-823.852) (-833.061) (-829.620) -- 0:01:11
66000 -- (-823.999) (-827.548) (-824.773) [-831.556] * (-826.731) (-823.782) [-830.463] (-824.217) -- 0:01:10
66500 -- [-824.897] (-830.413) (-823.869) (-828.677) * (-825.817) [-823.590] (-827.492) (-824.216) -- 0:01:10
67000 -- (-825.737) (-829.108) (-825.166) [-834.329] * (-824.444) (-824.111) (-832.907) [-825.305] -- 0:01:09
67500 -- (-826.933) (-826.410) [-826.359] (-836.269) * [-823.199] (-826.540) (-832.504) (-828.278) -- 0:01:09
68000 -- (-826.253) (-824.208) [-825.224] (-831.086) * (-824.419) (-826.258) (-837.386) [-826.807] -- 0:01:08
68500 -- (-825.738) [-825.528] (-823.955) (-838.489) * [-828.390] (-823.636) (-835.589) (-825.667) -- 0:01:07
69000 -- (-825.109) (-825.353) [-826.065] (-830.635) * (-828.860) (-825.446) [-832.194] (-825.118) -- 0:01:07
69500 -- (-823.894) (-825.354) [-826.434] (-839.758) * (-824.981) (-825.292) (-841.868) [-831.887] -- 0:01:06
70000 -- (-824.484) (-824.400) (-827.128) [-829.242] * [-825.919] (-825.491) (-834.031) (-825.906) -- 0:01:06
Average standard deviation of split frequencies: 0.021768
70500 -- (-824.827) (-826.542) (-823.530) [-833.707] * (-825.197) (-828.996) (-853.160) [-828.222] -- 0:01:05
71000 -- (-831.252) (-823.779) (-823.550) [-827.517] * (-824.086) [-826.691] (-827.063) (-828.561) -- 0:01:05
71500 -- (-826.874) (-827.907) [-825.654] (-839.716) * (-824.253) [-824.572] (-825.359) (-827.617) -- 0:01:04
72000 -- (-828.220) [-826.393] (-824.369) (-840.174) * (-829.688) [-825.421] (-826.142) (-825.627) -- 0:01:04
72500 -- [-824.115] (-824.775) (-823.582) (-839.664) * [-828.683] (-824.777) (-830.945) (-823.521) -- 0:01:03
73000 -- (-823.611) (-827.608) [-823.898] (-832.223) * (-826.611) (-824.775) (-823.217) [-824.309] -- 0:01:03
73500 -- (-824.723) (-827.423) (-826.477) [-833.516] * (-826.247) (-823.467) [-823.188] (-824.733) -- 0:01:03
74000 -- (-826.477) (-825.588) (-824.373) [-836.694] * (-829.528) [-824.345] (-824.713) (-824.277) -- 0:01:02
74500 -- (-824.572) (-823.423) (-824.454) [-834.908] * (-823.648) (-823.996) (-829.148) [-825.299] -- 0:01:02
75000 -- (-823.762) [-823.881] (-829.514) (-840.639) * [-824.567] (-823.619) (-827.774) (-825.354) -- 0:01:01
Average standard deviation of split frequencies: 0.025500
75500 -- (-823.149) [-827.476] (-831.922) (-831.123) * [-824.059] (-824.173) (-827.554) (-825.548) -- 0:01:01
76000 -- (-823.431) [-824.170] (-835.218) (-835.127) * (-824.070) (-824.348) (-824.978) [-824.145] -- 0:01:00
76500 -- (-824.160) (-829.920) [-824.201] (-834.240) * (-826.612) [-824.452] (-822.842) (-827.981) -- 0:01:00
77000 -- (-826.889) (-824.816) (-823.999) [-830.162] * (-828.595) [-825.186] (-823.656) (-825.580) -- 0:00:59
77500 -- [-823.936] (-827.772) (-823.833) (-834.821) * [-823.229] (-823.715) (-824.115) (-825.102) -- 0:00:59
78000 -- [-824.257] (-827.025) (-824.441) (-831.864) * (-823.467) (-825.103) [-825.778] (-824.840) -- 0:00:59
78500 -- (-826.107) (-828.959) [-825.792] (-838.011) * [-824.270] (-825.192) (-827.094) (-824.288) -- 0:00:58
79000 -- (-825.253) (-826.023) (-823.624) [-833.824] * [-824.931] (-824.247) (-826.926) (-826.100) -- 0:00:58
79500 -- [-823.084] (-824.657) (-824.949) (-835.677) * (-832.769) (-824.380) [-827.918] (-827.201) -- 0:01:09
80000 -- [-822.951] (-823.758) (-823.554) (-836.784) * (-825.288) (-823.155) [-824.481] (-823.108) -- 0:01:09
Average standard deviation of split frequencies: 0.022077
80500 -- (-825.722) [-824.188] (-826.848) (-837.780) * [-824.373] (-829.807) (-823.649) (-824.028) -- 0:01:08
81000 -- (-823.614) (-825.399) [-827.142] (-838.193) * (-825.528) [-823.475] (-824.502) (-824.574) -- 0:01:08
81500 -- [-823.965] (-827.034) (-829.774) (-835.342) * (-827.099) [-824.455] (-823.755) (-823.514) -- 0:01:07
82000 -- (-823.930) (-827.361) (-825.837) [-829.854] * (-825.117) [-824.304] (-827.360) (-825.058) -- 0:01:07
82500 -- (-824.849) (-824.810) (-824.789) [-833.820] * (-825.580) [-824.492] (-823.404) (-827.570) -- 0:01:06
83000 -- (-825.338) (-826.133) [-826.442] (-836.313) * [-825.563] (-823.376) (-823.315) (-827.292) -- 0:01:06
83500 -- (-824.820) (-827.624) [-826.376] (-835.562) * (-824.564) (-823.119) [-824.799] (-824.090) -- 0:01:05
84000 -- (-828.626) (-825.859) (-824.147) [-834.550] * (-826.562) [-825.280] (-823.859) (-824.681) -- 0:01:05
84500 -- [-826.832] (-826.683) (-824.300) (-831.004) * [-826.137] (-825.939) (-824.692) (-828.392) -- 0:01:05
85000 -- (-823.310) (-824.308) (-825.170) [-836.736] * (-827.276) [-824.226] (-824.406) (-824.944) -- 0:01:04
Average standard deviation of split frequencies: 0.020007
85500 -- [-823.119] (-823.780) (-823.114) (-835.013) * (-826.713) [-823.431] (-824.246) (-824.592) -- 0:01:04
86000 -- (-823.776) [-823.691] (-824.426) (-829.929) * (-831.955) (-824.578) [-825.078] (-827.791) -- 0:01:03
86500 -- (-829.817) [-827.211] (-826.909) (-842.723) * (-829.394) (-823.621) [-825.911] (-825.216) -- 0:01:03
87000 -- (-825.614) (-824.812) (-827.985) [-834.117] * [-826.973] (-824.330) (-831.049) (-824.891) -- 0:01:02
87500 -- (-827.409) (-824.218) (-825.326) [-831.083] * [-826.975] (-826.053) (-826.683) (-822.954) -- 0:01:02
88000 -- [-825.036] (-825.565) (-825.638) (-832.719) * (-823.836) (-824.908) [-825.660] (-825.808) -- 0:01:02
88500 -- [-824.689] (-827.895) (-825.127) (-831.038) * (-825.061) [-827.448] (-825.172) (-827.273) -- 0:01:01
89000 -- [-825.482] (-829.204) (-827.387) (-834.011) * (-824.890) (-827.114) (-826.382) [-824.340] -- 0:01:01
89500 -- [-826.129] (-823.328) (-828.541) (-834.530) * [-824.114] (-826.018) (-826.800) (-825.805) -- 0:01:01
90000 -- (-826.654) (-823.271) [-823.190] (-833.702) * (-824.279) [-825.054] (-825.273) (-823.443) -- 0:01:00
Average standard deviation of split frequencies: 0.019976
90500 -- (-823.966) (-823.487) (-824.052) [-835.206] * (-826.628) (-826.978) [-826.528] (-823.408) -- 0:01:00
91000 -- (-824.329) (-823.724) [-823.393] (-840.498) * (-825.552) [-824.395] (-826.832) (-826.900) -- 0:00:59
91500 -- (-825.392) (-824.271) (-823.969) [-828.843] * (-824.057) (-824.774) (-825.158) [-825.190] -- 0:00:59
92000 -- [-826.132] (-824.481) (-823.373) (-839.845) * [-826.514] (-824.585) (-823.344) (-823.468) -- 0:00:59
92500 -- (-826.621) (-824.419) (-823.775) [-832.100] * (-825.660) (-828.058) (-823.400) [-824.761] -- 0:00:58
93000 -- (-827.251) [-827.041] (-825.806) (-828.149) * (-823.943) (-828.656) (-824.770) [-824.003] -- 0:00:58
93500 -- [-828.194] (-824.180) (-825.876) (-831.614) * [-823.975] (-826.793) (-825.226) (-824.546) -- 0:00:58
94000 -- (-827.450) [-823.394] (-825.719) (-835.445) * (-825.225) [-826.889] (-824.491) (-823.991) -- 0:00:57
94500 -- (-826.913) (-823.224) (-824.316) [-833.130] * (-825.345) (-827.411) [-824.470] (-824.553) -- 0:00:57
95000 -- (-827.589) [-825.735] (-826.688) (-836.316) * (-825.023) [-824.654] (-825.665) (-824.602) -- 0:00:57
Average standard deviation of split frequencies: 0.018198
95500 -- (-827.076) [-827.559] (-826.989) (-835.098) * [-827.477] (-824.400) (-826.043) (-826.433) -- 0:01:06
96000 -- (-825.285) (-828.236) (-824.713) [-828.471] * (-827.255) (-830.673) [-823.653] (-827.502) -- 0:01:05
96500 -- (-827.777) (-823.508) [-825.671] (-836.125) * (-825.961) [-828.064] (-827.560) (-826.448) -- 0:01:05
97000 -- (-826.645) (-823.698) (-826.029) [-833.972] * [-826.840] (-828.924) (-825.467) (-826.231) -- 0:01:05
97500 -- (-824.780) (-827.544) (-825.219) [-836.560] * (-825.786) [-825.059] (-826.682) (-824.227) -- 0:01:04
98000 -- (-823.699) (-827.328) [-824.020] (-831.914) * (-823.603) [-824.811] (-824.900) (-823.413) -- 0:01:04
98500 -- [-823.687] (-829.244) (-823.748) (-835.696) * (-823.696) (-826.952) [-824.502] (-823.826) -- 0:01:04
99000 -- [-825.132] (-830.250) (-824.884) (-832.038) * [-823.843] (-826.803) (-826.456) (-823.281) -- 0:01:03
99500 -- [-824.378] (-825.956) (-822.981) (-837.312) * (-826.719) [-825.407] (-825.200) (-823.816) -- 0:01:03
100000 -- (-825.534) (-824.605) [-824.423] (-829.927) * (-825.825) [-825.624] (-825.160) (-826.053) -- 0:01:02
Average standard deviation of split frequencies: 0.021073
100500 -- (-824.767) (-824.157) [-823.234] (-835.204) * [-824.090] (-828.109) (-825.504) (-823.215) -- 0:01:02
101000 -- (-824.231) (-823.891) [-825.172] (-831.136) * (-826.241) (-825.701) (-825.142) [-823.081] -- 0:01:02
101500 -- (-826.317) (-823.767) [-827.182] (-838.307) * [-826.122] (-826.376) (-825.626) (-824.539) -- 0:01:01
102000 -- (-824.270) (-827.047) (-827.407) [-833.387] * (-827.081) (-824.380) [-826.038] (-824.596) -- 0:01:01
102500 -- (-829.458) (-824.139) (-823.808) [-831.130] * [-824.131] (-825.022) (-823.735) (-824.595) -- 0:01:01
103000 -- (-827.511) (-823.345) (-825.947) [-836.118] * (-827.841) [-828.419] (-830.018) (-824.622) -- 0:01:00
103500 -- (-825.121) (-825.371) (-824.441) [-830.799] * [-828.070] (-824.596) (-823.961) (-824.624) -- 0:01:00
104000 -- (-827.764) (-824.715) [-824.064] (-833.106) * [-824.101] (-823.350) (-823.065) (-823.737) -- 0:01:00
104500 -- (-827.642) (-824.136) [-825.265] (-838.416) * (-829.483) (-826.010) [-824.017] (-828.274) -- 0:00:59
105000 -- (-827.793) [-824.925] (-824.852) (-836.907) * (-823.261) (-826.599) [-824.167] (-827.641) -- 0:00:59
Average standard deviation of split frequencies: 0.022014
105500 -- (-825.412) (-828.577) (-826.103) [-829.023] * (-823.261) [-823.958] (-825.600) (-824.463) -- 0:00:59
106000 -- (-825.926) (-822.874) (-827.830) [-827.681] * [-824.447] (-825.722) (-823.311) (-825.870) -- 0:00:59
106500 -- [-825.137] (-825.439) (-829.271) (-826.861) * (-823.633) [-823.890] (-823.590) (-825.429) -- 0:00:58
107000 -- (-826.396) (-823.773) [-825.012] (-828.601) * (-825.497) (-824.834) [-824.683] (-826.290) -- 0:00:58
107500 -- (-826.857) [-823.343] (-823.879) (-825.680) * (-826.052) (-827.338) [-825.659] (-824.737) -- 0:00:58
108000 -- (-825.832) (-824.212) [-823.415] (-831.139) * (-828.057) (-825.931) (-824.900) [-827.942] -- 0:00:57
108500 -- [-825.000] (-823.472) (-824.468) (-831.177) * [-827.255] (-826.516) (-825.101) (-827.384) -- 0:00:57
109000 -- (-828.725) (-824.724) [-823.987] (-828.596) * (-825.883) (-826.097) [-825.447] (-829.171) -- 0:00:57
109500 -- (-826.704) [-824.449] (-825.434) (-827.348) * (-824.777) (-827.148) (-825.252) [-826.073] -- 0:00:56
110000 -- (-827.053) (-825.083) [-826.900] (-826.643) * [-827.243] (-823.174) (-825.261) (-823.440) -- 0:00:56
Average standard deviation of split frequencies: 0.020177
110500 -- [-824.251] (-825.221) (-824.362) (-828.107) * (-826.134) [-823.194] (-827.060) (-825.303) -- 0:00:56
111000 -- [-826.878] (-826.586) (-823.882) (-826.024) * (-828.653) (-823.448) (-822.970) [-823.842] -- 0:00:56
111500 -- (-824.548) (-823.373) (-825.563) [-824.450] * [-826.559] (-828.764) (-824.394) (-824.980) -- 0:00:55
112000 -- [-823.890] (-825.664) (-825.335) (-824.545) * (-824.790) [-825.617] (-823.424) (-823.476) -- 0:01:03
112500 -- [-825.084] (-824.101) (-825.240) (-826.274) * (-824.153) [-826.222] (-823.141) (-830.565) -- 0:01:03
113000 -- (-824.544) [-824.088] (-829.221) (-826.219) * [-824.075] (-824.971) (-826.322) (-823.947) -- 0:01:02
113500 -- (-826.359) [-825.406] (-824.680) (-826.361) * (-825.519) (-824.285) [-824.152] (-823.775) -- 0:01:02
114000 -- (-827.493) (-823.686) [-826.572] (-825.386) * (-826.592) (-823.105) (-823.314) [-823.475] -- 0:01:02
114500 -- (-824.603) (-826.324) (-823.827) [-823.616] * (-824.317) (-823.168) [-824.537] (-823.771) -- 0:01:01
115000 -- (-830.278) (-828.027) (-826.433) [-825.226] * (-828.131) (-826.885) [-824.498] (-824.520) -- 0:01:01
Average standard deviation of split frequencies: 0.020116
115500 -- (-823.685) (-828.657) (-824.542) [-825.041] * (-823.273) (-825.282) (-824.560) [-824.208] -- 0:01:01
116000 -- (-826.082) [-827.441] (-826.130) (-824.580) * (-823.197) [-824.323] (-825.514) (-824.135) -- 0:01:00
116500 -- (-827.048) (-827.779) [-825.360] (-827.959) * (-824.437) (-823.873) (-831.472) [-823.542] -- 0:01:00
117000 -- (-826.741) (-826.429) [-823.756] (-831.126) * (-827.009) (-824.275) (-825.082) [-823.502] -- 0:01:00
117500 -- (-826.097) (-827.034) [-823.955] (-829.664) * (-826.040) (-823.404) [-825.548] (-826.812) -- 0:01:00
118000 -- (-825.380) (-827.798) (-827.662) [-825.086] * (-826.552) [-823.039] (-827.205) (-823.635) -- 0:00:59
118500 -- (-826.003) (-826.259) [-823.394] (-825.771) * (-825.474) [-823.263] (-825.173) (-823.348) -- 0:00:59
119000 -- (-824.135) (-824.879) (-823.898) [-824.884] * (-826.355) [-822.952] (-824.225) (-824.235) -- 0:00:59
119500 -- (-824.493) [-824.016] (-824.984) (-825.531) * (-825.169) [-823.922] (-823.891) (-829.401) -- 0:00:58
120000 -- [-823.691] (-823.598) (-823.594) (-829.137) * (-828.353) [-824.274] (-830.714) (-825.872) -- 0:00:58
Average standard deviation of split frequencies: 0.019533
120500 -- (-824.680) (-825.200) (-825.460) [-826.503] * (-824.042) (-829.752) (-826.009) [-823.696] -- 0:00:58
121000 -- (-823.983) [-825.948] (-824.116) (-827.587) * (-824.604) [-823.475] (-827.163) (-825.070) -- 0:00:58
121500 -- [-826.881] (-825.601) (-825.162) (-826.205) * (-825.751) (-829.328) [-824.028] (-825.983) -- 0:00:57
122000 -- (-827.296) (-831.321) [-824.732] (-826.619) * [-825.639] (-827.225) (-824.239) (-825.643) -- 0:00:57
122500 -- (-824.781) (-827.966) (-824.721) [-826.276] * (-825.380) [-826.939] (-826.649) (-823.127) -- 0:00:57
123000 -- (-832.513) [-824.597] (-826.141) (-824.814) * (-824.972) (-823.745) (-824.576) [-823.708] -- 0:00:57
123500 -- (-825.249) (-824.069) [-826.285] (-824.734) * [-828.066] (-823.750) (-825.435) (-823.523) -- 0:00:56
124000 -- (-824.796) [-824.089] (-825.440) (-823.149) * (-828.411) [-823.304] (-827.566) (-826.009) -- 0:00:56
124500 -- (-825.854) [-825.607] (-823.438) (-823.752) * (-823.851) (-824.598) [-825.569] (-825.901) -- 0:00:56
125000 -- [-826.266] (-823.506) (-823.542) (-824.015) * [-822.919] (-822.720) (-824.677) (-825.753) -- 0:00:56
Average standard deviation of split frequencies: 0.020310
125500 -- (-824.917) (-823.637) [-824.216] (-823.629) * (-828.729) (-825.820) [-827.575] (-830.534) -- 0:00:55
126000 -- (-825.560) (-826.250) [-828.152] (-825.659) * (-824.669) (-824.892) [-825.743] (-827.155) -- 0:00:55
126500 -- [-825.694] (-823.525) (-826.602) (-829.546) * (-823.756) (-825.977) (-826.299) [-826.456] -- 0:00:55
127000 -- (-825.734) (-824.810) (-824.342) [-826.111] * (-825.703) (-824.384) (-826.617) [-824.366] -- 0:00:54
127500 -- (-826.555) (-827.690) [-823.683] (-827.238) * (-828.073) (-826.054) [-825.319] (-824.933) -- 0:00:54
128000 -- [-824.336] (-825.956) (-825.590) (-827.096) * (-823.997) (-833.054) [-827.805] (-824.434) -- 0:00:54
128500 -- (-823.679) [-826.148] (-825.524) (-823.342) * (-825.013) (-829.528) [-824.296] (-823.906) -- 0:00:54
129000 -- (-824.176) [-823.559] (-825.387) (-824.009) * (-831.583) (-828.482) [-825.535] (-825.835) -- 0:01:00
129500 -- (-824.114) [-824.591] (-827.948) (-826.108) * [-829.921] (-830.238) (-827.488) (-825.469) -- 0:01:00
130000 -- (-823.795) [-823.693] (-829.055) (-823.337) * (-829.393) (-830.206) (-829.551) [-826.392] -- 0:01:00
Average standard deviation of split frequencies: 0.020272
130500 -- (-823.925) (-824.950) [-825.205] (-823.288) * [-823.832] (-825.625) (-823.909) (-826.049) -- 0:00:59
131000 -- [-825.274] (-826.131) (-827.112) (-824.106) * (-828.097) (-823.164) [-823.601] (-824.769) -- 0:00:59
131500 -- [-824.751] (-823.382) (-823.124) (-825.573) * (-828.052) [-824.036] (-834.642) (-823.144) -- 0:00:59
132000 -- (-824.255) (-825.579) (-825.505) [-823.934] * (-824.061) [-824.834] (-831.979) (-825.628) -- 0:00:59
132500 -- (-828.619) (-822.830) [-823.778] (-825.692) * (-824.846) (-824.522) (-826.926) [-823.419] -- 0:00:58
133000 -- [-823.630] (-824.015) (-824.367) (-825.093) * [-825.228] (-825.264) (-824.207) (-825.513) -- 0:00:58
133500 -- (-824.518) (-825.670) (-825.724) [-826.332] * (-825.681) [-824.855] (-825.896) (-828.629) -- 0:00:58
134000 -- (-824.913) (-824.458) [-823.559] (-825.681) * (-827.565) (-824.723) (-822.972) [-825.896] -- 0:00:58
134500 -- (-825.561) [-824.951] (-823.589) (-829.607) * (-824.235) (-826.175) (-823.901) [-824.688] -- 0:00:57
135000 -- (-827.874) (-824.782) (-824.143) [-827.822] * [-825.121] (-826.528) (-823.809) (-824.067) -- 0:00:57
Average standard deviation of split frequencies: 0.021837
135500 -- (-823.511) (-823.601) (-823.565) [-826.060] * [-823.734] (-822.991) (-824.515) (-824.251) -- 0:00:57
136000 -- [-824.232] (-826.543) (-824.008) (-826.171) * [-825.165] (-824.850) (-825.348) (-824.825) -- 0:00:57
136500 -- (-825.169) [-824.137] (-823.323) (-826.586) * [-826.732] (-823.946) (-824.587) (-825.456) -- 0:00:56
137000 -- [-823.926] (-824.767) (-827.899) (-823.445) * (-825.537) [-825.038] (-824.522) (-826.671) -- 0:00:56
137500 -- (-828.331) [-824.767] (-826.955) (-824.503) * (-827.070) [-823.839] (-824.197) (-825.498) -- 0:00:56
138000 -- (-826.905) (-825.633) (-825.848) [-825.011] * (-826.821) [-824.325] (-823.393) (-823.745) -- 0:00:56
138500 -- (-825.396) (-824.426) [-826.689] (-825.071) * (-827.178) (-824.936) [-824.940] (-824.726) -- 0:00:55
139000 -- (-823.926) (-824.330) [-824.670] (-824.920) * (-824.733) [-825.998] (-825.137) (-825.489) -- 0:00:55
139500 -- [-825.431] (-827.959) (-825.349) (-824.767) * (-826.576) (-828.805) (-825.899) [-825.977] -- 0:00:55
140000 -- (-825.931) (-823.068) (-825.072) [-824.837] * (-823.027) (-831.134) [-825.354] (-824.440) -- 0:00:55
Average standard deviation of split frequencies: 0.022047
140500 -- (-823.933) (-823.181) [-825.072] (-823.961) * (-830.061) (-825.698) (-826.158) [-824.924] -- 0:00:55
141000 -- (-824.295) [-823.138] (-825.080) (-824.809) * (-827.732) [-824.560] (-823.276) (-825.535) -- 0:00:54
141500 -- (-824.733) (-824.456) [-824.950] (-824.654) * (-825.680) (-824.909) [-823.219] (-825.263) -- 0:00:54
142000 -- (-823.560) (-823.231) [-828.588] (-828.865) * (-823.940) (-827.832) [-823.509] (-824.717) -- 0:00:54
142500 -- [-824.518] (-824.388) (-826.132) (-825.559) * [-827.496] (-827.370) (-828.926) (-825.006) -- 0:00:54
143000 -- (-823.101) (-825.704) [-824.741] (-824.744) * [-825.720] (-825.745) (-827.825) (-826.368) -- 0:00:53
143500 -- [-823.203] (-828.414) (-828.082) (-823.464) * (-828.816) (-825.915) [-823.819] (-824.499) -- 0:00:53
144000 -- (-823.203) (-823.693) [-826.225] (-824.754) * [-827.077] (-827.976) (-824.414) (-827.490) -- 0:00:53
144500 -- (-825.273) (-824.761) [-824.378] (-823.651) * (-827.810) (-826.292) [-826.189] (-823.294) -- 0:00:53
145000 -- (-825.325) (-825.308) [-823.910] (-823.918) * (-826.313) (-825.073) (-830.476) [-823.084] -- 0:00:53
Average standard deviation of split frequencies: 0.020757
145500 -- (-826.599) [-825.762] (-824.524) (-823.596) * [-825.441] (-825.196) (-828.995) (-825.876) -- 0:00:58
146000 -- (-824.460) (-825.402) (-825.096) [-824.025] * (-824.500) (-829.030) (-831.604) [-826.867] -- 0:00:58
146500 -- (-823.614) [-824.576] (-826.690) (-824.939) * (-826.158) [-824.295] (-825.582) (-828.817) -- 0:00:58
147000 -- (-823.412) (-824.745) [-825.896] (-832.102) * (-826.419) (-825.275) [-823.691] (-829.009) -- 0:00:58
147500 -- [-823.253] (-827.327) (-824.948) (-827.685) * [-825.999] (-828.123) (-826.755) (-827.182) -- 0:00:57
148000 -- (-823.240) [-826.415] (-824.208) (-824.719) * (-828.921) (-825.565) [-825.168] (-832.295) -- 0:00:57
148500 -- (-827.276) [-827.131] (-825.136) (-827.681) * [-825.473] (-823.320) (-823.488) (-828.873) -- 0:00:57
149000 -- (-828.399) [-824.498] (-826.329) (-826.034) * (-825.065) (-826.823) [-825.462] (-826.864) -- 0:00:57
149500 -- (-824.893) [-823.518] (-825.817) (-824.855) * (-825.823) [-826.650] (-826.743) (-824.828) -- 0:00:56
150000 -- (-823.375) (-824.296) [-825.318] (-824.456) * (-823.825) (-825.674) [-823.726] (-826.468) -- 0:00:56
Average standard deviation of split frequencies: 0.020710
150500 -- [-824.630] (-825.166) (-824.088) (-823.089) * (-826.045) [-825.055] (-829.882) (-823.517) -- 0:00:56
151000 -- [-824.329] (-824.370) (-827.201) (-824.430) * (-826.110) [-826.147] (-827.136) (-824.139) -- 0:00:56
151500 -- (-824.424) [-824.649] (-826.305) (-825.927) * [-827.762] (-824.284) (-826.677) (-823.804) -- 0:00:56
152000 -- (-823.591) (-827.278) [-824.151] (-825.257) * [-827.260] (-823.124) (-824.391) (-825.225) -- 0:00:55
152500 -- (-823.874) (-824.252) (-824.584) [-824.362] * (-824.472) (-824.375) (-823.167) [-824.993] -- 0:00:55
153000 -- [-826.806] (-823.909) (-827.301) (-826.861) * (-824.303) (-824.588) [-823.045] (-826.012) -- 0:00:55
153500 -- (-823.718) [-827.433] (-825.087) (-826.362) * (-825.597) (-824.255) (-824.774) [-827.201] -- 0:00:55
154000 -- (-826.762) [-828.153] (-824.333) (-826.117) * (-825.933) (-825.237) (-824.682) [-823.210] -- 0:00:54
154500 -- (-827.860) (-823.807) (-826.731) [-824.600] * (-826.380) (-825.620) [-825.378] (-824.164) -- 0:00:54
155000 -- (-827.468) (-825.465) (-825.367) [-824.314] * (-831.406) (-825.606) (-828.065) [-825.483] -- 0:00:54
Average standard deviation of split frequencies: 0.020517
155500 -- (-827.654) [-823.529] (-825.435) (-827.195) * (-824.094) [-826.800] (-825.226) (-823.875) -- 0:00:54
156000 -- [-827.181] (-825.918) (-825.994) (-827.572) * (-825.736) (-825.784) [-824.777] (-825.738) -- 0:00:54
156500 -- (-827.401) [-829.726] (-823.780) (-827.156) * (-823.838) [-824.541] (-828.368) (-826.898) -- 0:00:53
157000 -- [-824.132] (-827.837) (-822.948) (-824.416) * (-823.906) [-825.257] (-827.630) (-825.638) -- 0:00:53
157500 -- (-823.313) [-827.184] (-824.198) (-828.142) * (-825.121) (-825.180) [-826.352] (-826.049) -- 0:00:53
158000 -- (-825.082) [-823.961] (-825.879) (-824.897) * (-823.676) [-823.479] (-825.372) (-827.095) -- 0:00:53
158500 -- (-823.119) (-828.032) [-824.106] (-824.846) * (-823.653) (-824.745) [-824.053] (-825.848) -- 0:00:53
159000 -- (-825.874) [-824.708] (-827.193) (-826.817) * (-825.606) (-825.042) (-824.385) [-824.738] -- 0:00:52
159500 -- (-827.259) (-824.361) [-826.571] (-824.656) * (-825.397) [-824.358] (-823.487) (-829.681) -- 0:00:52
160000 -- (-824.591) (-825.183) [-825.509] (-824.481) * (-824.361) (-824.411) (-823.233) [-828.151] -- 0:00:52
Average standard deviation of split frequencies: 0.021353
160500 -- (-824.498) (-823.585) [-824.263] (-827.989) * (-826.551) (-826.648) [-823.832] (-823.560) -- 0:00:52
161000 -- (-822.947) (-824.186) (-825.407) [-823.704] * (-827.270) (-826.052) [-823.623] (-823.475) -- 0:00:52
161500 -- (-825.321) [-824.065] (-829.916) (-824.176) * (-825.308) [-828.632] (-825.984) (-823.165) -- 0:00:51
162000 -- (-824.108) (-824.209) (-823.002) [-824.447] * (-825.669) (-826.041) [-824.017] (-823.078) -- 0:00:51
162500 -- (-824.773) (-824.568) [-825.192] (-826.974) * (-828.208) (-823.276) (-825.246) [-823.045] -- 0:00:56
163000 -- (-826.058) [-824.467] (-824.689) (-831.063) * (-826.500) (-825.266) (-823.703) [-823.241] -- 0:00:56
163500 -- (-827.363) (-825.973) [-824.151] (-829.623) * (-827.762) (-824.875) [-825.113] (-825.630) -- 0:00:56
164000 -- (-823.476) (-824.192) (-824.188) [-825.896] * (-827.311) [-824.249] (-826.591) (-824.547) -- 0:00:56
164500 -- [-824.909] (-828.511) (-825.146) (-827.597) * (-824.731) (-827.000) [-823.809] (-824.863) -- 0:00:55
165000 -- (-824.289) (-823.765) (-825.318) [-827.605] * [-822.970] (-824.525) (-825.351) (-828.053) -- 0:00:55
Average standard deviation of split frequencies: 0.020194
165500 -- (-824.709) [-825.026] (-824.769) (-823.542) * (-822.920) (-828.516) (-829.807) [-826.573] -- 0:00:55
166000 -- [-827.672] (-824.012) (-824.395) (-825.813) * [-824.286] (-825.133) (-823.788) (-824.864) -- 0:00:55
166500 -- [-823.661] (-825.887) (-823.211) (-825.906) * (-826.113) (-823.414) (-828.521) [-824.313] -- 0:00:55
167000 -- (-823.613) [-825.103] (-824.683) (-827.148) * (-825.841) (-825.999) [-824.810] (-823.916) -- 0:00:54
167500 -- (-824.313) [-825.331] (-824.567) (-824.053) * [-824.300] (-824.055) (-825.473) (-823.773) -- 0:00:54
168000 -- (-825.367) (-826.850) (-828.534) [-827.084] * [-824.700] (-824.904) (-824.965) (-827.448) -- 0:00:54
168500 -- (-823.656) (-825.803) (-825.667) [-827.542] * (-826.758) (-824.170) (-827.747) [-826.748] -- 0:00:54
169000 -- (-824.248) [-826.418] (-828.600) (-824.732) * (-824.578) (-825.319) (-828.333) [-823.819] -- 0:00:54
169500 -- [-823.436] (-824.079) (-828.266) (-826.042) * [-824.608] (-824.366) (-825.336) (-829.235) -- 0:00:53
170000 -- [-823.039] (-829.049) (-830.435) (-825.298) * (-829.196) (-824.290) (-826.127) [-829.058] -- 0:00:53
Average standard deviation of split frequencies: 0.021176
170500 -- [-823.461] (-826.043) (-828.789) (-824.204) * [-828.756] (-824.458) (-825.119) (-824.438) -- 0:00:53
171000 -- (-827.267) (-825.578) (-824.072) [-824.623] * [-825.424] (-824.805) (-827.010) (-823.592) -- 0:00:53
171500 -- (-827.331) (-825.552) (-824.681) [-825.703] * (-824.574) (-833.327) (-825.703) [-824.429] -- 0:00:53
172000 -- [-824.147] (-823.807) (-825.284) (-824.749) * [-823.393] (-830.049) (-827.240) (-824.903) -- 0:00:52
172500 -- (-823.598) [-824.733] (-826.358) (-823.949) * (-823.268) (-826.418) [-826.226] (-828.628) -- 0:00:52
173000 -- (-824.722) [-824.721] (-825.817) (-824.909) * (-827.637) [-826.984] (-826.263) (-823.490) -- 0:00:52
173500 -- [-824.290] (-825.261) (-831.944) (-824.226) * (-826.688) [-823.697] (-825.157) (-825.151) -- 0:00:52
174000 -- [-825.913] (-824.139) (-825.083) (-832.478) * (-829.840) (-824.850) [-824.342] (-824.368) -- 0:00:52
174500 -- (-827.708) [-824.280] (-823.753) (-829.348) * (-824.734) [-824.683] (-825.792) (-825.200) -- 0:00:52
175000 -- (-829.095) [-824.975] (-824.859) (-827.658) * (-824.252) (-823.761) (-826.604) [-824.035] -- 0:00:51
Average standard deviation of split frequencies: 0.020981
175500 -- (-825.838) (-825.567) [-827.367] (-824.240) * (-824.530) (-823.600) [-826.529] (-825.501) -- 0:00:51
176000 -- (-824.094) (-826.149) [-827.350] (-824.462) * (-824.274) [-825.054] (-828.244) (-824.502) -- 0:00:51
176500 -- [-825.787] (-825.974) (-825.088) (-829.745) * (-826.025) (-826.865) (-824.380) [-825.348] -- 0:00:51
177000 -- [-825.025] (-824.758) (-827.879) (-824.460) * [-827.840] (-825.948) (-823.949) (-824.080) -- 0:00:51
177500 -- (-824.159) [-825.594] (-829.228) (-823.905) * (-826.699) (-826.244) [-823.576] (-824.246) -- 0:00:50
178000 -- (-825.032) (-824.470) (-830.401) [-825.335] * (-826.621) (-825.925) [-823.826] (-828.042) -- 0:00:50
178500 -- (-824.669) (-823.877) (-823.461) [-824.323] * (-823.883) (-828.966) (-823.245) [-823.948] -- 0:00:50
179000 -- (-824.743) [-827.618] (-825.238) (-825.495) * (-826.736) (-824.138) (-824.081) [-825.668] -- 0:00:55
179500 -- (-826.804) (-829.401) (-825.636) [-827.716] * (-823.555) [-823.120] (-823.381) (-824.303) -- 0:00:54
180000 -- (-826.055) (-829.195) (-826.514) [-824.391] * (-824.001) (-825.111) (-825.808) [-824.777] -- 0:00:54
Average standard deviation of split frequencies: 0.019279
180500 -- [-825.592] (-828.342) (-824.977) (-826.880) * [-824.014] (-827.689) (-824.154) (-825.429) -- 0:00:54
181000 -- (-826.238) [-827.563] (-824.279) (-823.280) * (-824.178) (-826.600) [-824.797] (-824.516) -- 0:00:54
181500 -- (-826.583) (-825.586) (-825.025) [-823.509] * [-824.913] (-824.890) (-825.701) (-823.349) -- 0:00:54
182000 -- (-823.646) [-823.974] (-826.084) (-826.380) * [-824.381] (-824.388) (-825.053) (-823.504) -- 0:00:53
182500 -- (-823.813) [-825.492] (-826.199) (-824.865) * [-824.397] (-825.801) (-824.491) (-824.725) -- 0:00:53
183000 -- (-825.567) (-823.880) [-824.476] (-826.983) * [-825.800] (-825.206) (-825.875) (-823.392) -- 0:00:53
183500 -- [-824.214] (-827.116) (-824.482) (-824.540) * (-829.180) (-826.785) (-825.202) [-823.384] -- 0:00:53
184000 -- (-824.776) (-825.376) [-825.185] (-824.273) * (-827.014) (-826.663) [-825.634] (-825.628) -- 0:00:53
184500 -- [-823.791] (-823.459) (-823.667) (-825.051) * (-827.014) (-825.063) (-824.386) [-823.580] -- 0:00:53
185000 -- (-823.658) [-824.069] (-823.107) (-824.270) * (-826.523) (-827.431) [-824.104] (-825.061) -- 0:00:52
Average standard deviation of split frequencies: 0.018586
185500 -- (-822.825) (-824.595) [-826.779] (-829.500) * (-826.063) (-826.501) [-824.585] (-824.972) -- 0:00:52
186000 -- [-823.625] (-824.845) (-826.887) (-826.368) * (-825.895) [-827.173] (-824.731) (-823.705) -- 0:00:52
186500 -- (-823.611) [-823.946] (-825.444) (-827.044) * (-823.889) (-828.433) (-823.993) [-825.041] -- 0:00:52
187000 -- [-823.889] (-824.589) (-827.351) (-824.751) * [-823.861] (-829.956) (-825.705) (-825.918) -- 0:00:52
187500 -- (-824.730) (-826.197) [-824.951] (-823.583) * [-826.714] (-828.051) (-824.830) (-825.952) -- 0:00:52
188000 -- (-828.615) (-824.579) (-826.958) [-825.497] * [-828.020] (-826.867) (-827.256) (-827.554) -- 0:00:51
188500 -- [-827.210] (-826.611) (-826.463) (-825.501) * (-824.554) (-825.425) [-824.928] (-823.551) -- 0:00:51
189000 -- [-829.314] (-826.006) (-825.379) (-826.929) * [-823.961] (-824.391) (-824.820) (-827.929) -- 0:00:51
189500 -- (-822.877) (-827.650) (-826.245) [-824.873] * (-823.294) (-825.161) [-826.160] (-824.106) -- 0:00:51
190000 -- (-823.598) (-828.568) (-825.052) [-826.091] * [-824.186] (-825.386) (-824.423) (-823.828) -- 0:00:51
Average standard deviation of split frequencies: 0.018218
190500 -- (-825.984) [-825.777] (-825.904) (-823.588) * (-824.560) [-823.961] (-824.304) (-825.155) -- 0:00:50
191000 -- (-823.590) [-823.259] (-824.160) (-826.000) * (-830.984) [-823.734] (-824.389) (-824.671) -- 0:00:50
191500 -- [-824.396] (-823.375) (-823.294) (-825.971) * [-825.502] (-824.188) (-824.221) (-825.949) -- 0:00:50
192000 -- (-828.245) (-825.997) (-823.429) [-823.934] * (-825.191) (-827.198) (-823.294) [-824.879] -- 0:00:50
192500 -- (-829.783) (-823.836) [-824.704] (-823.995) * [-829.775] (-824.601) (-823.976) (-827.544) -- 0:00:50
193000 -- (-827.804) (-823.267) [-824.065] (-823.228) * [-829.199] (-823.022) (-823.895) (-827.633) -- 0:00:50
193500 -- (-827.811) [-824.180] (-826.671) (-823.042) * (-824.315) (-826.075) (-824.524) [-826.985] -- 0:00:50
194000 -- [-826.684] (-823.922) (-824.827) (-824.152) * (-824.266) [-825.333] (-824.784) (-826.090) -- 0:00:49
194500 -- (-825.608) (-825.315) (-823.851) [-826.412] * (-824.312) [-825.411] (-827.833) (-827.635) -- 0:00:49
195000 -- (-823.824) (-824.355) (-825.261) [-825.808] * (-824.909) (-823.431) (-827.138) [-828.384] -- 0:00:49
Average standard deviation of split frequencies: 0.018102
195500 -- (-823.808) [-824.005] (-825.990) (-827.058) * (-823.950) (-824.501) (-823.651) [-830.583] -- 0:00:53
196000 -- (-823.574) [-825.523] (-827.231) (-827.590) * [-824.177] (-823.384) (-825.148) (-824.555) -- 0:00:53
196500 -- (-823.565) [-828.211] (-828.266) (-828.622) * (-826.494) [-823.384] (-824.651) (-823.711) -- 0:00:53
197000 -- (-823.833) (-824.910) (-824.970) [-825.197] * (-827.733) (-823.923) [-824.656] (-825.666) -- 0:00:52
197500 -- [-824.120] (-825.631) (-829.304) (-826.197) * [-833.271] (-824.623) (-826.872) (-823.662) -- 0:00:52
198000 -- (-827.886) [-825.491] (-825.724) (-824.253) * [-825.366] (-825.048) (-826.056) (-826.020) -- 0:00:52
198500 -- (-828.398) (-825.556) (-826.108) [-823.666] * (-825.476) (-823.768) [-828.446] (-825.252) -- 0:00:52
199000 -- (-831.696) (-824.621) [-825.347] (-823.314) * [-826.796] (-824.920) (-829.569) (-824.408) -- 0:00:52
199500 -- [-829.109] (-823.339) (-831.119) (-824.431) * (-825.382) (-825.619) [-828.312] (-823.893) -- 0:00:52
200000 -- (-824.103) (-823.863) (-826.447) [-827.680] * (-826.350) [-823.969] (-827.177) (-824.575) -- 0:00:51
Average standard deviation of split frequencies: 0.017488
200500 -- (-823.309) (-824.010) (-827.828) [-825.732] * [-826.345] (-827.756) (-824.132) (-824.311) -- 0:00:51
201000 -- (-826.262) [-825.216] (-825.457) (-828.422) * [-825.800] (-823.672) (-823.992) (-824.761) -- 0:00:51
201500 -- (-826.587) (-823.943) [-823.844] (-828.969) * [-826.774] (-826.328) (-823.140) (-825.235) -- 0:00:51
202000 -- (-824.343) [-824.428] (-825.169) (-828.953) * (-826.293) (-825.377) (-823.615) [-824.012] -- 0:00:51
202500 -- (-824.624) (-824.741) (-826.368) [-826.591] * (-827.051) (-823.390) [-824.383] (-824.014) -- 0:00:51
203000 -- (-825.261) (-825.275) (-825.982) [-827.649] * [-824.953] (-823.354) (-824.990) (-823.833) -- 0:00:51
203500 -- (-827.071) (-825.519) (-824.476) [-825.349] * (-832.352) (-825.777) (-824.244) [-828.006] -- 0:00:50
204000 -- [-824.704] (-824.152) (-823.207) (-827.637) * (-828.593) (-825.144) (-826.397) [-824.449] -- 0:00:50
204500 -- [-823.299] (-825.323) (-826.130) (-831.271) * (-826.428) (-823.954) [-825.253] (-826.807) -- 0:00:50
205000 -- (-823.066) (-824.171) (-830.909) [-825.483] * [-825.725] (-825.476) (-824.044) (-827.728) -- 0:00:50
Average standard deviation of split frequencies: 0.016820
205500 -- [-825.506] (-824.146) (-828.310) (-824.279) * (-825.262) (-824.600) (-828.016) [-825.077] -- 0:00:50
206000 -- (-824.134) [-823.761] (-829.421) (-824.351) * (-824.990) (-824.031) (-825.051) [-827.495] -- 0:00:50
206500 -- [-823.965] (-824.801) (-825.443) (-826.837) * [-825.779] (-825.772) (-827.094) (-825.459) -- 0:00:49
207000 -- [-825.162] (-825.144) (-825.945) (-825.118) * (-825.866) (-826.111) (-827.619) [-825.747] -- 0:00:49
207500 -- (-824.267) (-823.797) [-826.077] (-826.345) * [-825.789] (-828.386) (-826.710) (-825.951) -- 0:00:49
208000 -- (-825.656) [-823.788] (-826.425) (-824.390) * (-825.271) (-826.333) (-828.070) [-823.226] -- 0:00:49
208500 -- (-825.948) (-823.997) (-824.264) [-823.768] * (-825.165) (-827.578) [-826.694] (-823.906) -- 0:00:49
209000 -- (-825.835) (-823.381) [-824.125] (-825.607) * [-824.571] (-827.894) (-824.543) (-823.287) -- 0:00:49
209500 -- (-829.413) (-822.936) [-827.261] (-827.249) * (-826.770) (-830.049) [-825.763] (-825.117) -- 0:00:49
210000 -- (-824.397) [-823.119] (-824.502) (-826.393) * (-824.791) (-827.215) [-824.208] (-824.906) -- 0:00:48
Average standard deviation of split frequencies: 0.017430
210500 -- (-825.683) (-825.022) (-825.837) [-824.220] * (-825.974) (-824.183) [-822.858] (-824.853) -- 0:00:48
211000 -- [-825.308] (-823.629) (-830.418) (-826.208) * [-823.280] (-825.958) (-823.047) (-824.876) -- 0:00:48
211500 -- (-829.530) [-823.563] (-824.889) (-824.168) * (-824.944) (-825.117) [-827.497] (-830.013) -- 0:00:48
212000 -- (-826.379) [-824.291] (-826.688) (-825.003) * [-823.086] (-825.117) (-826.826) (-827.661) -- 0:00:48
212500 -- (-824.217) (-824.569) (-828.897) [-823.012] * (-823.057) (-828.449) (-824.235) [-825.231] -- 0:00:51
213000 -- [-828.100] (-825.352) (-823.302) (-824.751) * (-824.579) [-823.897] (-824.761) (-826.264) -- 0:00:51
213500 -- (-828.180) (-823.702) (-823.114) [-823.294] * [-827.862] (-825.769) (-824.010) (-824.963) -- 0:00:51
214000 -- (-824.904) (-823.648) (-829.564) [-824.034] * (-828.825) [-824.099] (-823.468) (-823.510) -- 0:00:51
214500 -- (-828.133) (-825.859) [-830.875] (-824.092) * (-826.133) [-825.314] (-826.491) (-827.623) -- 0:00:51
215000 -- (-826.470) [-825.221] (-828.570) (-825.029) * [-823.953] (-824.044) (-825.599) (-826.408) -- 0:00:51
Average standard deviation of split frequencies: 0.017345
215500 -- (-824.410) (-824.170) (-826.346) [-823.511] * (-824.793) (-824.668) (-826.453) [-826.294] -- 0:00:50
216000 -- [-824.824] (-825.169) (-828.444) (-825.093) * (-823.717) (-825.204) [-824.286] (-827.885) -- 0:00:50
216500 -- (-826.147) [-823.986] (-828.236) (-826.134) * (-824.404) [-825.517] (-824.388) (-828.820) -- 0:00:50
217000 -- (-827.762) [-824.087] (-825.983) (-825.258) * (-823.746) (-824.756) (-823.919) [-824.025] -- 0:00:50
217500 -- (-824.746) [-824.109] (-827.544) (-826.405) * (-824.369) [-828.409] (-823.675) (-825.638) -- 0:00:50
218000 -- (-827.141) [-823.992] (-826.965) (-825.285) * (-824.369) (-823.047) [-822.981] (-827.905) -- 0:00:50
218500 -- [-830.484] (-823.992) (-827.273) (-824.920) * (-824.821) (-823.935) [-823.446] (-825.725) -- 0:00:50
219000 -- [-824.663] (-827.652) (-826.431) (-824.842) * (-824.611) (-824.185) [-823.464] (-825.879) -- 0:00:49
219500 -- (-825.604) (-827.022) (-825.219) [-827.469] * (-824.108) (-823.787) (-823.925) [-825.168] -- 0:00:49
220000 -- (-824.772) [-823.193] (-825.499) (-827.004) * (-824.058) [-824.688] (-824.825) (-826.624) -- 0:00:49
Average standard deviation of split frequencies: 0.018102
220500 -- (-824.404) [-824.068] (-825.192) (-828.830) * (-825.678) (-823.825) (-825.934) [-825.471] -- 0:00:49
221000 -- (-824.468) (-824.755) (-826.223) [-826.298] * [-823.467] (-827.550) (-824.109) (-825.605) -- 0:00:49
221500 -- (-824.253) (-824.913) (-826.031) [-823.957] * (-825.966) (-828.212) (-825.043) [-827.049] -- 0:00:49
222000 -- (-825.971) [-824.638] (-823.880) (-823.430) * (-826.650) (-825.200) [-826.526] (-825.572) -- 0:00:49
222500 -- (-828.951) (-825.069) [-823.672] (-824.077) * (-827.712) [-823.729] (-828.338) (-826.283) -- 0:00:48
223000 -- (-825.102) (-824.788) [-824.883] (-823.034) * [-825.437] (-822.928) (-827.242) (-825.146) -- 0:00:48
223500 -- [-826.380] (-825.309) (-825.923) (-825.625) * (-824.564) (-823.929) [-827.392] (-826.489) -- 0:00:48
224000 -- (-826.519) [-824.100] (-826.387) (-824.209) * (-827.633) (-823.532) [-827.371] (-825.347) -- 0:00:48
224500 -- (-824.362) (-823.510) [-827.325] (-823.421) * (-830.275) (-824.232) [-823.219] (-824.120) -- 0:00:48
225000 -- (-827.164) (-823.587) [-829.663] (-825.802) * (-825.421) (-824.066) (-824.865) [-824.491] -- 0:00:48
Average standard deviation of split frequencies: 0.017313
225500 -- [-826.749] (-825.861) (-827.695) (-824.454) * (-826.767) (-824.492) (-824.038) [-824.237] -- 0:00:48
226000 -- [-825.604] (-824.294) (-828.968) (-823.746) * [-825.063] (-824.222) (-824.175) (-823.166) -- 0:00:47
226500 -- [-825.654] (-824.163) (-825.927) (-827.849) * [-829.823] (-824.412) (-823.492) (-823.196) -- 0:00:47
227000 -- (-824.833) [-824.055] (-824.662) (-830.424) * [-827.112] (-824.360) (-825.801) (-823.196) -- 0:00:47
227500 -- (-825.856) [-824.872] (-826.296) (-830.618) * [-823.615] (-824.860) (-824.220) (-823.484) -- 0:00:47
228000 -- (-823.742) [-823.422] (-825.054) (-832.368) * [-824.165] (-823.146) (-823.946) (-824.116) -- 0:00:47
228500 -- (-827.218) (-823.439) [-824.792] (-824.254) * (-824.150) (-824.110) [-824.994] (-823.576) -- 0:00:47
229000 -- [-825.095] (-823.648) (-824.326) (-826.236) * (-828.296) (-824.242) (-824.997) [-822.930] -- 0:00:47
229500 -- [-828.970] (-826.082) (-823.070) (-825.515) * (-823.591) (-827.787) [-825.220] (-825.895) -- 0:00:50
230000 -- (-825.073) [-824.810] (-831.312) (-825.490) * (-823.519) (-824.650) [-823.919] (-824.100) -- 0:00:50
Average standard deviation of split frequencies: 0.016860
230500 -- (-826.870) [-824.334] (-828.321) (-823.557) * (-823.665) (-824.376) (-823.644) [-823.583] -- 0:00:50
231000 -- (-825.177) [-825.804] (-825.986) (-825.113) * (-827.717) (-825.211) [-824.069] (-825.726) -- 0:00:49
231500 -- (-825.890) (-823.265) [-824.161] (-824.060) * (-823.279) (-827.475) (-823.204) [-825.320] -- 0:00:49
232000 -- (-825.402) (-823.523) (-829.775) [-824.050] * (-823.473) (-824.596) (-825.584) [-823.568] -- 0:00:49
232500 -- [-824.487] (-823.902) (-827.250) (-823.573) * (-825.069) (-824.075) [-823.354] (-827.290) -- 0:00:49
233000 -- [-824.936] (-823.949) (-825.408) (-825.571) * [-826.121] (-826.170) (-824.432) (-827.180) -- 0:00:49
233500 -- (-831.819) (-825.915) (-826.986) [-827.592] * (-826.252) [-825.274] (-824.329) (-826.449) -- 0:00:49
234000 -- (-829.093) (-826.869) (-825.043) [-825.306] * (-824.648) (-825.786) [-823.559] (-825.298) -- 0:00:49
234500 -- (-824.551) (-832.936) [-823.162] (-826.710) * (-825.033) (-826.124) (-824.746) [-825.574] -- 0:00:48
235000 -- [-825.714] (-832.721) (-824.565) (-825.125) * [-823.640] (-823.421) (-825.042) (-824.167) -- 0:00:48
Average standard deviation of split frequencies: 0.014681
235500 -- (-824.764) [-824.334] (-824.803) (-824.876) * (-828.132) [-825.929] (-827.687) (-823.857) -- 0:00:48
236000 -- (-828.930) (-826.092) [-823.719] (-829.279) * [-824.993] (-824.194) (-825.205) (-825.237) -- 0:00:48
236500 -- (-825.443) [-824.903] (-824.222) (-825.716) * (-823.321) [-824.707] (-824.720) (-824.610) -- 0:00:48
237000 -- (-825.137) (-823.964) (-824.100) [-829.252] * (-826.788) (-827.077) (-825.874) [-825.117] -- 0:00:48
237500 -- [-824.679] (-825.158) (-824.326) (-825.293) * (-827.593) (-825.935) [-823.575] (-827.063) -- 0:00:48
238000 -- (-822.981) (-825.115) (-824.023) [-826.140] * (-829.181) [-823.653] (-826.923) (-831.731) -- 0:00:48
238500 -- (-824.660) (-830.732) [-824.249] (-826.537) * (-826.452) (-824.350) (-827.646) [-827.191] -- 0:00:47
239000 -- [-824.354] (-827.494) (-823.184) (-824.729) * (-824.222) [-825.232] (-827.306) (-826.974) -- 0:00:47
239500 -- (-823.591) (-824.440) [-823.177] (-824.049) * (-825.058) [-824.770] (-826.722) (-825.658) -- 0:00:47
240000 -- (-827.839) [-825.455] (-825.726) (-829.057) * [-825.799] (-825.125) (-823.964) (-825.252) -- 0:00:47
Average standard deviation of split frequencies: 0.013820
240500 -- (-824.868) (-824.291) [-824.198] (-827.890) * (-827.955) (-824.218) [-824.654] (-824.725) -- 0:00:47
241000 -- (-825.615) [-823.195] (-825.808) (-826.166) * (-824.757) (-824.533) (-825.827) [-824.714] -- 0:00:47
241500 -- (-826.556) (-823.457) [-824.087] (-824.610) * (-824.111) (-824.603) [-826.048] (-825.743) -- 0:00:47
242000 -- (-824.994) (-825.265) [-823.074] (-824.046) * (-825.885) [-827.279] (-826.268) (-825.517) -- 0:00:46
242500 -- (-824.113) (-822.994) (-825.168) [-824.645] * [-825.597] (-822.853) (-825.071) (-825.497) -- 0:00:46
243000 -- (-823.351) (-822.931) (-825.602) [-823.266] * (-826.434) (-822.920) [-824.466] (-826.079) -- 0:00:46
243500 -- (-826.337) (-823.803) [-825.451] (-823.443) * (-827.282) [-826.270] (-823.679) (-824.895) -- 0:00:46
244000 -- (-829.748) (-824.326) (-830.037) [-826.533] * (-827.211) [-823.736] (-826.372) (-825.197) -- 0:00:46
244500 -- (-828.892) (-824.001) (-827.756) [-826.229] * (-824.010) (-824.529) [-825.298] (-823.834) -- 0:00:46
245000 -- (-825.756) (-824.085) [-826.216] (-824.229) * (-822.989) (-824.099) (-823.752) [-823.165] -- 0:00:46
Average standard deviation of split frequencies: 0.015043
245500 -- [-825.099] (-823.338) (-830.345) (-825.638) * (-824.789) (-824.003) (-825.170) [-823.718] -- 0:00:46
246000 -- (-828.641) [-825.268] (-828.209) (-826.062) * [-823.193] (-824.042) (-825.988) (-823.874) -- 0:00:49
246500 -- [-824.915] (-827.628) (-822.898) (-825.970) * [-823.193] (-825.564) (-824.229) (-826.836) -- 0:00:48
247000 -- (-825.637) [-824.443] (-822.957) (-823.569) * (-826.011) (-824.232) (-827.473) [-826.088] -- 0:00:48
247500 -- (-823.731) [-823.505] (-822.891) (-826.762) * (-827.031) [-826.902] (-825.046) (-823.891) -- 0:00:48
248000 -- (-823.531) [-824.773] (-824.718) (-828.260) * (-824.193) (-826.540) [-826.323] (-825.487) -- 0:00:48
248500 -- (-825.579) (-826.201) [-826.981] (-825.632) * (-824.057) [-824.355] (-824.007) (-825.466) -- 0:00:48
249000 -- (-826.018) (-825.278) [-823.137] (-824.941) * (-831.696) (-823.125) [-824.462] (-827.387) -- 0:00:48
249500 -- (-825.002) (-823.206) [-823.665] (-828.552) * (-827.662) (-824.737) (-830.053) [-826.873] -- 0:00:48
250000 -- (-824.180) (-823.099) (-825.602) [-827.516] * [-824.448] (-824.132) (-828.410) (-824.918) -- 0:00:48
Average standard deviation of split frequencies: 0.015463
250500 -- (-823.346) (-825.720) [-823.544] (-825.281) * [-824.179] (-824.426) (-824.861) (-825.659) -- 0:00:47
251000 -- (-823.654) (-823.403) [-823.626] (-825.881) * (-823.389) (-828.758) [-825.482] (-827.787) -- 0:00:47
251500 -- [-825.321] (-827.385) (-824.490) (-825.544) * (-823.637) (-826.516) [-824.338] (-825.146) -- 0:00:47
252000 -- [-827.870] (-825.100) (-826.508) (-825.679) * (-824.298) [-824.326] (-826.328) (-826.290) -- 0:00:47
252500 -- (-825.794) (-824.926) (-830.302) [-824.292] * [-823.764] (-824.813) (-826.877) (-827.874) -- 0:00:47
253000 -- (-824.243) (-824.512) (-827.035) [-824.539] * [-823.114] (-829.416) (-825.423) (-823.895) -- 0:00:47
253500 -- [-824.074] (-823.842) (-824.745) (-826.692) * [-824.804] (-824.151) (-826.833) (-824.575) -- 0:00:47
254000 -- (-824.533) (-826.139) [-824.663] (-824.176) * (-825.244) (-825.311) (-826.777) [-824.871] -- 0:00:46
254500 -- [-825.936] (-828.107) (-827.766) (-824.002) * (-827.182) (-824.091) (-826.194) [-825.649] -- 0:00:46
255000 -- (-830.675) (-825.447) [-824.171] (-823.368) * [-826.706] (-823.985) (-824.106) (-824.445) -- 0:00:46
Average standard deviation of split frequencies: 0.015991
255500 -- [-823.781] (-828.735) (-827.977) (-823.156) * (-823.948) (-825.858) (-824.138) [-824.958] -- 0:00:46
256000 -- (-824.700) (-825.732) (-824.241) [-825.049] * (-824.904) (-823.150) (-823.729) [-834.020] -- 0:00:46
256500 -- (-825.697) (-827.568) (-825.817) [-826.283] * (-825.532) (-823.013) [-826.129] (-824.562) -- 0:00:46
257000 -- (-825.768) [-823.930] (-830.798) (-825.304) * [-824.769] (-824.266) (-825.201) (-826.223) -- 0:00:46
257500 -- (-825.810) [-823.488] (-828.682) (-825.444) * (-823.722) (-826.992) (-827.664) [-826.043] -- 0:00:46
258000 -- [-825.002] (-823.431) (-827.944) (-823.433) * (-823.129) (-826.593) [-824.995] (-825.021) -- 0:00:46
258500 -- (-826.333) (-825.255) (-824.661) [-824.864] * (-828.999) [-825.076] (-824.598) (-823.876) -- 0:00:45
259000 -- (-826.352) (-823.993) (-827.425) [-824.985] * (-824.047) (-827.313) [-825.566] (-829.203) -- 0:00:45
259500 -- [-824.713] (-823.875) (-825.931) (-823.264) * (-823.443) [-823.207] (-825.421) (-830.185) -- 0:00:45
260000 -- [-824.394] (-823.761) (-827.713) (-824.962) * (-825.125) (-826.752) [-827.176] (-826.128) -- 0:00:45
Average standard deviation of split frequencies: 0.015800
260500 -- [-824.816] (-824.471) (-827.134) (-826.150) * (-824.665) (-826.714) [-826.000] (-831.709) -- 0:00:45
261000 -- [-824.879] (-825.121) (-827.874) (-823.907) * (-824.730) (-826.681) [-824.724] (-825.220) -- 0:00:45
261500 -- (-826.728) (-825.975) [-825.898] (-824.287) * (-823.751) [-824.224] (-827.229) (-826.240) -- 0:00:45
262000 -- [-824.540] (-823.917) (-826.865) (-826.919) * (-823.331) (-824.406) (-826.469) [-825.578] -- 0:00:45
262500 -- (-825.838) [-826.520] (-825.452) (-826.370) * [-828.455] (-824.140) (-823.876) (-825.577) -- 0:00:47
263000 -- (-824.100) (-827.310) [-825.292] (-825.549) * [-824.684] (-825.344) (-824.018) (-823.529) -- 0:00:47
263500 -- (-824.338) (-825.572) [-824.461] (-825.664) * [-824.998] (-823.820) (-827.275) (-825.052) -- 0:00:47
264000 -- (-825.691) (-827.321) [-824.524] (-823.846) * (-826.681) [-825.397] (-825.384) (-823.111) -- 0:00:47
264500 -- (-824.266) [-825.864] (-825.593) (-823.573) * (-826.598) [-825.228] (-823.494) (-824.790) -- 0:00:47
265000 -- [-825.279] (-827.141) (-824.470) (-824.286) * (-826.154) [-826.482] (-825.734) (-829.586) -- 0:00:47
Average standard deviation of split frequencies: 0.015443
265500 -- (-827.547) (-826.467) [-824.024] (-823.644) * (-826.771) (-824.213) [-824.929] (-827.634) -- 0:00:47
266000 -- (-830.915) [-825.941] (-827.178) (-823.350) * (-824.391) (-825.684) [-825.024] (-831.462) -- 0:00:46
266500 -- (-824.679) [-824.898] (-824.245) (-825.376) * (-824.633) (-827.569) (-825.008) [-825.281] -- 0:00:46
267000 -- [-824.789] (-825.245) (-825.355) (-825.184) * [-823.821] (-825.275) (-825.283) (-828.362) -- 0:00:46
267500 -- (-826.486) [-823.993] (-825.559) (-824.001) * (-824.655) (-825.107) [-824.793] (-825.802) -- 0:00:46
268000 -- [-826.453] (-825.812) (-825.691) (-826.071) * (-825.036) [-823.713] (-824.630) (-826.434) -- 0:00:46
268500 -- (-825.406) (-827.176) [-823.516] (-827.907) * (-824.302) (-825.777) (-825.326) [-826.689] -- 0:00:46
269000 -- [-827.747] (-828.621) (-823.989) (-824.529) * [-824.917] (-824.083) (-826.595) (-824.327) -- 0:00:46
269500 -- (-823.347) [-824.574] (-829.725) (-828.902) * (-828.857) (-827.320) [-824.845] (-824.058) -- 0:00:46
270000 -- (-825.936) [-825.745] (-830.748) (-829.114) * [-824.227] (-823.629) (-824.000) (-824.494) -- 0:00:45
Average standard deviation of split frequencies: 0.016408
270500 -- (-826.169) [-822.945] (-826.263) (-825.441) * (-826.198) [-823.406] (-830.861) (-825.721) -- 0:00:45
271000 -- (-824.904) [-824.259] (-824.340) (-825.444) * (-826.521) (-823.828) (-823.816) [-824.360] -- 0:00:45
271500 -- (-825.111) [-824.759] (-827.374) (-827.212) * (-825.068) (-826.437) [-825.616] (-824.766) -- 0:00:45
272000 -- (-823.970) (-825.464) [-825.289] (-825.940) * [-825.646] (-826.799) (-824.657) (-830.420) -- 0:00:45
272500 -- [-823.949] (-824.930) (-827.440) (-823.342) * (-824.521) [-826.012] (-824.530) (-823.345) -- 0:00:45
273000 -- [-824.422] (-824.573) (-825.141) (-823.490) * [-825.507] (-826.298) (-824.439) (-824.027) -- 0:00:45
273500 -- (-823.341) (-828.808) [-824.752] (-823.934) * [-824.102] (-827.062) (-824.416) (-825.290) -- 0:00:45
274000 -- (-823.153) (-825.770) (-828.404) [-823.600] * [-824.660] (-825.022) (-824.157) (-828.482) -- 0:00:45
274500 -- (-824.203) (-826.878) (-826.175) [-824.172] * (-823.580) [-828.855] (-825.180) (-823.967) -- 0:00:44
275000 -- (-824.549) [-825.425] (-823.407) (-823.532) * (-823.837) (-825.777) [-823.542] (-824.201) -- 0:00:44
Average standard deviation of split frequencies: 0.014859
275500 -- (-824.329) [-830.054] (-824.741) (-825.459) * (-829.192) (-824.623) [-825.318] (-826.810) -- 0:00:44
276000 -- (-825.569) [-825.327] (-825.880) (-824.367) * [-826.534] (-823.951) (-824.842) (-825.113) -- 0:00:44
276500 -- (-823.191) (-823.219) (-825.627) [-827.777] * (-832.249) (-826.376) [-823.551] (-824.614) -- 0:00:44
277000 -- (-824.360) (-823.205) [-826.100] (-824.789) * (-824.036) (-825.438) (-823.046) [-828.492] -- 0:00:44
277500 -- (-826.672) [-823.685] (-824.658) (-827.166) * (-823.990) (-828.404) [-823.616] (-826.279) -- 0:00:44
278000 -- [-824.105] (-823.906) (-829.189) (-830.185) * (-824.342) (-825.829) [-826.475] (-824.602) -- 0:00:44
278500 -- (-825.974) [-825.396] (-828.200) (-828.706) * (-825.147) (-828.706) [-825.645] (-828.252) -- 0:00:44
279000 -- [-825.454] (-823.805) (-828.219) (-823.335) * (-824.602) (-829.190) (-826.167) [-825.399] -- 0:00:43
279500 -- (-825.111) (-825.325) [-827.479] (-824.234) * (-825.683) (-827.083) (-823.425) [-822.877] -- 0:00:46
280000 -- (-826.386) (-824.453) [-829.233] (-825.954) * (-825.645) (-826.134) [-828.038] (-825.452) -- 0:00:46
Average standard deviation of split frequencies: 0.014056
280500 -- (-825.923) (-823.341) (-826.418) [-825.136] * (-824.800) [-823.020] (-823.119) (-823.984) -- 0:00:46
281000 -- (-826.647) [-824.304] (-826.964) (-826.259) * (-825.053) (-824.256) [-824.738] (-825.250) -- 0:00:46
281500 -- (-824.608) [-823.658] (-825.043) (-823.801) * [-825.090] (-823.884) (-824.920) (-823.382) -- 0:00:45
282000 -- (-827.778) (-823.743) (-825.980) [-823.642] * (-824.402) (-822.854) (-823.799) [-823.320] -- 0:00:45
282500 -- (-824.881) (-827.141) [-824.104] (-825.611) * (-829.881) (-822.855) [-825.109] (-824.245) -- 0:00:45
283000 -- (-823.959) (-828.537) (-824.308) [-823.555] * [-823.674] (-825.543) (-823.719) (-828.267) -- 0:00:45
283500 -- (-823.520) [-826.130] (-826.458) (-826.799) * (-824.307) [-826.491] (-823.516) (-825.417) -- 0:00:45
284000 -- (-824.131) (-830.154) [-823.426] (-826.825) * (-824.411) (-825.254) [-825.355] (-825.526) -- 0:00:45
284500 -- [-826.620] (-823.216) (-824.223) (-824.520) * (-823.994) (-824.815) [-824.837] (-823.579) -- 0:00:45
285000 -- (-824.712) (-824.605) (-824.050) [-824.565] * [-828.612] (-823.894) (-830.705) (-829.450) -- 0:00:45
Average standard deviation of split frequencies: 0.013928
285500 -- (-823.771) (-825.014) (-824.966) [-825.313] * (-828.255) (-824.039) (-827.328) [-825.858] -- 0:00:45
286000 -- (-823.749) (-827.489) (-825.009) [-826.216] * (-824.243) (-824.996) (-828.825) [-828.734] -- 0:00:44
286500 -- (-827.294) [-825.767] (-826.128) (-826.254) * [-824.262] (-826.314) (-829.371) (-824.101) -- 0:00:44
287000 -- (-824.748) [-826.368] (-824.899) (-825.220) * (-828.092) (-828.589) (-826.100) [-824.670] -- 0:00:44
287500 -- (-824.649) (-824.821) (-822.887) [-823.720] * (-827.743) (-829.111) [-826.378] (-823.560) -- 0:00:44
288000 -- (-830.431) (-825.930) [-825.043] (-825.399) * (-825.655) (-826.941) (-827.115) [-825.751] -- 0:00:44
288500 -- (-830.736) (-826.219) (-825.821) [-826.033] * [-824.215] (-824.792) (-826.274) (-825.916) -- 0:00:44
289000 -- [-824.425] (-826.217) (-828.519) (-824.873) * (-824.710) [-824.430] (-824.429) (-827.395) -- 0:00:44
289500 -- (-827.962) (-823.490) (-825.448) [-824.180] * [-825.439] (-824.677) (-828.886) (-829.058) -- 0:00:44
290000 -- (-825.440) (-826.069) [-825.533] (-823.879) * (-825.507) (-823.478) [-824.236] (-826.334) -- 0:00:44
Average standard deviation of split frequencies: 0.014255
290500 -- (-825.650) [-825.374] (-824.483) (-824.385) * (-826.445) (-826.186) (-826.860) [-824.018] -- 0:00:43
291000 -- (-824.979) (-823.930) [-826.433] (-825.291) * (-823.526) (-824.365) [-826.051] (-824.275) -- 0:00:43
291500 -- (-824.755) [-824.463] (-826.708) (-823.541) * (-823.694) (-827.716) (-824.795) [-823.589] -- 0:00:43
292000 -- (-831.430) (-827.055) [-829.232] (-832.357) * [-824.944] (-823.608) (-824.401) (-825.239) -- 0:00:43
292500 -- (-824.219) [-824.917] (-825.520) (-824.316) * (-827.352) (-824.153) (-826.480) [-824.225] -- 0:00:43
293000 -- (-824.945) (-825.468) [-825.769] (-825.405) * (-829.406) (-824.411) [-824.766] (-823.658) -- 0:00:43
293500 -- (-824.925) (-824.773) [-823.725] (-823.941) * (-824.999) [-825.705] (-824.465) (-823.933) -- 0:00:43
294000 -- (-827.042) [-823.413] (-824.001) (-824.192) * (-825.818) [-824.679] (-825.125) (-829.301) -- 0:00:43
294500 -- (-825.802) (-824.086) (-825.212) [-823.587] * [-825.106] (-828.186) (-824.712) (-825.134) -- 0:00:43
295000 -- (-824.328) (-824.404) (-827.257) [-824.377] * (-828.693) (-825.512) (-823.640) [-824.828] -- 0:00:43
Average standard deviation of split frequencies: 0.012918
295500 -- (-823.250) (-829.609) (-830.759) [-825.151] * [-825.216] (-824.190) (-826.147) (-825.902) -- 0:00:42
296000 -- [-824.621] (-829.656) (-824.933) (-829.000) * (-829.890) (-823.562) (-828.448) [-824.134] -- 0:00:45
296500 -- [-825.519] (-826.070) (-824.537) (-827.309) * (-825.779) (-825.290) (-823.885) [-823.245] -- 0:00:45
297000 -- (-827.816) (-826.056) [-827.708] (-829.233) * [-827.196] (-828.064) (-826.069) (-825.252) -- 0:00:44
297500 -- (-824.963) [-827.426] (-833.203) (-824.788) * (-824.117) (-829.398) [-823.722] (-825.192) -- 0:00:44
298000 -- (-825.910) (-829.068) (-824.221) [-823.046] * (-824.113) (-824.844) (-827.125) [-823.220] -- 0:00:44
298500 -- (-830.573) (-823.828) (-823.228) [-823.367] * [-827.256] (-827.030) (-824.814) (-825.407) -- 0:00:44
299000 -- (-826.231) (-826.538) [-823.536] (-826.002) * (-823.796) [-825.507] (-825.922) (-825.183) -- 0:00:44
299500 -- (-827.509) (-824.954) [-825.036] (-824.218) * (-829.194) (-826.110) (-825.522) [-824.725] -- 0:00:44
300000 -- (-825.379) [-825.286] (-826.861) (-826.344) * (-829.120) (-824.315) (-824.848) [-825.139] -- 0:00:44
Average standard deviation of split frequencies: 0.012107
300500 -- [-823.536] (-823.034) (-823.279) (-823.642) * (-824.346) (-824.528) [-823.092] (-826.725) -- 0:00:44
301000 -- (-823.593) (-823.842) (-823.403) [-823.944] * (-827.504) (-824.814) (-822.989) [-826.107] -- 0:00:44
301500 -- (-825.862) (-823.914) [-823.935] (-827.101) * (-827.005) (-828.603) [-826.154] (-823.976) -- 0:00:44
302000 -- (-822.964) (-830.319) [-826.956] (-826.635) * (-825.831) [-826.196] (-823.639) (-823.156) -- 0:00:43
302500 -- (-825.787) [-825.247] (-831.439) (-826.313) * (-825.945) [-827.466] (-824.724) (-826.310) -- 0:00:43
303000 -- (-826.446) (-824.713) (-826.247) [-823.841] * [-825.017] (-823.913) (-822.837) (-825.922) -- 0:00:43
303500 -- [-823.968] (-824.408) (-826.113) (-827.039) * (-827.917) (-826.496) (-824.012) [-824.551] -- 0:00:43
304000 -- [-824.470] (-823.597) (-829.356) (-824.596) * (-824.004) (-824.245) (-824.187) [-829.895] -- 0:00:43
304500 -- (-825.202) [-823.871] (-825.432) (-825.783) * (-824.876) [-824.997] (-827.529) (-824.359) -- 0:00:43
305000 -- (-826.414) (-827.578) [-823.189] (-826.375) * (-824.993) (-823.558) [-829.767] (-829.039) -- 0:00:43
Average standard deviation of split frequencies: 0.012068
305500 -- (-827.057) [-825.997] (-825.491) (-825.849) * (-822.976) [-824.771] (-826.181) (-824.802) -- 0:00:43
306000 -- (-826.652) (-825.862) (-823.670) [-824.516] * (-833.241) (-823.899) (-828.293) [-825.125] -- 0:00:43
306500 -- (-826.136) (-825.641) [-823.702] (-825.504) * [-822.899] (-825.634) (-825.449) (-825.373) -- 0:00:42
307000 -- (-823.588) (-826.187) (-823.096) [-826.604] * (-825.008) [-824.659] (-824.425) (-824.971) -- 0:00:42
307500 -- (-828.399) (-825.702) [-824.237] (-827.943) * (-824.453) (-829.198) [-825.866] (-825.708) -- 0:00:42
308000 -- (-824.986) [-825.468] (-823.782) (-824.528) * [-824.133] (-828.505) (-827.921) (-825.839) -- 0:00:42
308500 -- (-826.574) (-827.799) [-823.857] (-824.572) * (-824.356) (-828.002) [-824.891] (-826.575) -- 0:00:42
309000 -- [-824.371] (-824.881) (-825.338) (-823.180) * (-823.828) [-824.756] (-824.118) (-829.773) -- 0:00:42
309500 -- (-825.146) (-823.303) [-825.831] (-823.440) * (-823.916) (-823.763) (-824.949) [-824.155] -- 0:00:42
310000 -- (-825.967) (-823.701) [-824.763] (-824.884) * (-824.068) (-823.290) [-825.718] (-826.022) -- 0:00:42
Average standard deviation of split frequencies: 0.012299
310500 -- (-823.340) [-828.698] (-826.017) (-824.873) * (-823.468) (-825.434) (-825.688) [-827.624] -- 0:00:42
311000 -- (-823.908) (-825.046) (-826.810) [-827.070] * (-825.196) [-825.465] (-826.578) (-823.578) -- 0:00:42
311500 -- (-823.881) (-825.232) [-824.037] (-825.520) * (-825.891) [-824.086] (-831.739) (-824.637) -- 0:00:41
312000 -- [-824.428] (-823.342) (-827.053) (-826.821) * (-826.599) (-824.483) (-827.833) [-824.325] -- 0:00:41
312500 -- (-825.740) (-825.763) (-824.068) [-825.447] * (-823.725) [-824.301] (-827.611) (-825.844) -- 0:00:41
313000 -- (-826.358) (-826.327) [-825.837] (-824.275) * (-824.096) (-824.366) [-824.417] (-825.955) -- 0:00:43
313500 -- (-825.679) (-830.695) [-824.677] (-825.343) * [-823.416] (-824.281) (-828.605) (-831.755) -- 0:00:43
314000 -- (-826.309) [-824.907] (-828.663) (-825.387) * (-823.545) (-825.037) (-827.804) [-830.294] -- 0:00:43
314500 -- (-830.104) [-824.860] (-824.258) (-825.866) * (-823.133) (-824.015) [-825.167] (-824.764) -- 0:00:43
315000 -- (-827.387) (-823.974) (-823.501) [-825.032] * (-827.985) [-824.627] (-825.146) (-825.020) -- 0:00:43
Average standard deviation of split frequencies: 0.014128
315500 -- [-826.984] (-826.902) (-824.802) (-823.785) * (-827.143) (-824.183) (-827.381) [-824.826] -- 0:00:43
316000 -- [-824.794] (-824.324) (-825.024) (-823.828) * (-824.657) (-825.337) [-825.878] (-827.596) -- 0:00:43
316500 -- (-823.402) (-826.374) (-823.656) [-830.352] * (-823.967) (-824.230) (-823.966) [-823.602] -- 0:00:43
317000 -- (-825.536) (-827.813) [-826.028] (-825.503) * (-827.708) [-828.523] (-825.079) (-828.582) -- 0:00:43
317500 -- (-830.743) (-827.025) (-827.363) [-824.869] * (-824.074) (-824.774) (-824.792) [-824.122] -- 0:00:42
318000 -- [-831.517] (-825.255) (-826.052) (-823.617) * (-823.859) [-823.826] (-824.595) (-823.226) -- 0:00:42
318500 -- [-824.754] (-824.427) (-826.684) (-825.045) * [-824.956] (-824.703) (-823.742) (-824.197) -- 0:00:42
319000 -- (-823.602) [-827.291] (-826.917) (-824.684) * (-824.410) [-824.831] (-824.409) (-824.997) -- 0:00:42
319500 -- (-826.107) (-825.963) (-827.550) [-825.007] * (-823.963) [-826.745] (-824.414) (-824.603) -- 0:00:42
320000 -- (-825.386) [-823.336] (-826.513) (-830.034) * (-825.538) (-830.486) (-824.720) [-825.178] -- 0:00:42
Average standard deviation of split frequencies: 0.013639
320500 -- (-824.706) [-824.689] (-829.860) (-828.331) * (-827.751) (-828.803) [-824.583] (-825.949) -- 0:00:42
321000 -- (-825.255) (-826.733) [-825.577] (-825.438) * (-827.675) (-826.729) (-825.053) [-825.408] -- 0:00:42
321500 -- [-825.678] (-825.046) (-825.560) (-825.116) * [-827.084] (-825.113) (-823.192) (-826.241) -- 0:00:42
322000 -- (-824.803) (-824.566) (-827.470) [-829.194] * (-824.142) (-825.399) (-822.973) [-827.312] -- 0:00:42
322500 -- (-826.558) (-826.934) (-824.877) [-824.168] * (-823.702) (-826.074) [-824.974] (-826.457) -- 0:00:42
323000 -- (-824.997) (-829.662) (-824.086) [-823.627] * [-823.359] (-825.023) (-824.184) (-826.432) -- 0:00:41
323500 -- (-826.804) [-826.754] (-826.084) (-823.786) * (-825.257) (-828.095) (-824.695) [-823.797] -- 0:00:41
324000 -- (-824.315) (-823.285) (-825.622) [-826.896] * (-826.087) [-826.179] (-833.033) (-824.057) -- 0:00:41
324500 -- [-825.019] (-824.217) (-825.593) (-823.989) * [-826.090] (-833.676) (-827.385) (-825.224) -- 0:00:41
325000 -- (-823.217) (-823.947) [-824.678] (-824.784) * [-824.555] (-823.490) (-827.719) (-826.435) -- 0:00:41
Average standard deviation of split frequencies: 0.012862
325500 -- (-823.217) (-824.474) [-825.021] (-826.015) * (-824.811) [-823.688] (-828.038) (-824.398) -- 0:00:41
326000 -- (-823.698) [-826.007] (-824.805) (-825.995) * (-824.397) (-829.702) (-827.965) [-824.345] -- 0:00:41
326500 -- (-824.445) [-824.818] (-823.954) (-824.479) * [-825.485] (-828.262) (-826.864) (-823.789) -- 0:00:41
327000 -- [-823.522] (-823.680) (-823.373) (-825.698) * (-825.381) (-828.332) (-822.793) [-824.795] -- 0:00:41
327500 -- [-824.001] (-824.052) (-823.524) (-827.551) * (-824.549) (-825.393) [-823.950] (-824.553) -- 0:00:41
328000 -- (-824.488) (-826.351) [-825.587] (-827.399) * (-825.494) [-827.232] (-825.511) (-827.842) -- 0:00:40
328500 -- (-828.818) (-827.819) [-823.727] (-823.764) * (-824.804) (-825.695) (-826.776) [-828.483] -- 0:00:40
329000 -- (-829.059) (-825.440) (-823.424) [-824.079] * [-827.115] (-823.984) (-825.114) (-824.347) -- 0:00:42
329500 -- (-830.505) (-826.202) [-825.014] (-825.965) * (-824.108) (-826.207) [-825.112] (-823.613) -- 0:00:42
330000 -- (-831.313) (-826.772) [-825.539] (-823.676) * (-824.748) (-827.455) [-824.198] (-824.627) -- 0:00:42
Average standard deviation of split frequencies: 0.012906
330500 -- (-825.992) (-825.272) [-823.463] (-825.066) * (-826.781) (-825.446) (-831.459) [-829.738] -- 0:00:42
331000 -- (-827.554) [-826.228] (-825.102) (-824.430) * (-826.504) [-825.888] (-825.512) (-825.769) -- 0:00:42
331500 -- (-826.990) (-827.434) (-824.987) [-827.280] * [-826.271] (-825.327) (-823.217) (-826.189) -- 0:00:42
332000 -- [-832.903] (-829.359) (-823.019) (-832.411) * (-823.013) [-823.233] (-823.132) (-826.562) -- 0:00:42
332500 -- (-829.138) (-826.480) [-825.287] (-829.454) * (-823.038) (-824.982) [-827.622] (-826.857) -- 0:00:42
333000 -- [-830.170] (-826.120) (-823.340) (-826.906) * (-823.990) [-824.806] (-824.454) (-826.807) -- 0:00:42
333500 -- [-825.084] (-827.642) (-824.033) (-826.190) * (-823.582) (-824.085) (-829.235) [-823.140] -- 0:00:41
334000 -- (-826.841) (-826.753) (-824.806) [-827.001] * [-825.851] (-823.372) (-826.803) (-829.029) -- 0:00:41
334500 -- (-824.105) (-825.428) (-824.495) [-826.132] * [-823.485] (-825.617) (-825.766) (-826.892) -- 0:00:41
335000 -- (-824.059) (-824.702) [-823.936] (-825.595) * (-828.325) (-826.613) [-825.608] (-825.104) -- 0:00:41
Average standard deviation of split frequencies: 0.013365
335500 -- (-824.753) (-826.466) (-823.240) [-823.411] * (-823.093) [-826.201] (-825.619) (-829.661) -- 0:00:41
336000 -- (-825.913) (-824.569) [-824.263] (-825.045) * (-826.939) (-827.195) (-824.620) [-825.483] -- 0:00:41
336500 -- [-823.967] (-823.292) (-825.308) (-825.162) * (-826.493) [-823.400] (-829.647) (-827.479) -- 0:00:41
337000 -- [-826.220] (-823.794) (-827.095) (-827.576) * (-828.889) [-825.863] (-828.632) (-825.834) -- 0:00:41
337500 -- (-826.238) [-823.828] (-823.539) (-828.563) * (-825.480) (-827.569) [-825.773] (-825.748) -- 0:00:41
338000 -- (-824.428) (-823.710) [-823.909] (-825.360) * (-825.351) [-826.235] (-825.519) (-825.451) -- 0:00:41
338500 -- (-824.888) (-824.195) [-825.068] (-825.625) * (-825.508) (-825.044) [-823.829] (-825.459) -- 0:00:41
339000 -- (-826.856) (-827.842) [-823.954] (-825.119) * (-823.386) [-824.927] (-825.382) (-826.453) -- 0:00:40
339500 -- (-822.903) (-824.182) (-826.382) [-824.060] * (-827.152) (-823.545) [-823.645] (-825.341) -- 0:00:40
340000 -- (-824.515) (-826.152) [-825.717] (-825.627) * [-824.713] (-828.512) (-825.314) (-826.012) -- 0:00:40
Average standard deviation of split frequencies: 0.013530
340500 -- (-824.378) [-823.052] (-825.531) (-826.883) * (-823.442) (-828.062) [-824.396] (-826.835) -- 0:00:40
341000 -- (-824.804) (-825.481) [-824.017] (-833.304) * (-824.599) (-827.550) [-823.584] (-823.173) -- 0:00:40
341500 -- (-824.593) [-825.075] (-825.918) (-830.679) * (-827.497) (-827.190) (-824.972) [-826.802] -- 0:00:40
342000 -- (-824.907) [-825.195] (-826.817) (-827.113) * (-826.880) (-831.083) (-828.284) [-823.661] -- 0:00:40
342500 -- (-823.777) (-825.691) (-824.807) [-824.373] * [-826.295] (-836.074) (-827.203) (-822.744) -- 0:00:40
343000 -- [-824.156] (-825.734) (-824.357) (-828.838) * (-824.507) (-831.656) [-833.246] (-826.040) -- 0:00:40
343500 -- (-826.647) (-826.711) [-824.553] (-829.518) * (-823.971) (-826.748) [-824.618] (-824.202) -- 0:00:40
344000 -- (-823.588) (-825.214) [-823.924] (-825.790) * (-828.713) [-824.478] (-824.631) (-827.002) -- 0:00:40
344500 -- (-823.083) [-823.768] (-825.075) (-824.878) * (-824.065) (-823.634) (-830.013) [-827.764] -- 0:00:39
345000 -- [-823.601] (-826.947) (-825.930) (-823.385) * (-827.305) (-824.261) (-832.788) [-825.574] -- 0:00:39
Average standard deviation of split frequencies: 0.013397
345500 -- (-827.095) [-823.833] (-824.862) (-824.824) * (-827.472) [-825.486] (-825.754) (-823.248) -- 0:00:39
346000 -- [-824.108] (-826.080) (-824.379) (-824.658) * (-825.385) (-827.566) (-827.486) [-827.011] -- 0:00:41
346500 -- (-824.069) [-823.295] (-826.735) (-825.024) * (-823.145) (-830.221) (-824.130) [-825.141] -- 0:00:41
347000 -- (-826.880) (-825.307) [-827.077] (-824.123) * [-823.921] (-823.738) (-825.911) (-824.226) -- 0:00:41
347500 -- (-824.695) (-825.773) [-827.169] (-824.771) * [-824.402] (-824.348) (-827.174) (-822.983) -- 0:00:41
348000 -- (-823.391) (-828.029) [-825.250] (-832.289) * (-824.248) (-825.001) [-823.820] (-824.251) -- 0:00:41
348500 -- (-823.882) [-825.322] (-825.667) (-833.276) * (-824.428) (-824.308) [-826.868] (-826.133) -- 0:00:41
349000 -- [-824.740] (-827.819) (-828.353) (-824.809) * [-823.900] (-826.858) (-823.583) (-825.646) -- 0:00:41
349500 -- [-824.740] (-826.477) (-829.367) (-824.358) * (-823.875) [-826.299] (-823.803) (-824.501) -- 0:00:40
350000 -- (-825.398) (-826.531) [-824.821] (-823.025) * (-825.778) (-826.511) [-826.556] (-826.290) -- 0:00:40
Average standard deviation of split frequencies: 0.013219
350500 -- (-822.985) [-824.550] (-824.310) (-824.799) * (-826.548) (-827.889) [-825.639] (-826.161) -- 0:00:40
351000 -- (-826.039) (-824.456) (-825.349) [-825.846] * [-823.992] (-825.402) (-823.600) (-824.827) -- 0:00:40
351500 -- (-828.128) (-827.194) [-825.740] (-824.242) * [-823.599] (-825.917) (-826.876) (-827.224) -- 0:00:40
352000 -- (-827.519) (-828.189) [-824.333] (-825.380) * [-825.459] (-823.795) (-827.545) (-829.291) -- 0:00:40
352500 -- [-827.600] (-828.479) (-824.547) (-824.092) * (-823.690) [-828.303] (-824.519) (-826.479) -- 0:00:40
353000 -- [-823.972] (-824.769) (-827.182) (-827.076) * (-823.837) [-826.419] (-826.832) (-823.871) -- 0:00:40
353500 -- (-826.780) (-824.771) [-829.995] (-825.611) * (-825.405) (-824.547) [-826.371] (-826.720) -- 0:00:40
354000 -- (-824.829) (-824.096) [-826.685] (-824.300) * [-825.150] (-832.202) (-827.811) (-827.675) -- 0:00:40
354500 -- (-823.344) [-825.140] (-825.354) (-826.950) * (-827.623) [-825.848] (-828.250) (-825.804) -- 0:00:40
355000 -- (-830.135) (-825.604) (-827.347) [-825.248] * (-831.913) [-826.017] (-827.546) (-826.165) -- 0:00:39
Average standard deviation of split frequencies: 0.013095
355500 -- [-827.138] (-823.573) (-825.830) (-826.160) * (-828.733) (-823.603) [-826.297] (-825.512) -- 0:00:39
356000 -- (-826.656) [-824.984] (-828.910) (-826.828) * (-825.511) (-826.513) (-827.040) [-831.470] -- 0:00:39
356500 -- [-827.542] (-826.365) (-826.436) (-824.912) * (-826.329) (-824.584) [-824.091] (-826.620) -- 0:00:39
357000 -- [-825.296] (-830.832) (-827.390) (-825.998) * (-830.774) [-826.881] (-823.713) (-827.693) -- 0:00:39
357500 -- [-825.408] (-828.042) (-825.143) (-825.224) * [-828.244] (-824.941) (-827.539) (-824.252) -- 0:00:39
358000 -- (-827.212) (-824.228) (-825.336) [-825.988] * [-825.409] (-824.305) (-825.120) (-825.461) -- 0:00:39
358500 -- (-830.870) (-825.978) [-823.647] (-823.390) * (-825.720) (-824.777) (-824.238) [-824.612] -- 0:00:39
359000 -- (-824.650) (-827.478) (-825.281) [-825.257] * [-824.688] (-824.678) (-823.895) (-825.567) -- 0:00:39
359500 -- (-824.357) [-824.929] (-824.211) (-828.534) * (-824.471) [-824.786] (-825.449) (-825.806) -- 0:00:39
360000 -- (-826.949) [-826.588] (-824.584) (-824.311) * (-824.594) [-825.219] (-823.797) (-826.537) -- 0:00:39
Average standard deviation of split frequencies: 0.012532
360500 -- (-825.593) (-825.368) (-823.803) [-826.122] * [-823.821] (-828.347) (-824.253) (-824.459) -- 0:00:39
361000 -- [-824.299] (-826.438) (-824.905) (-823.954) * (-824.679) [-829.176] (-825.611) (-824.447) -- 0:00:38
361500 -- [-826.435] (-824.641) (-826.440) (-828.917) * (-825.684) [-828.057] (-823.955) (-824.373) -- 0:00:38
362000 -- [-823.488] (-826.050) (-823.930) (-831.841) * (-827.133) (-827.592) (-824.485) [-823.995] -- 0:00:38
362500 -- (-825.145) [-823.653] (-823.485) (-827.543) * (-823.378) [-823.538] (-823.610) (-824.781) -- 0:00:40
363000 -- (-824.703) (-825.318) (-824.279) [-824.827] * (-825.845) (-823.360) (-824.178) [-824.930] -- 0:00:40
363500 -- [-823.540] (-824.069) (-825.781) (-825.482) * [-824.213] (-824.630) (-824.502) (-828.142) -- 0:00:40
364000 -- (-826.784) (-825.259) [-825.278] (-824.840) * [-825.245] (-823.221) (-826.176) (-825.682) -- 0:00:40
364500 -- [-823.726] (-825.161) (-825.365) (-828.129) * (-829.623) (-829.513) [-827.605] (-824.855) -- 0:00:40
365000 -- (-824.098) [-823.912] (-831.936) (-825.241) * (-825.738) (-826.709) (-827.302) [-826.093] -- 0:00:40
Average standard deviation of split frequencies: 0.011663
365500 -- [-825.625] (-829.453) (-826.930) (-824.418) * (-827.602) (-824.643) (-826.291) [-826.869] -- 0:00:39
366000 -- (-826.718) (-825.542) (-830.486) [-827.730] * (-825.819) (-823.311) [-824.706] (-823.739) -- 0:00:39
366500 -- (-827.404) (-825.553) (-831.377) [-824.128] * (-826.480) (-828.643) (-825.192) [-823.658] -- 0:00:39
367000 -- (-826.431) [-826.008] (-825.057) (-824.342) * (-825.203) (-827.643) (-823.662) [-825.272] -- 0:00:39
367500 -- (-828.155) (-825.021) (-826.206) [-828.019] * (-824.859) [-824.388] (-825.638) (-828.623) -- 0:00:39
368000 -- [-823.925] (-823.335) (-827.846) (-830.794) * (-823.040) (-824.417) [-827.338] (-825.686) -- 0:00:39
368500 -- (-823.807) [-825.184] (-826.495) (-826.626) * (-824.405) (-823.581) (-830.418) [-824.736] -- 0:00:39
369000 -- (-827.696) (-823.993) [-823.911] (-826.386) * (-826.927) [-823.073] (-826.722) (-827.763) -- 0:00:39
369500 -- [-825.501] (-828.751) (-824.591) (-826.832) * (-825.340) [-823.006] (-823.253) (-826.220) -- 0:00:39
370000 -- (-825.428) (-825.591) (-826.229) [-825.901] * [-823.664] (-824.622) (-823.395) (-825.941) -- 0:00:39
Average standard deviation of split frequencies: 0.011163
370500 -- (-823.886) (-826.497) (-825.765) [-827.590] * (-823.827) [-824.818] (-823.267) (-826.822) -- 0:00:39
371000 -- (-825.324) (-826.992) (-828.599) [-826.194] * (-823.571) (-824.708) (-826.609) [-824.140] -- 0:00:38
371500 -- [-823.645] (-825.503) (-825.928) (-823.584) * (-826.761) (-825.100) [-823.608] (-823.704) -- 0:00:38
372000 -- (-824.273) (-828.334) [-825.391] (-824.181) * (-824.754) (-824.252) [-824.269] (-824.523) -- 0:00:38
372500 -- [-829.135] (-828.203) (-825.732) (-824.068) * [-826.072] (-832.152) (-825.336) (-825.219) -- 0:00:38
373000 -- [-824.347] (-824.451) (-829.033) (-827.803) * (-826.005) [-825.579] (-827.454) (-824.859) -- 0:00:38
373500 -- [-824.456] (-824.407) (-826.478) (-829.591) * [-824.089] (-829.036) (-827.879) (-824.487) -- 0:00:38
374000 -- [-823.604] (-825.003) (-829.798) (-827.481) * (-825.895) [-826.555] (-823.114) (-827.224) -- 0:00:38
374500 -- [-824.282] (-825.825) (-825.022) (-830.022) * (-825.924) [-826.309] (-827.926) (-824.410) -- 0:00:38
375000 -- (-828.025) (-825.492) (-826.223) [-826.723] * (-831.078) (-824.666) [-826.716] (-825.751) -- 0:00:38
Average standard deviation of split frequencies: 0.010694
375500 -- (-824.023) [-825.737] (-824.845) (-824.047) * (-830.350) [-825.046] (-824.206) (-824.076) -- 0:00:38
376000 -- (-825.400) [-825.871] (-827.914) (-826.788) * (-827.801) (-827.294) (-825.472) [-824.379] -- 0:00:38
376500 -- (-826.254) (-824.165) [-826.991] (-823.190) * (-827.460) (-825.696) [-825.154] (-824.206) -- 0:00:38
377000 -- (-823.731) [-825.976] (-824.987) (-828.147) * (-827.315) [-826.469] (-825.516) (-824.664) -- 0:00:38
377500 -- (-823.647) (-826.383) (-823.842) [-823.434] * (-824.044) [-827.397] (-824.532) (-827.527) -- 0:00:37
378000 -- (-825.536) [-824.828] (-823.998) (-827.020) * (-825.275) (-824.524) (-826.014) [-823.816] -- 0:00:37
378500 -- (-828.409) [-824.244] (-824.951) (-825.702) * (-825.603) [-823.461] (-827.068) (-823.561) -- 0:00:37
379000 -- (-828.390) (-823.863) [-824.330] (-824.633) * (-825.395) (-825.682) [-825.002] (-824.781) -- 0:00:37
379500 -- (-825.404) (-828.531) [-825.283] (-825.915) * [-824.652] (-827.237) (-824.997) (-824.090) -- 0:00:39
380000 -- (-826.047) (-824.613) [-825.273] (-825.916) * [-824.490] (-827.168) (-827.262) (-826.273) -- 0:00:39
Average standard deviation of split frequencies: 0.009632
380500 -- (-827.138) (-824.835) [-824.082] (-824.542) * (-824.532) (-825.409) (-823.099) [-823.446] -- 0:00:39
381000 -- (-828.704) (-824.354) (-823.006) [-824.838] * (-823.520) (-823.526) (-824.964) [-825.090] -- 0:00:38
381500 -- (-827.134) (-827.187) [-824.113] (-825.695) * [-823.565] (-826.794) (-825.263) (-823.952) -- 0:00:38
382000 -- [-824.066] (-823.691) (-825.676) (-823.447) * [-825.186] (-823.222) (-826.257) (-823.660) -- 0:00:38
382500 -- (-823.679) [-823.114] (-824.940) (-823.500) * (-823.915) (-824.730) (-823.128) [-825.897] -- 0:00:38
383000 -- (-824.990) (-822.962) [-826.149] (-825.711) * (-823.336) (-823.198) [-824.169] (-825.419) -- 0:00:38
383500 -- [-825.089] (-822.948) (-827.172) (-823.732) * (-823.450) (-823.135) [-826.862] (-830.299) -- 0:00:38
384000 -- (-825.035) (-824.498) (-827.259) [-823.993] * (-824.283) (-825.078) [-824.786] (-829.894) -- 0:00:38
384500 -- (-826.738) (-829.388) [-827.100] (-823.959) * [-824.428] (-826.680) (-824.784) (-824.772) -- 0:00:38
385000 -- (-825.343) [-824.509] (-828.548) (-826.235) * (-825.057) (-832.172) (-825.841) [-826.897] -- 0:00:38
Average standard deviation of split frequencies: 0.010734
385500 -- [-828.658] (-826.921) (-826.483) (-823.398) * (-826.294) (-826.662) (-827.601) [-824.064] -- 0:00:38
386000 -- [-829.570] (-825.300) (-828.123) (-823.490) * (-829.259) (-830.362) (-827.482) [-828.072] -- 0:00:38
386500 -- [-827.921] (-825.722) (-827.702) (-823.733) * [-823.307] (-828.552) (-826.494) (-823.151) -- 0:00:38
387000 -- (-823.205) [-824.930] (-827.330) (-824.638) * (-824.944) (-826.343) [-824.276] (-823.767) -- 0:00:38
387500 -- [-825.545] (-824.127) (-827.906) (-827.421) * [-823.290] (-825.817) (-824.684) (-832.350) -- 0:00:37
388000 -- (-823.793) (-828.926) [-827.104] (-826.919) * (-823.097) (-824.309) (-823.817) [-825.388] -- 0:00:37
388500 -- [-823.385] (-824.506) (-824.494) (-825.727) * (-823.224) [-825.581] (-827.596) (-824.710) -- 0:00:37
389000 -- (-825.406) [-824.917] (-827.356) (-825.441) * (-823.421) (-825.588) (-828.970) [-825.494] -- 0:00:37
389500 -- (-824.265) [-825.298] (-826.269) (-826.342) * (-824.534) (-824.593) [-824.150] (-825.355) -- 0:00:37
390000 -- (-828.617) (-825.905) (-824.865) [-828.459] * [-828.222] (-826.661) (-824.088) (-829.236) -- 0:00:37
Average standard deviation of split frequencies: 0.010726
390500 -- (-824.172) [-824.613] (-825.406) (-823.380) * (-824.811) [-823.437] (-823.991) (-825.929) -- 0:00:37
391000 -- (-827.037) [-825.324] (-825.837) (-823.239) * (-826.122) (-824.451) (-824.111) [-823.678] -- 0:00:37
391500 -- (-829.529) (-824.130) [-825.583] (-826.829) * (-825.245) (-826.094) [-824.988] (-823.314) -- 0:00:37
392000 -- (-826.130) (-824.451) [-824.310] (-826.612) * [-829.195] (-824.357) (-826.996) (-824.095) -- 0:00:37
392500 -- (-827.999) [-823.474] (-826.403) (-824.579) * (-826.024) [-824.140] (-825.773) (-826.674) -- 0:00:37
393000 -- (-826.717) (-830.979) (-828.990) [-823.258] * [-827.747] (-827.170) (-825.750) (-825.332) -- 0:00:37
393500 -- (-825.274) (-828.773) [-827.518] (-827.736) * (-827.099) [-824.376] (-823.802) (-823.227) -- 0:00:36
394000 -- (-827.595) [-825.923] (-824.321) (-825.770) * [-826.610] (-828.116) (-823.896) (-826.205) -- 0:00:36
394500 -- (-825.377) (-824.927) (-825.732) [-823.778] * (-827.821) (-823.218) (-826.466) [-826.009] -- 0:00:36
395000 -- [-824.494] (-822.939) (-825.448) (-826.551) * (-822.938) (-827.248) (-825.450) [-827.557] -- 0:00:36
Average standard deviation of split frequencies: 0.011274
395500 -- [-823.890] (-827.054) (-824.172) (-825.152) * [-824.912] (-826.852) (-826.349) (-828.015) -- 0:00:36
396000 -- (-824.437) (-826.546) [-823.464] (-826.585) * (-823.530) (-825.531) [-827.125] (-835.039) -- 0:00:38
396500 -- (-825.528) [-823.464] (-824.963) (-825.284) * (-825.249) (-823.945) (-824.205) [-825.318] -- 0:00:38
397000 -- (-826.562) (-827.377) [-826.697] (-830.195) * (-823.891) [-826.314] (-825.193) (-827.074) -- 0:00:37
397500 -- (-824.793) [-826.078] (-825.406) (-825.573) * (-823.995) (-826.894) (-823.773) [-823.284] -- 0:00:37
398000 -- [-824.203] (-825.088) (-825.067) (-824.907) * (-824.541) [-824.938] (-822.907) (-823.352) -- 0:00:37
398500 -- [-824.740] (-824.398) (-826.263) (-826.931) * (-828.037) [-826.229] (-825.301) (-824.967) -- 0:00:37
399000 -- [-828.098] (-825.016) (-825.212) (-826.633) * (-824.343) (-830.464) (-824.463) [-825.015] -- 0:00:37
399500 -- [-825.858] (-825.308) (-824.828) (-826.973) * (-827.367) [-826.270] (-824.607) (-825.444) -- 0:00:37
400000 -- [-828.744] (-829.421) (-827.043) (-824.160) * (-828.301) (-826.281) [-826.937] (-823.690) -- 0:00:37
Average standard deviation of split frequencies: 0.011889
400500 -- (-824.679) [-825.775] (-824.559) (-827.651) * (-825.532) (-827.034) (-833.127) [-827.278] -- 0:00:37
401000 -- (-825.629) (-827.217) (-824.573) [-824.515] * (-824.924) [-828.003] (-825.014) (-827.196) -- 0:00:37
401500 -- [-826.429] (-825.282) (-823.796) (-823.787) * (-825.547) (-829.518) [-823.803] (-826.932) -- 0:00:37
402000 -- (-830.248) [-823.770] (-824.109) (-825.103) * [-824.549] (-825.114) (-829.291) (-830.449) -- 0:00:37
402500 -- [-825.677] (-827.684) (-825.644) (-827.758) * (-825.448) [-824.787] (-827.248) (-824.886) -- 0:00:37
403000 -- (-828.311) (-826.018) (-824.893) [-825.378] * (-823.943) (-824.618) [-826.941] (-824.766) -- 0:00:37
403500 -- (-825.555) [-825.502] (-825.236) (-826.339) * (-825.243) (-824.959) (-823.464) [-826.356] -- 0:00:36
404000 -- (-824.358) (-827.771) [-827.385] (-827.047) * (-825.665) (-823.409) [-825.813] (-826.058) -- 0:00:36
404500 -- (-824.585) [-825.382] (-824.757) (-824.136) * (-826.222) (-824.130) (-833.492) [-825.503] -- 0:00:36
405000 -- [-824.160] (-828.512) (-824.570) (-825.977) * (-823.998) (-824.151) (-826.326) [-825.471] -- 0:00:36
Average standard deviation of split frequencies: 0.011672
405500 -- (-827.041) (-824.655) [-825.501] (-825.720) * (-824.947) (-825.369) (-824.804) [-823.941] -- 0:00:36
406000 -- (-824.451) (-826.732) [-825.215] (-825.498) * (-824.667) (-826.217) [-823.584] (-823.663) -- 0:00:36
406500 -- (-824.076) (-826.806) [-822.841] (-826.870) * [-824.008] (-826.677) (-824.096) (-824.963) -- 0:00:36
407000 -- (-824.771) (-823.591) [-825.689] (-825.404) * (-824.285) (-826.627) (-824.205) [-823.813] -- 0:00:36
407500 -- (-824.330) (-824.534) (-826.232) [-824.121] * (-824.980) [-828.063] (-824.092) (-828.972) -- 0:00:36
408000 -- (-827.699) (-825.011) [-827.708] (-826.040) * (-824.118) (-826.601) [-823.904] (-827.762) -- 0:00:36
408500 -- [-828.236] (-825.023) (-825.117) (-828.688) * (-823.219) (-824.823) [-823.694] (-823.162) -- 0:00:36
409000 -- (-824.091) [-824.548] (-824.069) (-826.767) * (-824.143) (-825.741) [-824.163] (-825.302) -- 0:00:36
409500 -- [-827.067] (-829.688) (-826.295) (-825.496) * (-825.246) (-830.844) (-824.359) [-825.180] -- 0:00:36
410000 -- (-826.393) (-824.670) [-824.545] (-824.645) * (-823.749) (-826.588) (-823.815) [-824.185] -- 0:00:35
Average standard deviation of split frequencies: 0.011224
410500 -- [-824.434] (-824.730) (-825.196) (-824.170) * [-826.706] (-824.801) (-823.976) (-825.622) -- 0:00:35
411000 -- (-828.146) (-825.702) [-825.008] (-823.969) * (-826.934) (-825.639) [-823.968] (-825.506) -- 0:00:35
411500 -- (-826.034) [-826.638] (-827.815) (-824.026) * (-824.519) [-824.702] (-823.249) (-825.449) -- 0:00:35
412000 -- (-825.574) (-834.564) [-825.165] (-825.527) * [-827.692] (-825.773) (-825.484) (-824.417) -- 0:00:35
412500 -- [-824.418] (-824.711) (-828.514) (-828.158) * (-824.899) (-827.260) (-826.694) [-827.376] -- 0:00:37
413000 -- [-823.644] (-825.158) (-825.190) (-828.887) * (-823.676) (-825.924) (-828.311) [-824.617] -- 0:00:36
413500 -- (-824.097) [-825.249] (-827.816) (-825.445) * (-823.771) (-826.663) (-826.630) [-823.591] -- 0:00:36
414000 -- [-824.528] (-825.028) (-829.947) (-825.501) * (-824.900) [-823.498] (-830.223) (-825.151) -- 0:00:36
414500 -- [-825.150] (-825.718) (-829.148) (-824.006) * (-829.615) [-823.750] (-826.463) (-825.710) -- 0:00:36
415000 -- (-826.043) (-827.083) [-824.757] (-824.731) * (-824.894) (-823.498) (-825.667) [-825.224] -- 0:00:36
Average standard deviation of split frequencies: 0.010576
415500 -- (-827.832) [-826.492] (-824.374) (-827.334) * (-823.951) [-827.543] (-826.692) (-826.396) -- 0:00:36
416000 -- [-828.683] (-825.649) (-824.507) (-824.083) * [-827.093] (-828.232) (-827.668) (-825.874) -- 0:00:36
416500 -- (-826.850) (-824.817) (-827.961) [-823.552] * [-826.127] (-828.110) (-829.689) (-825.211) -- 0:00:36
417000 -- (-824.658) (-825.699) (-824.285) [-824.003] * (-826.121) [-827.003] (-826.665) (-825.090) -- 0:00:36
417500 -- (-823.288) (-827.834) (-824.063) [-824.919] * (-823.971) (-825.092) [-823.152] (-824.165) -- 0:00:36
418000 -- (-829.105) (-826.396) [-826.532] (-825.717) * [-826.820] (-826.079) (-824.948) (-825.529) -- 0:00:36
418500 -- (-826.552) [-826.126] (-827.024) (-824.382) * (-824.143) [-827.314] (-823.871) (-824.810) -- 0:00:36
419000 -- (-825.590) (-826.722) [-823.727] (-824.821) * (-824.644) (-828.108) (-825.729) [-823.691] -- 0:00:36
419500 -- (-826.349) (-825.967) [-823.557] (-823.983) * (-826.725) [-823.727] (-824.336) (-823.908) -- 0:00:35
420000 -- [-823.345] (-823.969) (-823.645) (-823.801) * [-823.813] (-826.081) (-824.559) (-823.945) -- 0:00:35
Average standard deviation of split frequencies: 0.011338
420500 -- (-824.865) (-824.132) (-825.698) [-824.901] * [-823.842] (-826.782) (-827.314) (-826.516) -- 0:00:35
421000 -- (-826.497) (-826.264) (-823.545) [-824.638] * (-825.810) (-823.334) (-824.039) [-823.535] -- 0:00:35
421500 -- (-829.286) (-825.405) [-823.191] (-824.739) * (-824.646) [-826.531] (-827.042) (-826.237) -- 0:00:35
422000 -- (-828.515) (-827.476) [-823.347] (-824.433) * [-825.903] (-825.464) (-826.102) (-825.042) -- 0:00:35
422500 -- [-825.946] (-824.501) (-824.298) (-827.034) * (-824.883) (-827.021) [-823.983] (-826.276) -- 0:00:35
423000 -- (-826.306) (-824.006) (-825.723) [-824.464] * (-824.346) (-828.874) [-826.176] (-823.547) -- 0:00:35
423500 -- (-827.733) (-824.300) (-828.617) [-824.072] * [-825.703] (-826.792) (-825.073) (-827.704) -- 0:00:35
424000 -- (-827.646) (-824.061) (-826.424) [-826.010] * (-824.890) (-830.148) (-823.716) [-827.141] -- 0:00:35
424500 -- (-827.337) [-826.148] (-823.539) (-827.691) * [-824.756] (-826.801) (-825.678) (-826.310) -- 0:00:35
425000 -- (-831.803) [-824.564] (-823.254) (-831.896) * (-823.179) [-825.679] (-824.062) (-824.160) -- 0:00:35
Average standard deviation of split frequencies: 0.011988
425500 -- (-825.555) [-822.822] (-823.688) (-826.221) * (-823.913) (-823.273) [-825.562] (-829.120) -- 0:00:35
426000 -- (-823.968) [-824.918] (-823.528) (-826.298) * (-824.289) (-824.204) [-825.183] (-826.932) -- 0:00:35
426500 -- (-829.325) (-825.368) [-823.593] (-824.612) * (-824.362) (-825.722) (-825.937) [-824.969] -- 0:00:34
427000 -- (-830.763) [-825.952] (-824.340) (-828.614) * (-823.712) (-826.238) [-829.051] (-829.232) -- 0:00:34
427500 -- (-825.614) [-823.667] (-827.385) (-827.615) * [-826.559] (-824.680) (-824.961) (-827.115) -- 0:00:34
428000 -- (-827.655) [-824.708] (-828.530) (-824.819) * (-824.237) (-826.010) (-826.848) [-824.171] -- 0:00:34
428500 -- (-824.386) (-824.617) (-824.911) [-826.178] * (-827.403) (-827.757) [-825.086] (-824.635) -- 0:00:34
429000 -- (-827.063) (-828.088) (-828.853) [-822.990] * (-827.823) [-824.941] (-824.204) (-825.613) -- 0:00:35
429500 -- (-830.037) (-824.474) [-824.927] (-824.887) * (-824.435) [-824.454] (-824.248) (-824.996) -- 0:00:35
430000 -- [-825.232] (-823.941) (-826.170) (-825.798) * (-824.375) (-823.966) [-823.727] (-827.339) -- 0:00:35
Average standard deviation of split frequencies: 0.011268
430500 -- [-824.905] (-825.512) (-826.851) (-824.400) * [-824.390] (-824.367) (-824.941) (-827.633) -- 0:00:35
431000 -- (-823.842) (-828.752) [-824.410] (-823.749) * (-825.938) (-824.692) [-832.449] (-824.694) -- 0:00:35
431500 -- [-823.770] (-828.763) (-823.106) (-826.224) * (-823.577) (-825.170) [-825.041] (-823.553) -- 0:00:35
432000 -- (-825.735) (-825.696) (-824.482) [-824.043] * [-823.536] (-823.857) (-825.749) (-823.332) -- 0:00:35
432500 -- (-823.474) (-825.765) (-825.513) [-824.158] * (-825.339) [-825.586] (-825.697) (-823.885) -- 0:00:35
433000 -- (-825.078) [-825.000] (-823.722) (-826.891) * [-825.224] (-825.428) (-824.624) (-826.086) -- 0:00:35
433500 -- (-833.522) (-827.682) (-823.475) [-825.004] * [-825.752] (-825.406) (-823.305) (-824.152) -- 0:00:35
434000 -- (-828.505) [-829.856] (-823.904) (-825.317) * (-823.881) (-827.657) (-824.317) [-825.018] -- 0:00:35
434500 -- (-826.313) (-829.876) [-823.514] (-823.239) * (-823.106) (-827.532) (-823.279) [-824.979] -- 0:00:35
435000 -- (-826.341) [-823.548] (-827.639) (-823.334) * [-823.988] (-823.411) (-823.522) (-823.005) -- 0:00:35
Average standard deviation of split frequencies: 0.011015
435500 -- (-825.175) (-826.927) [-824.491] (-826.552) * [-822.826] (-824.597) (-824.214) (-825.053) -- 0:00:34
436000 -- [-827.572] (-826.491) (-829.490) (-826.295) * (-823.489) (-826.465) [-824.189] (-826.257) -- 0:00:34
436500 -- (-825.393) (-827.027) [-827.859] (-828.433) * (-825.159) (-825.993) [-824.065] (-824.643) -- 0:00:34
437000 -- [-824.236] (-826.981) (-823.454) (-823.068) * [-824.058] (-823.342) (-824.285) (-824.937) -- 0:00:34
437500 -- (-824.434) [-825.369] (-825.381) (-829.855) * (-824.276) (-825.948) (-828.995) [-824.416] -- 0:00:34
438000 -- (-825.420) [-828.011] (-832.140) (-826.578) * (-825.800) (-824.736) (-827.425) [-825.550] -- 0:00:34
438500 -- (-824.635) [-826.015] (-825.588) (-823.653) * [-824.319] (-824.380) (-824.731) (-825.074) -- 0:00:34
439000 -- [-823.619] (-827.260) (-825.384) (-829.470) * (-826.150) [-824.307] (-827.688) (-825.728) -- 0:00:34
439500 -- (-825.113) [-825.556] (-829.678) (-825.691) * (-823.327) (-825.384) (-827.309) [-824.767] -- 0:00:34
440000 -- (-824.510) [-826.093] (-827.223) (-825.416) * [-823.559] (-824.639) (-823.830) (-827.311) -- 0:00:34
Average standard deviation of split frequencies: 0.011299
440500 -- (-824.135) (-825.299) (-828.234) [-825.308] * [-823.621] (-824.810) (-823.234) (-825.502) -- 0:00:34
441000 -- (-823.375) [-826.069] (-824.252) (-825.640) * (-824.994) (-825.502) (-827.356) [-824.895] -- 0:00:34
441500 -- [-823.269] (-826.895) (-826.863) (-825.801) * [-823.938] (-825.337) (-828.446) (-826.412) -- 0:00:34
442000 -- (-825.041) [-823.635] (-829.964) (-826.537) * (-826.505) [-824.406] (-824.555) (-826.592) -- 0:00:34
442500 -- [-825.894] (-827.775) (-823.208) (-825.092) * (-826.135) (-824.082) [-828.636] (-829.213) -- 0:00:34
443000 -- (-826.109) [-823.805] (-823.519) (-824.940) * (-824.539) (-827.511) [-823.097] (-826.079) -- 0:00:33
443500 -- (-825.140) (-826.255) (-823.465) [-824.145] * [-828.862] (-826.128) (-825.284) (-826.007) -- 0:00:33
444000 -- (-823.752) (-825.016) [-824.421] (-825.743) * (-824.890) (-828.213) (-826.031) [-823.175] -- 0:00:33
444500 -- (-823.854) (-824.194) (-824.992) [-827.958] * (-823.169) (-830.537) (-826.384) [-825.204] -- 0:00:33
445000 -- (-825.634) (-827.982) (-829.038) [-825.015] * (-824.793) (-824.948) (-822.887) [-828.206] -- 0:00:33
Average standard deviation of split frequencies: 0.010636
445500 -- (-828.355) (-825.413) (-824.283) [-825.623] * (-824.652) (-827.098) [-824.986] (-826.830) -- 0:00:34
446000 -- (-827.744) (-830.144) (-824.225) [-825.120] * [-824.784] (-827.417) (-826.716) (-824.673) -- 0:00:34
446500 -- (-830.247) [-826.947] (-823.143) (-830.453) * (-825.933) (-826.540) (-823.940) [-823.735] -- 0:00:34
447000 -- (-826.949) [-828.407] (-824.161) (-828.567) * (-830.242) (-823.943) (-825.097) [-827.516] -- 0:00:34
447500 -- (-823.626) (-824.149) (-822.974) [-823.342] * [-829.213] (-823.930) (-824.035) (-825.276) -- 0:00:34
448000 -- (-826.550) (-824.027) [-823.437] (-823.681) * (-824.136) (-826.108) [-826.488] (-825.171) -- 0:00:34
448500 -- (-823.227) [-824.782] (-823.571) (-824.169) * [-824.140] (-826.100) (-827.062) (-824.453) -- 0:00:34
449000 -- [-824.096] (-824.275) (-825.022) (-828.597) * (-828.038) [-826.123] (-825.929) (-823.033) -- 0:00:34
449500 -- (-825.032) [-825.230] (-828.909) (-823.393) * (-827.064) (-823.204) [-825.929] (-832.324) -- 0:00:34
450000 -- (-826.428) (-825.687) [-824.587] (-824.113) * (-823.913) (-824.942) (-827.360) [-826.261] -- 0:00:34
Average standard deviation of split frequencies: 0.010787
450500 -- (-823.220) (-828.377) [-824.359] (-824.500) * [-824.463] (-824.026) (-827.690) (-823.636) -- 0:00:34
451000 -- (-826.632) (-824.248) (-825.272) [-824.334] * (-825.002) (-826.842) (-828.514) [-823.748] -- 0:00:34
451500 -- (-825.874) [-827.301] (-824.799) (-824.323) * (-829.342) [-824.416] (-827.294) (-825.979) -- 0:00:34
452000 -- [-824.613] (-824.773) (-823.983) (-824.801) * (-828.865) (-824.815) (-823.488) [-824.686] -- 0:00:33
452500 -- (-825.461) (-823.584) [-828.680] (-826.854) * (-825.546) (-825.974) (-823.415) [-825.027] -- 0:00:33
453000 -- [-824.584] (-826.499) (-827.446) (-824.029) * (-824.659) (-834.761) (-823.799) [-824.839] -- 0:00:33
453500 -- [-823.834] (-828.883) (-824.382) (-823.730) * (-828.068) (-823.920) (-825.096) [-823.727] -- 0:00:33
454000 -- (-824.861) (-825.935) (-825.145) [-823.988] * (-826.051) (-827.465) (-823.384) [-825.038] -- 0:00:33
454500 -- (-823.994) (-826.212) (-825.372) [-823.372] * (-826.890) (-825.851) (-823.642) [-825.414] -- 0:00:33
455000 -- (-823.288) [-825.769] (-824.719) (-828.883) * (-828.713) (-824.008) [-825.458] (-823.546) -- 0:00:33
Average standard deviation of split frequencies: 0.011178
455500 -- (-823.089) (-823.785) [-823.473] (-825.765) * (-828.071) (-823.930) [-824.169] (-827.401) -- 0:00:33
456000 -- [-823.067] (-826.050) (-826.769) (-824.727) * (-833.242) (-825.299) (-828.926) [-824.959] -- 0:00:33
456500 -- (-824.266) (-824.044) [-825.602] (-823.758) * (-826.608) [-824.151] (-827.799) (-824.358) -- 0:00:33
457000 -- [-823.525] (-825.285) (-824.465) (-823.029) * [-823.949] (-825.171) (-825.977) (-825.046) -- 0:00:33
457500 -- (-823.392) (-825.162) [-823.710] (-823.284) * (-826.899) (-825.786) (-828.453) [-824.339] -- 0:00:33
458000 -- [-824.050] (-823.919) (-824.977) (-824.737) * (-826.034) [-824.743] (-826.106) (-825.592) -- 0:00:33
458500 -- (-823.852) (-823.940) [-826.243] (-824.484) * (-828.951) [-824.982] (-827.803) (-826.675) -- 0:00:33
459000 -- (-823.859) [-824.141] (-823.775) (-826.020) * (-826.411) [-823.990] (-826.358) (-825.521) -- 0:00:33
459500 -- (-823.900) [-823.492] (-823.942) (-827.780) * (-826.950) [-826.418] (-824.347) (-824.542) -- 0:00:32
460000 -- (-825.070) [-824.809] (-826.285) (-826.304) * (-827.083) [-826.846] (-824.694) (-825.354) -- 0:00:32
Average standard deviation of split frequencies: 0.010895
460500 -- (-824.436) (-826.038) [-823.621] (-825.625) * (-824.280) [-825.926] (-824.107) (-824.297) -- 0:00:32
461000 -- (-827.170) [-827.928] (-823.464) (-825.497) * (-824.815) [-825.133] (-823.722) (-825.624) -- 0:00:32
461500 -- (-827.879) [-823.809] (-823.991) (-828.151) * (-825.842) (-827.502) [-828.327] (-825.089) -- 0:00:32
462000 -- (-825.001) [-824.043] (-825.324) (-824.832) * (-825.347) (-824.180) (-825.059) [-827.579] -- 0:00:32
462500 -- (-828.579) [-824.852] (-824.583) (-826.808) * (-823.911) (-826.953) [-823.659] (-829.906) -- 0:00:33
463000 -- (-826.606) (-824.681) [-824.479] (-828.414) * (-826.965) (-825.817) (-830.354) [-824.598] -- 0:00:33
463500 -- (-828.642) (-824.150) (-824.367) [-824.051] * (-825.988) (-827.573) [-827.542] (-825.871) -- 0:00:33
464000 -- (-825.120) (-824.360) [-825.280] (-824.689) * (-825.152) (-823.728) [-826.249] (-825.053) -- 0:00:33
464500 -- (-826.846) (-824.826) (-824.567) [-823.879] * (-825.092) (-824.447) [-824.710] (-823.477) -- 0:00:33
465000 -- (-829.132) [-824.434] (-826.384) (-827.421) * [-825.468] (-826.138) (-824.081) (-825.465) -- 0:00:33
Average standard deviation of split frequencies: 0.010830
465500 -- [-823.914] (-828.222) (-826.441) (-827.724) * [-823.558] (-823.944) (-825.988) (-826.257) -- 0:00:33
466000 -- (-831.578) (-824.555) (-825.553) [-825.710] * (-824.346) (-825.866) [-825.013] (-834.566) -- 0:00:33
466500 -- (-824.528) (-822.767) [-825.657] (-826.006) * [-823.527] (-825.510) (-826.300) (-826.536) -- 0:00:33
467000 -- (-827.256) [-825.698] (-826.172) (-828.804) * (-825.609) [-825.505] (-824.799) (-832.361) -- 0:00:33
467500 -- (-828.809) (-826.713) [-827.544] (-825.955) * (-824.933) (-823.120) [-824.600] (-827.786) -- 0:00:33
468000 -- [-825.133] (-829.274) (-825.516) (-825.925) * (-824.079) [-828.539] (-825.406) (-826.170) -- 0:00:32
468500 -- (-825.187) (-827.004) (-826.432) [-825.216] * [-825.276] (-827.491) (-827.345) (-826.633) -- 0:00:32
469000 -- [-823.675] (-828.652) (-825.947) (-827.331) * (-826.355) (-827.582) (-828.420) [-827.547] -- 0:00:32
469500 -- (-827.551) [-824.664] (-824.428) (-830.478) * (-830.743) [-823.135] (-828.258) (-828.531) -- 0:00:32
470000 -- (-827.253) (-823.992) [-825.748] (-830.330) * (-825.527) (-823.609) [-828.243] (-824.625) -- 0:00:32
Average standard deviation of split frequencies: 0.010192
470500 -- [-823.323] (-825.125) (-824.659) (-826.530) * [-824.915] (-823.423) (-827.108) (-825.133) -- 0:00:32
471000 -- (-824.664) (-825.019) (-825.836) [-826.656] * (-824.167) [-823.526] (-826.352) (-825.348) -- 0:00:32
471500 -- (-825.292) (-826.478) [-827.540] (-826.114) * (-826.543) [-824.307] (-825.326) (-823.118) -- 0:00:32
472000 -- (-823.359) [-823.558] (-828.920) (-829.573) * (-825.460) [-828.135] (-824.485) (-823.560) -- 0:00:32
472500 -- (-823.429) [-824.607] (-829.865) (-826.819) * (-823.704) (-828.102) (-824.220) [-823.583] -- 0:00:32
473000 -- (-823.946) (-826.437) [-831.093] (-826.900) * (-831.397) (-823.827) [-824.728] (-823.597) -- 0:00:32
473500 -- (-824.648) (-826.010) (-825.030) [-825.818] * (-827.567) [-826.926] (-825.264) (-824.123) -- 0:00:32
474000 -- [-827.333] (-825.793) (-826.421) (-828.797) * [-828.187] (-825.024) (-827.400) (-824.719) -- 0:00:32
474500 -- (-825.477) [-823.240] (-827.939) (-825.123) * [-824.482] (-827.907) (-823.633) (-823.931) -- 0:00:32
475000 -- (-825.049) (-825.159) (-826.590) [-826.243] * (-824.341) [-823.866] (-824.326) (-824.265) -- 0:00:32
Average standard deviation of split frequencies: 0.010337
475500 -- (-827.376) [-823.204] (-824.665) (-825.339) * (-825.172) (-823.950) [-826.909] (-825.044) -- 0:00:31
476000 -- [-826.493] (-825.117) (-825.504) (-825.968) * (-824.637) (-823.284) (-826.936) [-823.975] -- 0:00:31
476500 -- (-828.958) (-825.999) [-824.337] (-823.385) * (-823.416) (-824.384) [-825.210] (-823.242) -- 0:00:31
477000 -- (-828.094) (-825.922) [-823.444] (-823.471) * (-826.212) (-824.244) [-825.487] (-823.340) -- 0:00:31
477500 -- [-825.294] (-825.505) (-823.800) (-825.203) * (-826.352) (-824.509) [-826.718] (-826.773) -- 0:00:31
478000 -- [-824.722] (-825.049) (-825.514) (-825.473) * (-825.880) (-824.496) (-829.878) [-825.656] -- 0:00:31
478500 -- [-824.329] (-823.739) (-830.495) (-823.621) * (-828.326) (-823.901) (-825.330) [-828.670] -- 0:00:31
479000 -- (-824.498) (-824.587) (-823.928) [-827.316] * (-828.986) (-823.784) (-826.727) [-826.318] -- 0:00:32
479500 -- (-825.157) [-824.875] (-823.027) (-826.725) * (-823.650) (-824.604) [-823.601] (-826.271) -- 0:00:32
480000 -- (-825.220) (-823.322) [-824.897] (-827.884) * (-823.993) (-824.782) (-825.217) [-825.600] -- 0:00:32
Average standard deviation of split frequencies: 0.010673
480500 -- [-825.793] (-824.482) (-824.048) (-828.478) * [-823.768] (-823.027) (-823.689) (-825.799) -- 0:00:32
481000 -- [-823.984] (-826.355) (-825.005) (-825.587) * (-824.002) (-825.267) [-827.251] (-830.596) -- 0:00:32
481500 -- (-824.277) [-824.042] (-825.114) (-825.149) * (-824.298) [-825.822] (-825.954) (-827.118) -- 0:00:32
482000 -- (-825.410) (-826.474) (-826.712) [-826.181] * (-824.794) [-824.631] (-823.254) (-825.401) -- 0:00:32
482500 -- (-825.257) [-825.869] (-825.796) (-828.413) * (-828.265) [-824.344] (-823.142) (-824.948) -- 0:00:32
483000 -- (-827.373) [-823.338] (-828.325) (-825.645) * (-826.257) (-824.046) [-824.664] (-825.012) -- 0:00:32
483500 -- [-823.956] (-823.336) (-829.367) (-829.311) * (-824.662) (-824.262) (-826.565) [-823.432] -- 0:00:32
484000 -- [-827.474] (-825.551) (-826.877) (-830.468) * (-830.416) [-824.432] (-825.547) (-827.425) -- 0:00:31
484500 -- (-824.915) (-824.368) (-823.317) [-826.930] * [-825.193] (-824.326) (-825.466) (-825.327) -- 0:00:31
485000 -- (-825.053) (-823.783) (-823.224) [-824.692] * [-829.456] (-823.479) (-827.245) (-825.233) -- 0:00:31
Average standard deviation of split frequencies: 0.010384
485500 -- (-824.480) (-824.639) [-825.333] (-825.441) * (-823.926) [-828.307] (-824.104) (-825.142) -- 0:00:31
486000 -- [-826.213] (-825.871) (-825.362) (-827.789) * [-826.623] (-828.069) (-837.669) (-824.902) -- 0:00:31
486500 -- [-826.637] (-828.444) (-825.034) (-825.406) * [-822.795] (-825.544) (-826.074) (-826.447) -- 0:00:31
487000 -- (-827.058) (-827.605) (-826.432) [-825.502] * (-823.378) [-824.617] (-825.552) (-824.345) -- 0:00:31
487500 -- (-825.183) (-828.727) [-824.898] (-826.132) * (-825.221) [-825.057] (-824.337) (-824.318) -- 0:00:31
488000 -- (-825.918) (-825.265) (-824.047) [-824.095] * (-827.732) (-828.794) [-824.416] (-826.991) -- 0:00:31
488500 -- [-826.243] (-828.559) (-824.597) (-825.099) * [-823.965] (-827.359) (-823.964) (-825.731) -- 0:00:31
489000 -- (-825.923) (-827.660) (-823.755) [-826.996] * (-825.299) (-823.686) (-824.840) [-826.144] -- 0:00:31
489500 -- (-825.676) [-824.429] (-823.838) (-827.122) * (-823.979) [-823.660] (-824.479) (-825.536) -- 0:00:31
490000 -- [-827.446] (-827.963) (-823.825) (-824.020) * [-823.765] (-825.769) (-830.034) (-827.410) -- 0:00:31
Average standard deviation of split frequencies: 0.010455
490500 -- (-824.760) (-824.515) (-825.126) [-824.507] * (-825.062) (-825.587) [-840.110] (-827.175) -- 0:00:31
491000 -- (-824.942) (-827.258) [-825.146] (-824.082) * (-823.553) (-824.845) [-823.760] (-825.389) -- 0:00:31
491500 -- (-823.926) (-826.105) [-823.662] (-824.416) * (-825.637) (-823.861) (-825.708) [-824.443] -- 0:00:31
492000 -- (-825.152) [-823.636] (-824.839) (-827.634) * (-827.495) (-824.057) (-828.424) [-825.343] -- 0:00:30
492500 -- (-824.509) (-824.333) [-826.210] (-824.194) * (-826.657) [-824.850] (-828.250) (-826.336) -- 0:00:30
493000 -- (-824.260) (-823.039) [-823.100] (-828.446) * (-828.010) (-824.776) (-823.976) [-824.917] -- 0:00:30
493500 -- (-825.545) (-824.817) (-826.198) [-823.682] * (-829.882) (-828.316) [-825.028] (-826.883) -- 0:00:30
494000 -- [-824.598] (-825.137) (-823.074) (-824.323) * (-825.281) (-824.614) [-827.122] (-827.953) -- 0:00:30
494500 -- [-824.655] (-827.417) (-825.734) (-825.041) * [-823.223] (-825.885) (-827.289) (-824.164) -- 0:00:30
495000 -- [-823.832] (-828.154) (-823.541) (-827.044) * (-827.178) (-825.922) [-825.601] (-824.237) -- 0:00:30
Average standard deviation of split frequencies: 0.010343
495500 -- (-823.641) (-823.291) (-823.534) [-826.584] * [-829.683] (-825.357) (-826.408) (-825.396) -- 0:00:31
496000 -- (-824.730) [-826.013] (-825.496) (-825.097) * (-828.845) (-827.004) (-826.147) [-826.995] -- 0:00:31
496500 -- (-826.176) [-825.041] (-824.328) (-825.425) * (-824.250) [-825.123] (-825.075) (-824.212) -- 0:00:31
497000 -- (-828.048) [-826.061] (-827.534) (-825.799) * (-826.528) (-826.373) (-826.143) [-824.390] -- 0:00:31
497500 -- [-829.146] (-826.785) (-824.665) (-824.881) * (-826.615) (-824.773) (-824.916) [-823.795] -- 0:00:31
498000 -- (-827.299) (-825.342) [-827.551] (-823.789) * (-825.281) [-825.646] (-825.828) (-826.648) -- 0:00:31
498500 -- (-824.583) (-827.448) [-823.034] (-824.105) * (-826.912) [-827.439] (-825.861) (-823.278) -- 0:00:31
499000 -- (-825.432) [-825.902] (-823.033) (-824.828) * (-826.415) [-824.500] (-828.083) (-826.042) -- 0:00:31
499500 -- (-823.690) [-824.378] (-828.792) (-828.024) * (-827.334) (-823.288) (-827.943) [-825.398] -- 0:00:31
500000 -- [-824.427] (-824.375) (-825.082) (-825.585) * (-826.198) (-824.842) [-823.437] (-825.540) -- 0:00:31
Average standard deviation of split frequencies: 0.010357
500500 -- (-824.198) (-824.399) (-827.518) [-823.957] * (-824.579) [-824.159] (-823.532) (-825.578) -- 0:00:30
501000 -- (-824.966) (-823.844) (-826.541) [-824.106] * (-824.717) (-825.127) (-823.531) [-824.382] -- 0:00:30
501500 -- (-823.448) (-828.422) (-826.346) [-825.280] * (-825.559) (-826.528) [-824.200] (-823.600) -- 0:00:30
502000 -- (-828.647) (-823.811) [-823.645] (-826.939) * (-828.156) (-826.146) (-827.342) [-825.591] -- 0:00:30
502500 -- (-827.150) [-824.813] (-823.871) (-823.952) * (-826.024) [-824.785] (-828.082) (-826.266) -- 0:00:30
503000 -- (-829.081) (-824.659) (-823.740) [-823.163] * (-826.828) (-828.393) [-829.838] (-831.016) -- 0:00:30
503500 -- (-826.119) (-824.148) (-832.290) [-823.163] * (-826.467) (-825.870) [-826.181] (-825.331) -- 0:00:30
504000 -- (-826.343) (-823.381) [-823.702] (-824.246) * [-823.794] (-826.631) (-823.833) (-826.262) -- 0:00:30
504500 -- (-826.177) (-826.736) (-824.730) [-824.143] * (-823.543) (-825.579) [-825.377] (-826.375) -- 0:00:30
505000 -- [-824.654] (-825.314) (-826.243) (-824.956) * (-825.364) [-826.844] (-823.656) (-824.988) -- 0:00:30
Average standard deviation of split frequencies: 0.010138
505500 -- (-822.838) (-824.933) (-825.968) [-825.356] * [-824.538] (-824.023) (-827.731) (-824.074) -- 0:00:30
506000 -- (-825.505) [-823.940] (-826.744) (-823.529) * (-825.207) (-825.310) [-826.513] (-823.851) -- 0:00:30
506500 -- (-822.817) [-826.373] (-826.757) (-824.044) * (-827.922) [-830.473] (-826.632) (-825.238) -- 0:00:30
507000 -- (-823.532) (-825.204) (-823.643) [-826.324] * (-824.467) (-824.018) [-824.514] (-823.263) -- 0:00:30
507500 -- (-825.742) (-824.821) (-826.082) [-826.273] * (-823.021) (-823.764) [-824.773] (-825.445) -- 0:00:30
508000 -- (-829.295) (-824.593) [-829.717] (-825.348) * [-826.532] (-824.864) (-825.867) (-824.231) -- 0:00:30
508500 -- (-826.335) (-824.722) (-825.078) [-825.871] * [-823.352] (-825.315) (-823.622) (-824.160) -- 0:00:29
509000 -- (-823.258) [-823.961] (-823.673) (-824.237) * [-823.038] (-823.588) (-824.497) (-828.080) -- 0:00:29
509500 -- (-824.919) (-829.576) [-823.950] (-823.943) * (-823.432) (-824.290) [-826.701] (-823.590) -- 0:00:29
510000 -- [-825.553] (-824.533) (-828.887) (-823.875) * (-823.510) (-825.978) [-828.258] (-823.186) -- 0:00:29
Average standard deviation of split frequencies: 0.010046
510500 -- [-825.857] (-823.373) (-825.048) (-823.598) * [-825.484] (-824.206) (-828.836) (-823.373) -- 0:00:29
511000 -- (-824.368) (-829.915) (-823.572) [-823.473] * [-824.473] (-825.806) (-828.628) (-824.537) -- 0:00:29
511500 -- (-822.895) (-828.289) (-824.483) [-825.498] * (-824.862) (-826.208) [-826.551] (-824.877) -- 0:00:29
512000 -- (-823.172) (-829.711) [-826.561] (-824.052) * (-823.722) (-824.327) (-827.013) [-824.747] -- 0:00:30
512500 -- (-823.533) (-826.983) [-823.811] (-825.760) * (-827.082) (-825.617) (-824.763) [-826.065] -- 0:00:30
513000 -- [-825.571] (-825.967) (-823.229) (-824.268) * (-826.725) (-824.073) (-829.537) [-825.145] -- 0:00:30
513500 -- (-825.010) (-826.855) (-828.991) [-827.381] * (-825.057) (-825.572) (-825.192) [-824.416] -- 0:00:30
514000 -- (-823.662) [-826.803] (-830.883) (-827.878) * (-825.537) (-823.355) [-824.384] (-827.331) -- 0:00:30
514500 -- [-824.883] (-827.615) (-825.823) (-826.088) * (-827.260) [-824.421] (-826.730) (-824.800) -- 0:00:30
515000 -- [-824.303] (-825.241) (-825.785) (-825.985) * (-826.768) (-825.800) (-824.568) [-824.146] -- 0:00:30
Average standard deviation of split frequencies: 0.009458
515500 -- (-825.336) (-824.976) [-827.322] (-825.800) * (-824.230) [-824.385] (-823.790) (-826.239) -- 0:00:30
516000 -- (-829.295) (-826.907) (-827.409) [-824.581] * (-828.702) (-825.206) (-824.065) [-824.271] -- 0:00:30
516500 -- (-826.121) [-823.496] (-824.610) (-822.860) * (-824.612) (-826.757) [-823.172] (-823.122) -- 0:00:29
517000 -- (-823.995) (-823.723) [-825.585] (-823.751) * (-823.979) [-825.273] (-825.228) (-824.341) -- 0:00:29
517500 -- (-824.091) (-829.525) (-824.595) [-824.347] * (-824.297) (-829.990) (-826.758) [-823.628] -- 0:00:29
518000 -- (-823.057) (-824.857) [-825.532] (-824.718) * (-825.848) [-825.029] (-826.152) (-823.558) -- 0:00:29
518500 -- (-823.221) [-823.965] (-823.839) (-825.977) * (-828.097) (-826.818) (-826.917) [-825.287] -- 0:00:29
519000 -- (-825.823) (-826.751) (-826.065) [-825.113] * (-827.612) [-826.340] (-825.642) (-827.459) -- 0:00:29
519500 -- (-823.456) [-824.096] (-824.813) (-830.846) * (-835.078) (-825.243) [-824.970] (-823.445) -- 0:00:29
520000 -- [-823.274] (-824.201) (-824.849) (-824.851) * (-827.001) (-824.839) (-823.249) [-824.217] -- 0:00:29
Average standard deviation of split frequencies: 0.009640
520500 -- (-823.422) (-824.737) (-824.888) [-828.393] * (-823.914) (-824.868) (-824.900) [-823.275] -- 0:00:29
521000 -- [-825.559] (-826.726) (-826.747) (-828.214) * (-824.417) [-823.820] (-824.881) (-824.906) -- 0:00:29
521500 -- [-825.090] (-827.424) (-823.206) (-825.534) * [-824.356] (-824.973) (-825.558) (-824.038) -- 0:00:29
522000 -- (-828.136) (-825.441) [-823.933] (-826.227) * (-827.444) [-824.469] (-825.296) (-823.405) -- 0:00:29
522500 -- (-824.764) [-824.129] (-823.947) (-825.313) * (-825.424) (-825.259) [-827.254] (-827.077) -- 0:00:29
523000 -- [-823.660] (-825.713) (-825.204) (-828.507) * (-824.459) (-825.372) [-825.367] (-829.877) -- 0:00:29
523500 -- (-825.191) (-826.385) [-824.691] (-825.518) * (-825.871) (-824.823) (-823.990) [-824.418] -- 0:00:29
524000 -- (-823.837) (-827.684) (-824.559) [-825.747] * (-826.018) (-824.764) (-827.931) [-828.555] -- 0:00:29
524500 -- (-825.287) (-827.247) (-826.290) [-825.153] * (-828.307) (-823.720) (-824.982) [-826.237] -- 0:00:29
525000 -- [-826.464] (-825.408) (-825.262) (-823.902) * (-823.830) (-823.866) (-826.406) [-823.756] -- 0:00:28
Average standard deviation of split frequencies: 0.009226
525500 -- (-826.489) [-825.358] (-824.327) (-827.037) * (-825.056) (-825.486) (-824.298) [-824.426] -- 0:00:28
526000 -- (-830.616) (-824.313) (-827.253) [-825.172] * (-827.002) (-826.396) (-823.795) [-827.396] -- 0:00:28
526500 -- (-826.960) [-823.292] (-824.689) (-826.500) * (-831.456) (-825.360) [-822.978] (-826.165) -- 0:00:28
527000 -- (-824.274) (-823.125) [-824.376] (-828.322) * [-827.137] (-823.598) (-823.362) (-830.435) -- 0:00:28
527500 -- [-824.446] (-824.322) (-826.526) (-824.663) * (-825.617) (-825.359) [-826.229] (-825.024) -- 0:00:28
528000 -- (-823.910) (-824.417) (-827.612) [-824.572] * [-826.210] (-825.529) (-824.524) (-823.980) -- 0:00:28
528500 -- (-829.373) [-825.265] (-826.309) (-823.359) * (-829.480) [-825.972] (-827.578) (-823.524) -- 0:00:29
529000 -- (-825.856) (-826.680) [-824.800] (-823.684) * (-827.436) (-826.689) [-825.299] (-824.564) -- 0:00:29
529500 -- (-824.895) [-826.439] (-823.029) (-824.763) * [-826.393] (-824.955) (-830.610) (-828.093) -- 0:00:29
530000 -- (-825.740) (-826.217) [-826.158] (-824.502) * (-823.532) [-824.785] (-828.835) (-824.395) -- 0:00:29
Average standard deviation of split frequencies: 0.009458
530500 -- [-824.736] (-827.595) (-827.842) (-825.231) * (-823.509) [-824.653] (-827.144) (-826.665) -- 0:00:29
531000 -- (-825.506) (-825.478) (-825.298) [-827.830] * (-829.507) (-823.840) [-824.569] (-824.807) -- 0:00:29
531500 -- [-826.502] (-827.531) (-828.425) (-825.119) * (-826.671) (-827.422) (-825.004) [-826.591] -- 0:00:29
532000 -- (-825.837) [-825.950] (-827.156) (-827.012) * (-826.027) (-823.086) [-825.846] (-824.791) -- 0:00:29
532500 -- (-825.221) (-825.257) [-826.653] (-826.773) * (-826.764) [-823.540] (-828.319) (-825.251) -- 0:00:28
533000 -- (-828.357) (-823.913) [-823.892] (-829.350) * (-824.276) (-824.416) (-829.982) [-824.768] -- 0:00:28
533500 -- (-829.704) [-823.637] (-822.898) (-830.765) * (-823.864) (-825.568) (-827.010) [-824.570] -- 0:00:28
534000 -- (-829.619) (-826.867) (-823.780) [-823.947] * (-826.534) (-823.920) (-827.381) [-824.495] -- 0:00:28
534500 -- (-828.652) (-829.373) [-827.616] (-823.911) * (-825.504) [-823.548] (-827.610) (-822.799) -- 0:00:28
535000 -- (-826.770) [-825.981] (-826.384) (-825.013) * (-825.871) (-827.275) [-824.536] (-825.026) -- 0:00:28
Average standard deviation of split frequencies: 0.009260
535500 -- (-826.542) [-826.238] (-825.130) (-824.632) * (-827.384) [-824.266] (-823.745) (-825.087) -- 0:00:28
536000 -- [-825.510] (-825.337) (-825.263) (-826.526) * (-824.757) (-823.280) [-828.274] (-824.331) -- 0:00:28
536500 -- (-824.635) (-825.510) (-825.563) [-825.448] * [-825.603] (-823.215) (-825.179) (-827.321) -- 0:00:28
537000 -- [-824.774] (-826.012) (-827.408) (-825.949) * (-825.979) (-825.532) [-825.447] (-824.959) -- 0:00:28
537500 -- (-826.940) (-826.928) [-825.919] (-827.738) * (-829.077) (-824.649) (-824.613) [-826.583] -- 0:00:28
538000 -- (-825.978) [-824.070] (-827.090) (-824.527) * (-823.315) (-824.100) [-825.658] (-824.332) -- 0:00:28
538500 -- [-824.783] (-824.836) (-828.288) (-825.785) * (-826.618) (-825.598) (-824.456) [-823.536] -- 0:00:28
539000 -- (-823.316) (-825.671) (-825.266) [-824.207] * [-827.025] (-824.450) (-824.506) (-827.474) -- 0:00:28
539500 -- (-827.556) (-824.703) [-827.323] (-827.560) * [-823.091] (-823.769) (-825.199) (-826.715) -- 0:00:28
540000 -- [-827.594] (-825.028) (-827.866) (-826.427) * [-823.089] (-827.289) (-830.628) (-824.487) -- 0:00:28
Average standard deviation of split frequencies: 0.009129
540500 -- (-828.216) (-824.388) [-823.847] (-827.158) * (-824.135) (-828.830) (-825.923) [-825.289] -- 0:00:28
541000 -- (-825.364) (-824.233) [-823.095] (-825.555) * (-824.827) [-825.371] (-824.298) (-824.236) -- 0:00:27
541500 -- (-825.567) [-825.314] (-822.882) (-823.592) * (-826.875) (-824.088) [-823.442] (-824.400) -- 0:00:27
542000 -- (-829.718) (-825.168) [-826.237] (-824.687) * (-824.778) (-826.396) (-824.283) [-822.948] -- 0:00:27
542500 -- (-833.385) [-827.218] (-824.186) (-829.619) * (-825.547) (-824.331) [-827.472] (-824.402) -- 0:00:27
543000 -- (-825.660) (-826.248) [-823.766] (-829.724) * (-826.373) [-825.354] (-828.632) (-825.796) -- 0:00:27
543500 -- (-823.943) (-827.760) [-825.479] (-824.342) * (-824.738) (-825.126) (-825.990) [-823.441] -- 0:00:27
544000 -- [-826.885] (-827.941) (-824.842) (-825.079) * (-824.333) [-824.362] (-825.398) (-823.226) -- 0:00:27
544500 -- [-823.699] (-823.338) (-824.062) (-825.101) * (-825.158) (-826.064) [-824.901] (-825.854) -- 0:00:27
545000 -- [-825.001] (-827.117) (-824.667) (-825.746) * (-825.305) [-823.744] (-825.773) (-825.258) -- 0:00:28
Average standard deviation of split frequencies: 0.008939
545500 -- (-822.998) [-825.832] (-823.635) (-824.936) * (-830.755) (-823.511) [-824.174] (-824.711) -- 0:00:28
546000 -- (-822.803) (-825.592) [-823.625] (-823.802) * (-823.594) (-824.687) (-824.165) [-826.064] -- 0:00:28
546500 -- (-826.523) [-826.433] (-827.377) (-823.048) * (-822.919) (-825.582) (-824.741) [-824.198] -- 0:00:28
547000 -- (-825.179) [-824.778] (-828.224) (-822.988) * (-827.636) [-825.668] (-823.167) (-827.235) -- 0:00:28
547500 -- (-823.895) (-825.273) (-829.386) [-827.319] * [-823.614] (-824.442) (-823.713) (-824.013) -- 0:00:28
548000 -- (-825.229) [-826.429] (-823.652) (-823.382) * (-823.366) (-824.974) (-823.950) [-823.768] -- 0:00:28
548500 -- (-825.395) (-823.645) (-823.585) [-824.321] * (-824.333) (-826.140) (-828.141) [-825.049] -- 0:00:27
549000 -- (-827.738) (-824.825) (-823.933) [-831.123] * (-823.885) (-825.218) [-827.368] (-823.973) -- 0:00:27
549500 -- (-824.806) (-827.091) (-828.303) [-828.026] * [-825.442] (-825.356) (-828.510) (-824.614) -- 0:00:27
550000 -- (-825.802) (-827.224) (-823.389) [-824.183] * (-825.470) [-825.583] (-823.828) (-825.382) -- 0:00:27
Average standard deviation of split frequencies: 0.008913
550500 -- (-827.745) (-827.400) (-824.993) [-830.429] * (-825.405) (-827.127) [-825.377] (-824.661) -- 0:00:27
551000 -- (-825.604) (-823.790) [-827.134] (-830.622) * (-824.536) [-826.003] (-823.919) (-824.575) -- 0:00:27
551500 -- [-824.662] (-824.968) (-826.042) (-826.759) * (-823.400) (-825.572) [-825.053] (-824.627) -- 0:00:27
552000 -- [-825.689] (-823.899) (-827.712) (-824.537) * (-827.284) (-825.595) [-825.801] (-822.936) -- 0:00:27
552500 -- (-823.344) [-825.238] (-829.027) (-824.510) * (-826.156) (-824.774) (-824.742) [-831.286] -- 0:00:27
553000 -- (-824.160) [-825.567] (-825.949) (-825.290) * (-825.192) (-827.350) [-827.976] (-827.186) -- 0:00:27
553500 -- (-825.480) (-835.504) [-826.614] (-826.421) * (-823.958) [-823.746] (-825.805) (-825.114) -- 0:00:27
554000 -- (-823.685) [-824.905] (-825.259) (-824.497) * (-824.997) (-827.988) (-824.482) [-825.030] -- 0:00:27
554500 -- (-823.609) [-824.636] (-825.176) (-824.374) * [-826.836] (-823.620) (-827.045) (-828.213) -- 0:00:27
555000 -- (-825.161) (-827.112) (-825.331) [-823.353] * (-824.411) (-825.092) [-824.476] (-829.078) -- 0:00:27
Average standard deviation of split frequencies: 0.008528
555500 -- (-826.121) (-824.337) (-824.896) [-823.989] * [-824.126] (-824.747) (-826.314) (-824.553) -- 0:00:27
556000 -- (-822.908) (-824.783) (-824.318) [-823.745] * (-825.606) [-825.656] (-828.177) (-823.108) -- 0:00:27
556500 -- (-825.964) (-825.756) [-824.388] (-825.824) * (-824.771) [-825.689] (-823.715) (-825.798) -- 0:00:27
557000 -- (-824.925) [-824.397] (-823.976) (-824.702) * (-825.482) (-823.246) (-829.896) [-823.724] -- 0:00:27
557500 -- (-824.935) (-823.501) [-824.458] (-823.946) * (-825.018) [-825.393] (-825.222) (-825.535) -- 0:00:26
558000 -- (-824.438) [-823.479] (-827.762) (-823.278) * [-824.677] (-823.281) (-823.541) (-826.143) -- 0:00:26
558500 -- (-823.481) (-823.491) [-834.437] (-831.021) * [-823.442] (-825.709) (-824.254) (-823.495) -- 0:00:26
559000 -- (-825.763) [-825.347] (-826.389) (-824.073) * [-823.350] (-826.364) (-825.404) (-823.846) -- 0:00:26
559500 -- (-825.636) (-823.832) [-825.177] (-824.072) * [-827.308] (-827.307) (-825.591) (-825.794) -- 0:00:26
560000 -- [-823.746] (-824.504) (-825.055) (-824.715) * (-825.332) (-829.913) (-827.116) [-823.526] -- 0:00:26
Average standard deviation of split frequencies: 0.008754
560500 -- (-823.774) (-824.920) (-827.143) [-825.231] * (-823.929) (-826.367) [-824.440] (-823.853) -- 0:00:26
561000 -- [-825.480] (-825.359) (-824.571) (-825.194) * (-822.928) [-825.117] (-830.344) (-826.839) -- 0:00:26
561500 -- (-830.514) (-825.976) [-823.301] (-825.969) * (-823.359) [-827.590] (-824.242) (-825.160) -- 0:00:26
562000 -- (-825.286) [-823.962] (-826.308) (-827.539) * (-824.265) (-823.995) [-828.094] (-830.446) -- 0:00:27
562500 -- [-826.577] (-824.814) (-827.237) (-826.655) * (-824.685) [-823.987] (-826.612) (-825.085) -- 0:00:27
563000 -- [-823.407] (-826.709) (-823.870) (-824.265) * (-827.565) (-828.294) [-823.686] (-826.552) -- 0:00:27
563500 -- (-823.060) [-824.907] (-826.922) (-824.361) * (-823.790) (-828.767) (-822.889) [-826.387] -- 0:00:27
564000 -- (-825.693) [-828.325] (-825.947) (-826.218) * (-824.507) (-825.819) [-823.318] (-828.694) -- 0:00:27
564500 -- (-824.822) (-825.312) (-824.787) [-825.022] * [-823.983] (-824.855) (-826.290) (-827.045) -- 0:00:27
565000 -- (-825.772) [-830.090] (-824.575) (-826.560) * (-825.370) (-824.521) (-824.720) [-827.057] -- 0:00:26
Average standard deviation of split frequencies: 0.008884
565500 -- [-824.207] (-830.848) (-824.696) (-827.880) * (-825.819) (-827.598) [-823.207] (-826.189) -- 0:00:26
566000 -- (-824.240) [-823.270] (-824.589) (-826.984) * (-827.688) (-828.936) [-825.663] (-824.506) -- 0:00:26
566500 -- [-823.023] (-827.651) (-825.685) (-827.232) * [-824.436] (-829.769) (-831.165) (-826.919) -- 0:00:26
567000 -- (-828.002) (-829.576) (-823.925) [-823.547] * [-824.258] (-824.700) (-830.089) (-823.599) -- 0:00:26
567500 -- (-825.054) [-826.054] (-824.633) (-823.080) * [-825.279] (-824.882) (-829.510) (-824.062) -- 0:00:26
568000 -- (-825.728) [-825.104] (-825.039) (-823.823) * (-827.033) (-824.267) (-824.918) [-824.881] -- 0:00:26
568500 -- (-825.111) (-826.939) [-822.922] (-824.505) * (-825.949) (-825.898) (-825.644) [-823.572] -- 0:00:26
569000 -- [-825.207] (-827.714) (-824.827) (-826.792) * (-828.713) (-823.537) [-831.820] (-827.516) -- 0:00:26
569500 -- (-825.820) [-824.426] (-824.278) (-824.330) * (-827.758) (-825.154) [-825.503] (-825.757) -- 0:00:26
570000 -- (-824.748) (-823.690) [-824.673] (-826.505) * (-824.827) [-823.661] (-824.032) (-823.658) -- 0:00:26
Average standard deviation of split frequencies: 0.008261
570500 -- (-828.082) (-827.313) [-823.884] (-829.029) * [-823.194] (-824.186) (-826.052) (-825.233) -- 0:00:26
571000 -- (-826.377) [-825.754] (-824.508) (-825.771) * (-824.464) (-825.067) (-827.792) [-825.594] -- 0:00:26
571500 -- [-823.969] (-826.723) (-824.348) (-824.394) * (-823.976) (-823.693) (-824.509) [-824.050] -- 0:00:26
572000 -- (-828.223) (-823.875) [-824.744] (-825.606) * [-823.872] (-824.374) (-824.324) (-833.841) -- 0:00:26
572500 -- (-825.907) (-827.299) (-827.583) [-823.778] * [-827.051] (-823.539) (-824.670) (-828.634) -- 0:00:26
573000 -- (-828.394) [-827.936] (-828.598) (-823.531) * (-828.858) (-824.298) (-823.926) [-825.117] -- 0:00:26
573500 -- (-824.150) [-826.946] (-825.429) (-824.109) * (-826.301) (-824.954) (-828.488) [-825.160] -- 0:00:26
574000 -- (-827.428) [-825.928] (-823.995) (-825.731) * [-825.960] (-825.022) (-825.786) (-823.161) -- 0:00:25
574500 -- (-830.332) [-823.345] (-827.428) (-825.456) * (-826.114) (-824.815) (-823.303) [-824.361] -- 0:00:25
575000 -- (-827.402) (-823.985) [-823.858] (-829.342) * (-827.438) (-827.201) (-825.051) [-825.511] -- 0:00:25
Average standard deviation of split frequencies: 0.009230
575500 -- (-827.953) (-825.573) (-824.341) [-824.633] * (-827.787) (-824.503) [-825.035] (-823.611) -- 0:00:25
576000 -- (-825.741) [-824.290] (-824.776) (-825.889) * (-826.207) [-825.171] (-825.301) (-825.086) -- 0:00:25
576500 -- (-823.163) [-829.806] (-825.596) (-825.381) * (-824.322) (-823.646) (-823.830) [-825.447] -- 0:00:25
577000 -- (-824.602) (-825.878) [-824.681] (-827.070) * [-824.682] (-823.775) (-824.433) (-824.125) -- 0:00:25
577500 -- (-827.918) [-825.201] (-825.140) (-828.807) * (-828.109) (-823.227) [-824.517] (-829.651) -- 0:00:25
578000 -- (-824.619) [-823.589] (-824.037) (-825.419) * (-824.716) [-824.401] (-823.530) (-827.364) -- 0:00:25
578500 -- [-826.670] (-825.199) (-824.986) (-825.180) * (-824.346) [-824.312] (-823.389) (-824.875) -- 0:00:26
579000 -- [-824.106] (-826.476) (-823.328) (-829.379) * (-824.574) (-824.868) [-823.738] (-826.610) -- 0:00:26
579500 -- (-825.009) [-824.986] (-825.327) (-825.163) * (-823.856) [-823.312] (-825.782) (-826.583) -- 0:00:26
580000 -- (-825.284) (-824.382) (-826.898) [-824.253] * (-824.064) [-824.400] (-825.839) (-824.640) -- 0:00:26
Average standard deviation of split frequencies: 0.009787
580500 -- (-825.425) (-823.799) [-824.756] (-828.363) * (-824.148) (-825.145) [-823.050] (-824.743) -- 0:00:26
581000 -- (-827.494) [-823.294] (-825.097) (-827.676) * [-824.248] (-830.023) (-823.441) (-827.423) -- 0:00:25
581500 -- [-824.213] (-824.309) (-824.496) (-823.570) * (-825.549) (-825.651) [-824.039] (-826.369) -- 0:00:25
582000 -- (-828.421) (-828.209) [-824.767] (-826.894) * (-825.226) (-829.522) [-824.850] (-824.297) -- 0:00:25
582500 -- (-826.128) [-825.566] (-825.518) (-824.226) * (-823.081) (-828.287) [-823.873] (-826.893) -- 0:00:25
583000 -- (-824.715) (-825.194) [-824.638] (-825.038) * [-823.938] (-827.417) (-826.076) (-823.874) -- 0:00:25
583500 -- (-823.889) (-825.085) (-829.318) [-826.436] * (-827.942) (-825.236) (-823.995) [-823.911] -- 0:00:25
584000 -- (-824.300) (-825.007) [-825.266] (-828.380) * [-825.002] (-825.383) (-825.210) (-825.345) -- 0:00:25
584500 -- [-825.381] (-824.132) (-826.405) (-826.067) * (-824.399) (-829.203) (-827.402) [-825.691] -- 0:00:25
585000 -- (-831.239) (-823.823) (-824.558) [-824.518] * [-823.024] (-823.901) (-831.873) (-829.258) -- 0:00:25
Average standard deviation of split frequencies: 0.009966
585500 -- (-825.368) [-827.484] (-823.769) (-823.877) * (-829.462) (-824.114) (-826.495) [-823.152] -- 0:00:25
586000 -- [-823.031] (-828.271) (-824.264) (-824.586) * [-824.787] (-827.976) (-826.778) (-824.204) -- 0:00:25
586500 -- [-825.317] (-829.847) (-826.875) (-823.969) * (-825.928) (-826.960) (-824.588) [-824.450] -- 0:00:25
587000 -- (-823.669) (-824.001) (-824.130) [-824.953] * (-829.136) (-825.096) (-826.936) [-823.796] -- 0:00:25
587500 -- (-823.132) (-827.440) [-825.222] (-825.817) * [-827.128] (-826.225) (-826.868) (-823.019) -- 0:00:25
588000 -- (-823.642) (-824.129) [-826.243] (-824.602) * (-825.767) (-825.291) (-824.790) [-826.052] -- 0:00:25
588500 -- [-823.602] (-826.517) (-825.840) (-824.849) * (-825.667) (-823.908) (-826.816) [-824.403] -- 0:00:25
589000 -- (-824.316) (-824.487) [-825.522] (-824.967) * [-830.844] (-826.378) (-827.989) (-826.116) -- 0:00:25
589500 -- (-825.514) [-824.840] (-824.224) (-824.608) * (-829.861) (-828.065) (-827.587) [-824.116] -- 0:00:25
590000 -- (-824.919) (-826.737) [-823.700] (-826.478) * (-826.155) [-827.359] (-826.443) (-825.635) -- 0:00:25
Average standard deviation of split frequencies: 0.009843
590500 -- (-823.208) (-826.192) [-823.652] (-824.948) * (-825.358) (-824.023) (-830.382) [-823.607] -- 0:00:24
591000 -- (-822.830) [-825.435] (-824.696) (-823.285) * (-823.508) [-824.371] (-834.100) (-830.530) -- 0:00:24
591500 -- (-827.042) [-825.187] (-824.910) (-824.038) * [-824.011] (-824.270) (-825.378) (-824.627) -- 0:00:24
592000 -- [-826.751] (-825.279) (-822.870) (-823.455) * (-825.812) [-824.758] (-824.461) (-825.814) -- 0:00:24
592500 -- (-823.535) (-825.458) (-828.990) [-824.325] * (-823.745) (-824.080) (-824.051) [-825.219] -- 0:00:24
593000 -- (-823.403) (-824.134) [-824.380] (-826.435) * [-824.753] (-825.394) (-825.730) (-826.144) -- 0:00:24
593500 -- [-823.527] (-824.758) (-826.341) (-825.636) * [-825.196] (-826.037) (-825.240) (-827.989) -- 0:00:24
594000 -- (-826.509) [-823.545] (-828.998) (-826.744) * (-825.221) (-823.198) (-824.349) [-824.354] -- 0:00:24
594500 -- (-828.551) (-823.737) [-826.252] (-824.151) * (-825.892) [-822.965] (-827.359) (-825.933) -- 0:00:24
595000 -- [-823.769] (-823.256) (-824.628) (-823.107) * (-827.347) (-824.496) [-825.125] (-824.276) -- 0:00:24
Average standard deviation of split frequencies: 0.009843
595500 -- (-827.396) (-823.458) (-823.328) [-823.074] * [-826.253] (-826.936) (-824.867) (-826.667) -- 0:00:25
596000 -- (-829.403) (-824.015) (-826.359) [-823.215] * (-824.548) (-834.198) (-823.846) [-825.166] -- 0:00:25
596500 -- (-827.431) (-823.520) [-827.819] (-826.858) * (-826.777) (-827.304) [-825.803] (-824.764) -- 0:00:25
597000 -- (-828.008) (-825.714) [-826.739] (-825.984) * (-824.199) (-830.243) (-826.466) [-824.767] -- 0:00:24
597500 -- [-828.404] (-831.746) (-827.521) (-825.234) * (-824.469) (-830.764) (-826.668) [-827.235] -- 0:00:24
598000 -- (-826.336) (-826.923) [-827.893] (-825.064) * (-825.130) (-824.724) (-826.101) [-824.969] -- 0:00:24
598500 -- (-826.364) (-825.907) [-826.137] (-824.852) * (-828.676) (-823.784) [-823.975] (-823.378) -- 0:00:24
599000 -- [-825.337] (-825.315) (-827.866) (-826.655) * (-823.736) [-823.840] (-824.584) (-823.199) -- 0:00:24
599500 -- [-826.247] (-824.978) (-825.723) (-825.479) * [-824.485] (-824.500) (-825.121) (-826.092) -- 0:00:24
600000 -- (-825.603) (-827.411) (-826.342) [-824.768] * (-826.668) [-824.708] (-825.030) (-825.946) -- 0:00:24
Average standard deviation of split frequencies: 0.009679
600500 -- (-826.815) (-825.988) (-830.278) [-825.409] * (-826.209) [-825.920] (-823.951) (-823.169) -- 0:00:24
601000 -- (-826.037) (-825.341) [-824.370] (-824.255) * (-826.560) (-827.336) [-824.969] (-824.445) -- 0:00:24
601500 -- (-825.560) (-824.724) [-825.773] (-823.861) * (-825.116) (-826.097) [-826.413] (-827.631) -- 0:00:24
602000 -- [-824.705] (-827.585) (-826.977) (-824.507) * (-824.731) (-827.717) (-824.565) [-825.687] -- 0:00:24
602500 -- [-824.737] (-825.127) (-824.674) (-825.005) * (-828.915) (-826.127) [-825.635] (-824.662) -- 0:00:24
603000 -- [-826.357] (-827.833) (-823.717) (-825.577) * [-827.020] (-824.053) (-825.268) (-823.912) -- 0:00:24
603500 -- (-829.482) (-824.057) [-824.124] (-826.703) * (-823.117) (-823.235) (-825.371) [-824.348] -- 0:00:24
604000 -- (-826.663) (-826.708) [-823.203] (-824.007) * [-824.261] (-828.215) (-823.323) (-831.411) -- 0:00:24
604500 -- (-828.285) (-824.849) (-826.939) [-828.616] * (-823.421) (-826.672) (-829.729) [-826.510] -- 0:00:24
605000 -- (-825.204) [-825.341] (-828.200) (-825.712) * (-823.791) (-825.610) [-827.892] (-823.628) -- 0:00:24
Average standard deviation of split frequencies: 0.009594
605500 -- (-824.107) (-824.700) [-824.977] (-824.166) * [-824.118] (-828.318) (-826.742) (-824.166) -- 0:00:24
606000 -- [-823.854] (-823.935) (-825.310) (-825.044) * (-824.168) (-825.165) [-826.468] (-823.888) -- 0:00:24
606500 -- (-827.172) (-832.748) [-825.458] (-823.121) * [-824.220] (-824.668) (-827.429) (-823.439) -- 0:00:24
607000 -- (-823.871) [-828.679] (-826.693) (-830.339) * (-824.305) [-827.022] (-825.435) (-823.705) -- 0:00:23
607500 -- (-824.167) (-826.052) (-826.835) [-830.051] * (-823.419) [-827.421] (-824.252) (-823.883) -- 0:00:23
608000 -- (-831.110) (-825.354) [-826.924] (-826.355) * [-826.075] (-823.631) (-824.863) (-824.053) -- 0:00:23
608500 -- (-827.112) [-828.330] (-827.636) (-825.082) * (-823.818) (-825.186) (-825.316) [-824.499] -- 0:00:23
609000 -- (-824.499) [-824.909] (-824.493) (-826.556) * (-824.542) (-824.410) [-824.079] (-823.782) -- 0:00:23
609500 -- [-827.413] (-824.810) (-825.150) (-827.196) * (-832.670) (-823.522) [-824.351] (-823.474) -- 0:00:23
610000 -- (-826.482) (-827.069) [-825.909] (-826.033) * (-835.264) (-825.767) (-825.468) [-824.878] -- 0:00:23
Average standard deviation of split frequencies: 0.009778
610500 -- (-827.054) [-825.358] (-825.283) (-827.214) * (-830.252) [-824.612] (-825.530) (-824.493) -- 0:00:23
611000 -- [-824.592] (-823.444) (-823.367) (-823.749) * (-825.514) (-825.129) (-824.975) [-825.390] -- 0:00:23
611500 -- [-826.129] (-824.122) (-823.430) (-825.362) * (-823.748) [-828.493] (-826.028) (-825.129) -- 0:00:23
612000 -- (-829.204) [-824.739] (-823.622) (-824.432) * (-823.905) [-828.215] (-828.107) (-828.079) -- 0:00:24
612500 -- (-827.878) (-825.214) [-828.353] (-824.882) * (-828.855) [-826.349] (-824.463) (-824.969) -- 0:00:24
613000 -- (-824.175) (-825.528) (-827.611) [-823.979] * (-824.195) (-824.835) [-823.668] (-826.595) -- 0:00:23
613500 -- (-825.102) (-826.315) [-823.988] (-825.719) * (-824.841) (-824.729) [-828.755] (-824.091) -- 0:00:23
614000 -- (-830.646) [-824.858] (-830.819) (-829.022) * [-824.165] (-826.843) (-828.143) (-826.184) -- 0:00:23
614500 -- (-825.915) [-827.962] (-826.092) (-823.578) * (-829.455) [-824.752] (-826.203) (-824.051) -- 0:00:23
615000 -- (-825.276) (-825.697) (-825.938) [-824.024] * (-825.473) (-826.068) [-824.849] (-827.867) -- 0:00:23
Average standard deviation of split frequencies: 0.009948
615500 -- (-828.157) [-827.016] (-827.604) (-824.062) * (-823.625) [-825.037] (-826.533) (-822.994) -- 0:00:23
616000 -- (-829.900) (-823.885) [-826.642] (-823.927) * (-823.966) [-823.855] (-824.331) (-826.266) -- 0:00:23
616500 -- (-825.431) (-827.547) [-825.479] (-824.471) * (-823.443) (-826.934) [-824.444] (-825.704) -- 0:00:23
617000 -- (-827.909) [-823.470] (-824.914) (-829.553) * (-824.279) [-826.528] (-826.540) (-822.998) -- 0:00:23
617500 -- (-823.314) (-824.147) (-823.740) [-824.052] * (-829.825) (-823.360) (-826.714) [-825.704] -- 0:00:23
618000 -- (-825.850) [-823.775] (-825.522) (-824.296) * (-828.596) (-824.487) (-831.931) [-825.131] -- 0:00:23
618500 -- (-825.098) (-826.656) [-824.323] (-827.127) * (-825.700) (-825.795) [-824.734] (-828.464) -- 0:00:23
619000 -- [-824.708] (-824.709) (-830.746) (-825.221) * (-830.659) [-823.484] (-826.528) (-827.697) -- 0:00:23
619500 -- (-827.749) (-824.711) (-823.981) [-823.554] * (-827.450) [-824.386] (-824.740) (-827.711) -- 0:00:23
620000 -- [-823.845] (-823.815) (-823.616) (-823.735) * (-826.835) (-825.721) (-825.456) [-827.720] -- 0:00:23
Average standard deviation of split frequencies: 0.010338
620500 -- [-825.342] (-825.096) (-823.904) (-825.134) * [-825.700] (-823.105) (-825.830) (-828.817) -- 0:00:23
621000 -- (-824.271) (-829.695) [-824.581] (-823.629) * (-827.375) [-823.352] (-827.223) (-825.261) -- 0:00:23
621500 -- (-826.872) (-826.222) (-829.263) [-824.265] * (-824.711) (-823.393) [-831.067] (-825.888) -- 0:00:23
622000 -- (-827.633) (-832.618) (-825.051) [-824.345] * [-824.421] (-823.477) (-826.106) (-824.165) -- 0:00:23
622500 -- (-825.432) (-826.690) [-823.183] (-825.841) * (-824.214) (-830.484) (-826.617) [-824.074] -- 0:00:23
623000 -- [-826.145] (-825.648) (-823.275) (-825.806) * [-823.349] (-827.706) (-826.356) (-827.938) -- 0:00:22
623500 -- (-825.540) (-825.536) (-824.395) [-823.234] * (-824.563) (-824.888) [-824.836] (-826.761) -- 0:00:22
624000 -- (-827.435) [-824.237] (-824.192) (-828.878) * [-824.843] (-825.773) (-825.426) (-822.932) -- 0:00:22
624500 -- [-825.282] (-824.824) (-823.322) (-823.877) * (-824.157) [-823.416] (-827.048) (-825.892) -- 0:00:22
625000 -- (-824.274) [-826.357] (-822.998) (-825.769) * [-824.747] (-823.222) (-827.789) (-823.400) -- 0:00:22
Average standard deviation of split frequencies: 0.010622
625500 -- (-823.788) (-825.649) (-827.256) [-826.979] * (-825.175) (-824.593) [-827.719] (-826.264) -- 0:00:22
626000 -- (-824.100) [-826.027] (-825.277) (-827.945) * (-826.977) [-825.291] (-823.523) (-823.977) -- 0:00:22
626500 -- (-826.851) [-824.938] (-825.901) (-827.245) * [-824.790] (-825.951) (-823.928) (-824.557) -- 0:00:22
627000 -- (-825.205) [-825.845] (-825.665) (-823.850) * [-825.385] (-825.409) (-827.759) (-824.678) -- 0:00:22
627500 -- (-824.592) (-823.131) [-824.670] (-824.719) * (-824.003) (-823.695) (-824.123) [-825.389] -- 0:00:22
628000 -- (-825.079) [-823.165] (-835.152) (-825.189) * [-825.679] (-825.723) (-824.308) (-824.915) -- 0:00:22
628500 -- (-829.885) [-826.599] (-823.913) (-826.017) * [-827.322] (-824.538) (-825.856) (-828.183) -- 0:00:22
629000 -- [-823.864] (-827.689) (-823.879) (-828.055) * (-828.947) [-826.196] (-825.822) (-825.253) -- 0:00:23
629500 -- [-827.258] (-826.927) (-826.475) (-825.796) * (-824.973) (-828.646) [-826.476] (-829.242) -- 0:00:22
630000 -- (-824.858) [-826.705] (-824.413) (-825.491) * (-825.116) (-826.774) (-826.805) [-824.341] -- 0:00:22
Average standard deviation of split frequencies: 0.009953
630500 -- (-826.071) (-830.246) [-824.048] (-824.482) * (-823.655) [-824.836] (-823.671) (-826.489) -- 0:00:22
631000 -- (-824.538) [-824.890] (-823.281) (-825.771) * (-825.040) (-823.677) (-825.448) [-824.747] -- 0:00:22
631500 -- (-824.028) (-823.627) (-823.618) [-825.472] * (-827.145) (-831.764) [-825.502] (-829.607) -- 0:00:22
632000 -- (-823.648) (-823.614) [-823.773] (-823.215) * (-827.000) (-824.583) (-823.677) [-825.946] -- 0:00:22
632500 -- [-825.487] (-822.783) (-824.765) (-824.150) * (-825.950) (-825.120) (-824.223) [-827.036] -- 0:00:22
633000 -- [-825.420] (-822.761) (-826.756) (-827.081) * [-824.846] (-826.707) (-823.755) (-823.577) -- 0:00:22
633500 -- (-827.693) [-826.004] (-823.997) (-826.113) * (-825.503) (-828.536) (-823.829) [-824.936] -- 0:00:22
634000 -- (-824.802) [-823.926] (-824.943) (-824.301) * (-823.202) (-826.356) [-826.548] (-825.392) -- 0:00:22
634500 -- (-825.239) (-828.650) (-828.224) [-825.115] * (-824.977) (-824.190) [-824.004] (-822.951) -- 0:00:22
635000 -- (-828.621) (-827.446) (-824.815) [-825.926] * (-826.591) [-823.926] (-825.178) (-822.863) -- 0:00:22
Average standard deviation of split frequencies: 0.009389
635500 -- (-824.933) (-824.925) [-824.208] (-825.713) * (-828.047) (-825.849) (-826.362) [-823.036] -- 0:00:22
636000 -- (-823.597) (-826.281) [-823.599] (-823.950) * (-828.142) [-824.549] (-825.201) (-824.206) -- 0:00:22
636500 -- (-825.842) [-824.048] (-824.249) (-829.332) * (-827.081) (-829.576) (-825.969) [-824.880] -- 0:00:22
637000 -- [-825.123] (-823.653) (-826.405) (-826.548) * (-827.730) (-823.084) [-824.213] (-827.604) -- 0:00:22
637500 -- [-824.261] (-827.508) (-828.678) (-824.418) * (-824.760) (-825.547) [-824.270] (-826.739) -- 0:00:22
638000 -- (-824.528) (-825.413) [-830.996] (-824.510) * [-825.101] (-824.544) (-824.763) (-823.700) -- 0:00:22
638500 -- [-823.653] (-826.930) (-828.327) (-824.986) * (-823.147) (-823.138) (-825.420) [-825.338] -- 0:00:22
639000 -- (-823.267) [-826.658] (-826.734) (-823.881) * (-823.162) (-824.922) (-823.349) [-823.778] -- 0:00:22
639500 -- [-825.649] (-826.984) (-824.077) (-824.887) * (-825.910) (-824.034) [-823.488] (-824.210) -- 0:00:21
640000 -- (-823.530) (-825.723) (-824.539) [-826.035] * [-824.081] (-823.273) (-829.625) (-826.284) -- 0:00:21
Average standard deviation of split frequencies: 0.009436
640500 -- [-827.806] (-824.311) (-823.466) (-825.223) * [-825.488] (-823.301) (-825.775) (-827.151) -- 0:00:21
641000 -- (-826.566) (-824.936) (-823.448) [-824.562] * [-825.286] (-824.534) (-823.033) (-825.357) -- 0:00:21
641500 -- [-826.330] (-825.026) (-823.772) (-830.079) * (-824.531) (-824.071) (-824.069) [-825.433] -- 0:00:21
642000 -- (-828.478) (-823.495) [-823.433] (-828.866) * (-826.495) (-823.773) (-826.081) [-824.852] -- 0:00:21
642500 -- (-827.018) (-823.732) (-823.881) [-824.897] * [-827.438] (-824.771) (-825.533) (-828.903) -- 0:00:21
643000 -- (-823.926) (-823.977) [-823.929] (-826.553) * [-827.367] (-825.375) (-826.656) (-824.671) -- 0:00:21
643500 -- (-826.584) (-824.052) (-826.115) [-826.202] * (-826.993) (-825.125) (-824.938) [-823.418] -- 0:00:21
644000 -- (-827.343) (-826.143) (-826.227) [-830.254] * [-825.909] (-825.548) (-824.963) (-824.359) -- 0:00:21
644500 -- (-823.053) (-827.032) [-826.943] (-823.975) * (-825.318) (-825.261) [-824.360] (-823.791) -- 0:00:21
645000 -- (-824.302) (-824.327) (-826.613) [-825.205] * (-829.130) (-825.499) [-825.805] (-825.855) -- 0:00:21
Average standard deviation of split frequencies: 0.009122
645500 -- (-824.811) (-826.665) [-828.728] (-824.203) * (-824.558) (-824.923) (-827.463) [-824.594] -- 0:00:21
646000 -- (-823.973) [-828.767] (-827.153) (-827.235) * (-825.469) (-824.800) (-824.770) [-826.154] -- 0:00:21
646500 -- (-825.178) (-825.970) [-825.327] (-825.929) * (-825.020) (-826.562) (-823.181) [-826.573] -- 0:00:21
647000 -- (-827.130) (-825.453) [-825.386] (-823.830) * (-823.635) [-825.259] (-823.311) (-826.061) -- 0:00:21
647500 -- (-823.138) (-827.681) [-824.503] (-825.577) * (-825.913) [-823.113] (-825.811) (-825.608) -- 0:00:21
648000 -- (-824.248) [-824.585] (-825.120) (-825.598) * (-823.740) [-824.096] (-828.172) (-825.261) -- 0:00:21
648500 -- (-825.481) (-825.199) [-823.293] (-825.195) * (-827.520) (-825.562) (-827.326) [-824.484] -- 0:00:21
649000 -- [-824.786] (-830.074) (-826.221) (-825.234) * [-824.988] (-823.949) (-825.535) (-823.813) -- 0:00:21
649500 -- (-828.430) (-825.945) [-823.366] (-825.524) * (-825.563) (-826.999) [-824.156] (-826.763) -- 0:00:21
650000 -- (-823.507) (-826.913) [-824.753] (-825.917) * [-831.134] (-825.913) (-826.078) (-827.232) -- 0:00:21
Average standard deviation of split frequencies: 0.009217
650500 -- [-828.918] (-823.510) (-828.898) (-824.500) * (-829.559) (-825.714) (-823.934) [-826.894] -- 0:00:21
651000 -- [-824.235] (-825.639) (-824.003) (-824.205) * (-828.172) (-825.528) (-828.528) [-826.068] -- 0:00:21
651500 -- (-824.231) (-823.301) [-824.841] (-826.252) * (-827.669) (-823.705) (-822.789) [-824.158] -- 0:00:21
652000 -- (-826.220) [-823.282] (-827.399) (-825.351) * [-824.515] (-823.677) (-823.438) (-824.793) -- 0:00:21
652500 -- (-824.825) [-823.675] (-827.729) (-824.644) * (-823.925) (-836.091) [-828.172] (-823.440) -- 0:00:21
653000 -- [-826.440] (-827.069) (-830.077) (-827.816) * (-823.774) [-827.499] (-825.490) (-827.092) -- 0:00:21
653500 -- (-833.108) (-826.525) [-825.508] (-826.488) * (-829.605) (-823.837) [-823.432] (-828.536) -- 0:00:21
654000 -- [-825.104] (-826.934) (-826.106) (-823.041) * (-829.791) (-825.285) (-823.232) [-824.903] -- 0:00:21
654500 -- (-825.206) (-825.092) [-824.441] (-823.244) * (-828.142) [-823.337] (-825.881) (-823.067) -- 0:00:21
655000 -- (-829.908) (-825.172) (-825.256) [-823.989] * (-823.901) (-823.907) [-825.665] (-824.172) -- 0:00:21
Average standard deviation of split frequencies: 0.009257
655500 -- (-827.067) (-823.855) [-826.498] (-825.092) * [-824.520] (-825.576) (-826.447) (-823.639) -- 0:00:21
656000 -- (-825.809) (-825.160) (-827.442) [-824.091] * (-826.041) (-823.837) (-827.555) [-825.383] -- 0:00:20
656500 -- (-823.687) [-823.448] (-826.664) (-823.923) * (-825.530) (-827.783) [-827.200] (-826.713) -- 0:00:20
657000 -- [-824.012] (-825.425) (-824.874) (-823.917) * (-825.371) (-823.887) [-825.238] (-824.511) -- 0:00:20
657500 -- (-824.920) (-824.626) [-826.469] (-824.933) * (-824.904) [-824.234] (-825.466) (-824.539) -- 0:00:20
658000 -- (-826.335) (-828.798) (-824.490) [-826.430] * (-824.598) (-824.291) [-824.768] (-824.152) -- 0:00:20
658500 -- (-824.773) (-827.463) (-823.079) [-824.766] * (-824.543) (-826.232) [-824.041] (-826.486) -- 0:00:20
659000 -- (-828.284) (-826.472) (-830.559) [-824.149] * (-834.721) (-825.759) [-824.796] (-825.760) -- 0:00:20
659500 -- (-825.900) [-826.272] (-826.487) (-827.531) * [-824.981] (-825.473) (-825.855) (-824.877) -- 0:00:20
660000 -- [-825.721] (-824.201) (-826.845) (-824.387) * (-825.556) (-823.755) [-823.727] (-825.713) -- 0:00:20
Average standard deviation of split frequencies: 0.009276
660500 -- (-825.555) (-825.643) (-824.610) [-825.955] * (-824.140) [-824.595] (-824.159) (-825.646) -- 0:00:20
661000 -- (-827.783) [-823.841] (-825.605) (-824.602) * (-825.115) (-826.497) [-824.214] (-825.371) -- 0:00:20
661500 -- (-824.921) [-825.392] (-825.177) (-823.903) * (-824.200) (-827.896) [-826.296] (-823.862) -- 0:00:20
662000 -- (-823.925) (-825.049) [-825.418] (-827.409) * (-826.018) (-825.379) (-825.350) [-824.083] -- 0:00:20
662500 -- (-831.334) (-825.306) (-824.723) [-823.290] * (-824.966) (-823.868) [-825.819] (-823.288) -- 0:00:20
663000 -- [-832.519] (-835.098) (-828.476) (-823.878) * (-823.885) (-827.825) (-825.471) [-825.657] -- 0:00:20
663500 -- (-828.752) (-824.121) (-824.875) [-824.161] * [-824.306] (-824.985) (-831.746) (-823.403) -- 0:00:20
664000 -- (-831.127) [-822.871] (-825.055) (-822.853) * [-823.473] (-824.540) (-825.675) (-825.195) -- 0:00:20
664500 -- (-826.144) (-825.010) [-823.158] (-824.325) * (-824.935) (-825.572) (-826.058) [-823.322] -- 0:00:20
665000 -- (-827.178) (-823.944) (-827.124) [-825.066] * (-824.194) (-824.354) [-825.635] (-823.135) -- 0:00:20
Average standard deviation of split frequencies: 0.009243
665500 -- (-823.874) (-826.432) [-824.997] (-826.324) * (-830.625) (-825.880) (-825.172) [-823.546] -- 0:00:20
666000 -- (-822.981) [-824.943] (-823.251) (-823.780) * (-825.388) [-824.797] (-824.705) (-823.044) -- 0:00:20
666500 -- (-823.297) (-824.571) [-826.977] (-824.671) * (-823.666) (-825.204) (-826.332) [-825.827] -- 0:00:20
667000 -- (-824.005) (-827.275) [-827.615] (-824.703) * (-823.642) (-826.200) [-824.824] (-823.670) -- 0:00:20
667500 -- [-824.774] (-829.090) (-825.886) (-826.503) * [-824.251] (-823.518) (-828.462) (-824.622) -- 0:00:20
668000 -- (-825.009) (-824.842) [-825.989] (-829.691) * [-826.686] (-823.356) (-829.518) (-828.586) -- 0:00:20
668500 -- [-825.229] (-823.286) (-823.687) (-827.491) * (-828.276) [-823.671] (-832.298) (-825.341) -- 0:00:20
669000 -- (-827.074) (-823.731) [-823.325] (-823.852) * [-828.886] (-823.967) (-831.057) (-824.642) -- 0:00:20
669500 -- (-829.275) (-823.837) [-824.239] (-825.022) * [-827.209] (-831.319) (-827.178) (-826.962) -- 0:00:20
670000 -- [-825.872] (-827.251) (-823.237) (-827.317) * [-825.293] (-826.412) (-823.085) (-823.810) -- 0:00:20
Average standard deviation of split frequencies: 0.009716
670500 -- [-824.918] (-826.574) (-823.807) (-825.655) * (-824.595) (-826.405) [-824.165] (-823.957) -- 0:00:20
671000 -- (-825.570) (-824.604) (-825.472) [-825.939] * (-824.645) [-823.880] (-827.302) (-822.883) -- 0:00:20
671500 -- [-823.862] (-825.376) (-828.215) (-826.243) * (-828.990) (-824.252) (-826.484) [-823.171] -- 0:00:20
672000 -- (-823.731) [-829.779] (-823.777) (-828.863) * (-826.586) (-825.317) [-825.395] (-825.438) -- 0:00:20
672500 -- [-823.442] (-834.586) (-825.265) (-826.190) * (-823.893) (-824.033) [-823.020] (-825.287) -- 0:00:19
673000 -- (-826.556) (-824.480) [-827.061] (-824.350) * [-823.398] (-825.496) (-823.783) (-824.944) -- 0:00:19
673500 -- (-824.773) (-826.635) [-828.300] (-824.230) * (-824.344) (-825.937) [-825.622] (-824.624) -- 0:00:19
674000 -- (-829.152) (-825.771) [-823.310] (-823.555) * (-823.404) [-824.498] (-827.059) (-824.652) -- 0:00:19
674500 -- (-825.074) [-824.858] (-823.308) (-823.220) * [-823.637] (-826.297) (-825.661) (-827.943) -- 0:00:19
675000 -- (-825.535) (-824.324) (-825.963) [-825.635] * (-824.864) (-828.452) [-829.296] (-826.769) -- 0:00:19
Average standard deviation of split frequencies: 0.009804
675500 -- (-825.531) [-825.591] (-825.927) (-823.993) * [-825.824] (-825.723) (-824.704) (-825.880) -- 0:00:19
676000 -- [-825.485] (-834.378) (-823.435) (-829.074) * (-825.442) [-825.967] (-823.772) (-825.167) -- 0:00:19
676500 -- [-824.093] (-828.034) (-825.473) (-824.783) * (-825.397) (-825.258) [-823.971] (-824.167) -- 0:00:19
677000 -- [-823.733] (-827.660) (-825.537) (-826.894) * (-824.464) (-826.489) (-825.449) [-824.861] -- 0:00:19
677500 -- (-824.669) (-825.782) [-824.733] (-824.020) * (-825.892) [-823.301] (-824.580) (-826.608) -- 0:00:19
678000 -- (-824.634) [-826.265] (-827.157) (-826.174) * (-826.135) [-823.786] (-826.141) (-827.029) -- 0:00:19
678500 -- (-825.079) (-823.918) [-826.067] (-825.132) * (-824.870) (-826.095) (-824.012) [-828.919] -- 0:00:19
679000 -- (-827.610) [-823.376] (-824.954) (-823.787) * (-824.396) [-825.431] (-826.691) (-827.919) -- 0:00:19
679500 -- (-824.872) (-824.268) (-827.041) [-824.556] * (-827.623) (-825.135) [-824.832] (-826.090) -- 0:00:19
680000 -- (-825.190) (-823.682) (-825.718) [-824.264] * (-826.690) (-825.805) [-825.656] (-826.017) -- 0:00:19
Average standard deviation of split frequencies: 0.009981
680500 -- [-824.416] (-825.537) (-826.685) (-823.387) * [-823.695] (-830.157) (-825.770) (-826.987) -- 0:00:19
681000 -- [-823.332] (-824.903) (-826.873) (-823.386) * (-824.582) [-824.198] (-826.711) (-827.040) -- 0:00:19
681500 -- [-827.042] (-827.874) (-827.972) (-826.459) * (-824.356) [-823.970] (-825.160) (-828.203) -- 0:00:19
682000 -- (-826.440) (-827.917) [-825.422] (-827.250) * [-829.293] (-824.929) (-830.000) (-824.449) -- 0:00:19
682500 -- (-828.493) (-823.861) (-824.999) [-823.634] * (-827.912) (-824.891) [-823.779] (-825.467) -- 0:00:19
683000 -- (-828.492) [-823.901] (-824.780) (-826.521) * (-824.828) (-824.091) (-824.823) [-826.960] -- 0:00:19
683500 -- (-827.989) (-825.412) (-825.830) [-825.452] * (-825.822) (-827.174) (-827.724) [-824.646] -- 0:00:19
684000 -- (-825.035) [-823.425] (-825.225) (-825.709) * (-823.627) [-824.958] (-825.751) (-825.620) -- 0:00:19
684500 -- (-826.607) [-824.713] (-825.391) (-823.402) * (-825.739) (-824.185) (-827.354) [-827.442] -- 0:00:19
685000 -- [-825.393] (-825.120) (-824.731) (-823.384) * [-824.757] (-824.765) (-826.446) (-823.618) -- 0:00:19
Average standard deviation of split frequencies: 0.009135
685500 -- (-824.343) (-823.358) [-824.339] (-823.578) * (-824.581) (-826.875) (-825.034) [-824.873] -- 0:00:19
686000 -- (-825.577) [-825.881] (-831.249) (-826.446) * (-825.632) (-826.946) (-826.670) [-824.675] -- 0:00:19
686500 -- (-824.305) (-827.955) (-826.959) [-825.802] * (-824.532) [-824.460] (-824.802) (-823.272) -- 0:00:19
687000 -- (-827.096) (-824.388) [-822.972] (-825.976) * (-824.897) (-824.131) (-825.848) [-825.492] -- 0:00:19
687500 -- (-826.551) (-824.993) (-823.760) [-824.349] * (-823.879) (-824.648) (-825.256) [-828.839] -- 0:00:19
688000 -- (-826.496) (-825.659) [-828.137] (-824.617) * (-825.264) (-827.193) [-826.158] (-823.853) -- 0:00:19
688500 -- (-829.596) (-824.648) (-828.284) [-824.903] * [-823.406] (-824.130) (-827.112) (-823.940) -- 0:00:19
689000 -- [-825.998] (-823.493) (-826.843) (-824.859) * (-823.983) [-823.940] (-827.736) (-824.520) -- 0:00:18
689500 -- (-822.769) (-824.711) [-823.934] (-826.042) * [-823.630] (-823.354) (-823.561) (-823.986) -- 0:00:18
690000 -- (-822.762) (-834.718) [-825.395] (-826.174) * (-825.325) (-822.984) [-823.080] (-824.577) -- 0:00:18
Average standard deviation of split frequencies: 0.008873
690500 -- (-826.118) [-825.984] (-824.149) (-827.584) * (-826.116) (-823.005) (-823.831) [-823.229] -- 0:00:18
691000 -- [-823.954] (-825.877) (-826.023) (-825.157) * (-825.298) [-825.102] (-824.779) (-823.834) -- 0:00:18
691500 -- [-824.251] (-823.771) (-828.427) (-824.485) * [-826.398] (-824.184) (-828.474) (-825.595) -- 0:00:18
692000 -- [-826.800] (-823.242) (-826.289) (-827.173) * (-826.975) [-824.010] (-830.867) (-826.199) -- 0:00:18
692500 -- [-829.100] (-829.048) (-826.745) (-825.711) * (-827.129) [-824.737] (-825.527) (-828.308) -- 0:00:18
693000 -- [-824.091] (-827.366) (-826.276) (-824.634) * [-825.337] (-825.546) (-826.074) (-824.249) -- 0:00:18
693500 -- (-822.943) (-827.138) [-825.257] (-825.943) * (-824.834) (-825.993) (-825.407) [-826.364] -- 0:00:18
694000 -- [-827.063] (-826.057) (-824.753) (-828.114) * [-825.569] (-824.541) (-826.502) (-826.880) -- 0:00:18
694500 -- (-831.493) (-826.672) [-824.604] (-826.760) * (-827.081) (-824.869) (-826.348) [-824.368] -- 0:00:18
695000 -- [-828.350] (-829.971) (-824.476) (-826.893) * (-825.744) (-826.255) (-823.859) [-826.150] -- 0:00:18
Average standard deviation of split frequencies: 0.009271
695500 -- (-824.423) (-828.347) (-824.303) [-825.401] * [-824.946] (-826.713) (-823.777) (-824.848) -- 0:00:18
696000 -- (-825.020) (-824.949) (-825.805) [-824.649] * (-825.848) (-826.613) [-824.780] (-825.105) -- 0:00:18
696500 -- (-824.225) (-828.149) [-828.599] (-828.700) * (-825.529) (-826.155) (-823.635) [-825.843] -- 0:00:18
697000 -- [-823.483] (-825.452) (-826.883) (-824.238) * [-824.649] (-825.564) (-827.241) (-825.874) -- 0:00:18
697500 -- (-826.980) [-825.780] (-826.138) (-827.217) * (-830.360) (-822.990) (-822.967) [-823.232] -- 0:00:18
698000 -- (-827.385) (-826.767) [-829.239] (-827.899) * (-823.344) (-823.674) [-825.854] (-827.678) -- 0:00:18
698500 -- (-825.353) (-825.899) (-824.180) [-825.925] * [-825.512] (-825.963) (-827.548) (-825.711) -- 0:00:18
699000 -- [-823.001] (-823.198) (-827.582) (-829.002) * (-823.133) [-825.248] (-824.040) (-825.699) -- 0:00:18
699500 -- (-826.299) [-825.537] (-825.892) (-823.220) * (-824.113) (-826.744) [-825.207] (-825.820) -- 0:00:18
700000 -- [-824.951] (-823.709) (-827.356) (-827.141) * (-822.953) (-824.806) [-827.441] (-823.592) -- 0:00:18
Average standard deviation of split frequencies: 0.009377
700500 -- [-825.514] (-825.600) (-826.917) (-823.839) * (-826.823) [-829.344] (-827.216) (-827.153) -- 0:00:18
701000 -- (-828.264) (-827.177) [-823.657] (-823.744) * [-825.881] (-823.999) (-824.252) (-823.751) -- 0:00:18
701500 -- (-824.144) (-825.838) [-827.361] (-823.616) * [-823.295] (-826.187) (-824.619) (-824.066) -- 0:00:18
702000 -- [-825.480] (-823.648) (-826.702) (-833.861) * (-825.009) (-827.927) [-828.000] (-825.790) -- 0:00:18
702500 -- (-822.922) [-824.657] (-824.546) (-825.626) * (-825.291) (-825.455) [-823.831] (-826.349) -- 0:00:18
703000 -- (-822.843) (-824.096) (-824.987) [-826.087] * (-825.578) (-823.815) (-824.877) [-826.331] -- 0:00:18
703500 -- (-824.269) (-824.292) (-825.837) [-825.684] * (-825.226) (-823.463) (-825.959) [-823.741] -- 0:00:18
704000 -- (-828.194) [-824.915] (-825.815) (-825.487) * [-823.893] (-824.328) (-826.476) (-825.604) -- 0:00:18
704500 -- (-826.412) (-825.171) [-824.925] (-825.076) * (-823.322) [-826.079] (-823.318) (-826.443) -- 0:00:18
705000 -- (-825.880) (-823.867) [-823.755] (-824.739) * [-823.271] (-824.456) (-823.064) (-827.712) -- 0:00:17
Average standard deviation of split frequencies: 0.009724
705500 -- [-825.185] (-824.154) (-826.440) (-827.624) * (-826.134) (-824.191) [-823.698] (-830.097) -- 0:00:17
706000 -- (-827.169) (-824.526) (-825.195) [-826.873] * (-824.922) (-823.404) [-823.795] (-824.753) -- 0:00:17
706500 -- (-824.017) (-826.386) [-824.214] (-826.745) * [-823.838] (-823.680) (-825.360) (-824.410) -- 0:00:17
707000 -- (-828.173) (-825.513) [-824.602] (-825.580) * (-823.427) [-824.345] (-823.574) (-825.576) -- 0:00:17
707500 -- (-827.425) [-825.918] (-826.087) (-827.836) * (-824.552) [-824.988] (-826.296) (-824.433) -- 0:00:17
708000 -- (-825.722) (-826.011) (-824.014) [-824.762] * (-824.700) [-824.639] (-824.234) (-826.207) -- 0:00:17
708500 -- (-824.222) (-832.213) (-826.498) [-825.501] * (-828.597) [-825.648] (-824.744) (-826.262) -- 0:00:17
709000 -- (-827.099) [-824.111] (-827.856) (-827.329) * (-829.463) (-825.341) (-824.634) [-827.185] -- 0:00:17
709500 -- (-827.442) [-828.332] (-825.035) (-824.195) * [-825.152] (-823.469) (-824.240) (-826.562) -- 0:00:17
710000 -- (-825.388) [-827.171] (-828.240) (-825.364) * (-824.096) (-823.954) (-825.490) [-823.881] -- 0:00:17
Average standard deviation of split frequencies: 0.009701
710500 -- (-823.435) (-827.840) (-828.233) [-825.803] * (-824.917) (-823.366) (-827.066) [-825.935] -- 0:00:17
711000 -- (-823.801) (-823.684) [-824.115] (-824.720) * (-824.268) (-825.262) [-826.084] (-827.138) -- 0:00:17
711500 -- [-825.264] (-825.623) (-824.809) (-830.426) * (-825.897) (-823.747) [-825.198] (-828.382) -- 0:00:17
712000 -- (-824.591) [-825.570] (-826.813) (-827.219) * (-824.322) [-823.848] (-825.985) (-830.430) -- 0:00:17
712500 -- [-826.971] (-827.293) (-828.276) (-825.998) * (-823.834) (-825.708) [-825.392] (-828.122) -- 0:00:17
713000 -- [-825.084] (-825.340) (-827.452) (-828.862) * (-826.012) (-826.710) [-824.510] (-827.720) -- 0:00:17
713500 -- [-826.206] (-825.605) (-829.486) (-825.863) * (-826.483) (-825.301) [-823.519] (-828.613) -- 0:00:17
714000 -- (-826.316) [-825.666] (-824.861) (-825.441) * (-828.107) (-823.381) (-827.875) [-823.929] -- 0:00:17
714500 -- (-827.394) (-824.714) (-823.688) [-826.103] * (-828.145) (-824.836) [-826.092] (-823.682) -- 0:00:17
715000 -- [-827.013] (-823.680) (-823.950) (-824.891) * (-824.777) [-826.943] (-826.039) (-824.510) -- 0:00:17
Average standard deviation of split frequencies: 0.009835
715500 -- (-828.507) [-823.248] (-823.864) (-824.538) * (-824.832) (-826.891) [-823.112] (-824.531) -- 0:00:17
716000 -- [-827.740] (-824.351) (-824.554) (-826.055) * (-824.142) (-826.555) [-824.249] (-831.032) -- 0:00:17
716500 -- (-826.080) [-823.144] (-826.593) (-827.848) * (-825.709) (-826.008) [-823.179] (-828.602) -- 0:00:17
717000 -- (-828.480) (-823.908) [-825.885] (-825.353) * (-823.555) (-826.344) [-823.185] (-824.597) -- 0:00:17
717500 -- (-826.554) (-823.908) (-827.096) [-824.498] * (-825.279) (-827.499) (-822.896) [-823.542] -- 0:00:17
718000 -- [-825.084] (-830.065) (-825.315) (-825.474) * (-826.224) (-827.183) (-824.100) [-823.942] -- 0:00:17
718500 -- [-823.420] (-829.984) (-827.640) (-831.014) * (-829.041) (-828.534) [-823.207] (-824.364) -- 0:00:17
719000 -- (-824.483) [-827.270] (-826.766) (-826.638) * (-828.234) (-829.346) [-824.389] (-823.923) -- 0:00:17
719500 -- (-824.499) (-825.589) (-826.434) [-824.381] * (-823.516) (-824.094) [-825.846] (-826.921) -- 0:00:17
720000 -- (-825.217) (-823.965) (-827.851) [-824.305] * (-825.699) [-823.889] (-826.395) (-823.455) -- 0:00:17
Average standard deviation of split frequencies: 0.009771
720500 -- (-823.171) [-825.167] (-825.109) (-825.818) * (-826.157) (-823.164) (-824.284) [-823.537] -- 0:00:17
721000 -- (-826.117) (-824.776) (-832.738) [-825.020] * (-828.223) (-826.384) (-837.612) [-824.349] -- 0:00:17
721500 -- (-824.271) (-824.084) (-828.667) [-823.761] * (-826.179) (-825.827) (-824.154) [-826.723] -- 0:00:16
722000 -- (-827.078) (-824.020) [-825.857] (-825.062) * (-828.073) [-826.410] (-826.910) (-823.446) -- 0:00:16
722500 -- (-824.476) (-823.977) [-825.846] (-825.775) * (-824.660) (-827.736) [-823.638] (-824.094) -- 0:00:16
723000 -- [-824.210] (-826.314) (-825.938) (-831.463) * (-823.615) (-825.767) [-824.582] (-824.205) -- 0:00:16
723500 -- (-829.036) (-824.520) [-827.117] (-830.865) * (-823.638) (-831.302) (-823.682) [-824.391] -- 0:00:16
724000 -- (-831.293) [-825.675] (-826.092) (-825.628) * [-824.107] (-827.623) (-830.679) (-824.748) -- 0:00:16
724500 -- [-824.271] (-824.208) (-825.484) (-824.489) * [-824.692] (-824.568) (-827.103) (-826.934) -- 0:00:16
725000 -- (-824.956) [-825.185] (-825.959) (-825.886) * [-823.204] (-826.923) (-828.645) (-824.533) -- 0:00:16
Average standard deviation of split frequencies: 0.009659
725500 -- (-829.015) (-824.738) [-825.451] (-825.940) * [-824.983] (-828.317) (-824.578) (-830.619) -- 0:00:16
726000 -- (-834.181) (-823.130) [-823.715] (-825.046) * [-824.942] (-825.488) (-827.987) (-825.033) -- 0:00:16
726500 -- (-824.300) (-824.120) (-825.586) [-827.012] * (-823.815) [-824.612] (-832.284) (-823.549) -- 0:00:16
727000 -- (-823.783) (-823.438) (-823.722) [-824.342] * [-828.444] (-824.895) (-825.459) (-827.679) -- 0:00:16
727500 -- (-823.822) (-825.653) [-826.145] (-823.681) * (-824.341) (-825.842) (-827.068) [-823.685] -- 0:00:16
728000 -- (-824.736) [-825.455] (-822.925) (-824.484) * [-825.241] (-826.297) (-828.004) (-823.653) -- 0:00:16
728500 -- (-823.694) [-827.613] (-825.646) (-826.370) * [-823.494] (-824.246) (-831.025) (-825.541) -- 0:00:16
729000 -- (-823.922) (-824.881) [-825.503] (-826.510) * [-824.227] (-828.974) (-825.165) (-823.896) -- 0:00:16
729500 -- (-824.811) [-824.779] (-827.101) (-828.353) * (-827.950) (-823.673) (-826.624) [-824.785] -- 0:00:16
730000 -- [-824.197] (-824.219) (-830.143) (-827.185) * (-822.981) [-823.336] (-826.087) (-825.231) -- 0:00:16
Average standard deviation of split frequencies: 0.009758
730500 -- [-825.569] (-823.274) (-825.895) (-825.646) * (-824.059) (-824.190) [-827.068] (-824.804) -- 0:00:16
731000 -- (-824.846) (-825.638) (-823.765) [-825.470] * (-825.406) (-824.636) [-826.141] (-823.861) -- 0:00:16
731500 -- (-826.027) (-823.462) (-824.614) [-824.861] * (-825.250) (-823.910) [-824.464] (-824.162) -- 0:00:16
732000 -- (-825.331) (-826.621) (-824.886) [-830.637] * (-827.783) (-825.043) [-827.963] (-824.162) -- 0:00:16
732500 -- (-823.510) [-831.203] (-826.774) (-824.947) * (-826.312) (-823.829) [-823.144] (-825.214) -- 0:00:16
733000 -- (-824.988) (-828.091) [-824.531] (-825.059) * [-826.572] (-823.524) (-824.783) (-823.569) -- 0:00:16
733500 -- (-825.218) [-825.007] (-823.963) (-831.384) * [-826.424] (-824.622) (-825.032) (-823.568) -- 0:00:16
734000 -- [-826.754] (-824.833) (-824.798) (-824.431) * (-826.394) [-823.853] (-825.404) (-824.194) -- 0:00:16
734500 -- (-825.534) [-827.755] (-824.967) (-823.074) * (-827.029) [-824.208] (-825.320) (-825.687) -- 0:00:16
735000 -- (-827.028) (-824.639) [-824.260] (-826.313) * [-823.665] (-824.117) (-824.752) (-826.631) -- 0:00:16
Average standard deviation of split frequencies: 0.009728
735500 -- [-826.174] (-829.848) (-826.346) (-824.662) * [-824.629] (-826.110) (-824.611) (-825.552) -- 0:00:16
736000 -- (-827.162) [-824.213] (-826.443) (-825.116) * (-824.488) (-826.627) (-823.812) [-824.909] -- 0:00:16
736500 -- (-825.856) (-823.827) (-824.648) [-824.490] * [-823.788] (-826.968) (-823.546) (-826.696) -- 0:00:16
737000 -- (-824.702) [-824.587] (-830.567) (-823.283) * [-823.294] (-824.234) (-823.537) (-826.199) -- 0:00:16
737500 -- [-826.195] (-832.378) (-823.900) (-825.273) * [-824.278] (-828.914) (-826.380) (-826.199) -- 0:00:16
738000 -- (-824.547) (-824.109) [-825.663] (-828.009) * (-831.997) (-829.144) (-829.499) [-823.588] -- 0:00:15
738500 -- (-826.540) (-823.451) [-823.932] (-830.944) * (-826.361) (-826.459) (-826.380) [-824.355] -- 0:00:15
739000 -- (-825.019) (-823.391) [-823.600] (-823.685) * (-824.925) (-824.963) [-823.493] (-826.290) -- 0:00:15
739500 -- (-825.217) (-824.759) (-823.407) [-824.895] * (-826.531) [-824.070] (-826.466) (-826.001) -- 0:00:15
740000 -- (-824.830) [-824.755] (-823.298) (-828.947) * (-827.225) (-824.744) (-828.568) [-823.762] -- 0:00:15
Average standard deviation of split frequencies: 0.009945
740500 -- (-822.966) [-828.162] (-824.645) (-824.475) * (-823.701) (-831.446) [-825.978] (-827.001) -- 0:00:15
741000 -- (-823.926) (-826.965) [-828.066] (-826.041) * (-823.896) (-824.290) (-826.995) [-827.811] -- 0:00:15
741500 -- [-826.000] (-827.292) (-829.950) (-824.908) * (-825.287) (-824.467) [-825.831] (-826.193) -- 0:00:15
742000 -- (-825.968) [-824.799] (-825.698) (-825.102) * (-826.535) (-824.395) [-825.830] (-825.025) -- 0:00:15
742500 -- [-823.975] (-825.010) (-822.954) (-823.322) * (-826.373) (-824.604) [-822.829] (-824.767) -- 0:00:15
743000 -- (-824.453) (-823.366) [-823.546] (-824.102) * (-824.280) [-829.790] (-824.855) (-826.094) -- 0:00:15
743500 -- (-823.632) (-825.288) [-824.297] (-824.480) * (-824.973) (-826.148) (-825.344) [-825.604] -- 0:00:15
744000 -- (-828.837) (-823.391) (-824.088) [-824.069] * (-828.196) (-827.079) [-824.269] (-824.312) -- 0:00:15
744500 -- (-826.827) (-823.076) (-825.814) [-825.129] * (-824.917) (-824.146) (-825.053) [-824.012] -- 0:00:15
745000 -- (-828.109) (-823.359) (-826.370) [-824.741] * (-828.398) (-825.976) [-823.646] (-824.395) -- 0:00:15
Average standard deviation of split frequencies: 0.009795
745500 -- (-826.823) (-825.092) (-824.447) [-828.896] * [-824.626] (-826.764) (-825.155) (-826.070) -- 0:00:15
746000 -- (-825.619) [-824.739] (-825.112) (-827.122) * (-823.332) (-823.500) [-825.078] (-823.563) -- 0:00:15
746500 -- (-825.180) (-828.178) [-823.978] (-827.159) * (-823.609) [-824.446] (-825.970) (-830.981) -- 0:00:15
747000 -- (-830.207) (-827.652) [-825.310] (-828.409) * (-823.483) (-830.946) [-826.954] (-823.946) -- 0:00:15
747500 -- (-824.332) (-823.681) [-826.472] (-823.746) * (-824.915) (-825.034) [-823.999] (-825.596) -- 0:00:15
748000 -- (-825.513) (-824.481) [-828.320] (-825.519) * (-823.433) (-824.233) [-823.533] (-825.476) -- 0:00:15
748500 -- (-824.410) [-823.881] (-824.668) (-826.379) * (-823.864) (-823.797) [-823.934] (-829.760) -- 0:00:15
749000 -- (-826.658) (-826.625) [-826.533] (-823.688) * (-824.508) [-823.168] (-824.067) (-826.564) -- 0:00:15
749500 -- (-827.446) (-825.594) (-823.169) [-827.382] * [-825.988] (-824.560) (-826.218) (-825.274) -- 0:00:15
750000 -- [-825.684] (-824.797) (-825.201) (-824.468) * (-824.753) (-823.618) (-826.841) [-824.551] -- 0:00:15
Average standard deviation of split frequencies: 0.010362
750500 -- (-825.020) (-825.454) (-825.467) [-824.578] * (-825.862) (-823.833) [-826.753] (-830.767) -- 0:00:15
751000 -- (-825.917) (-825.462) [-824.889] (-827.778) * (-829.289) [-823.604] (-825.409) (-824.942) -- 0:00:15
751500 -- (-825.812) (-824.349) (-826.582) [-828.528] * (-828.595) (-824.512) [-826.533] (-825.214) -- 0:00:15
752000 -- [-824.254] (-823.769) (-826.925) (-828.193) * (-825.245) [-826.172] (-828.577) (-828.359) -- 0:00:15
752500 -- [-824.197] (-824.712) (-823.986) (-825.265) * (-826.184) (-825.676) (-823.774) [-826.151] -- 0:00:15
753000 -- (-825.698) (-825.761) (-825.003) [-824.913] * (-825.203) (-825.213) [-824.699] (-825.825) -- 0:00:15
753500 -- (-824.585) (-828.406) (-824.322) [-824.876] * (-823.503) (-825.440) (-823.625) [-825.245] -- 0:00:15
754000 -- (-826.367) (-824.214) [-825.811] (-824.045) * (-825.334) (-827.503) (-828.303) [-823.967] -- 0:00:15
754500 -- (-826.982) (-823.610) [-825.264] (-825.430) * (-828.905) (-826.462) [-826.815] (-828.169) -- 0:00:14
755000 -- (-827.475) (-830.530) [-828.916] (-824.329) * (-824.333) (-823.971) [-825.074] (-827.381) -- 0:00:14
Average standard deviation of split frequencies: 0.010367
755500 -- (-826.043) [-826.740] (-825.576) (-825.885) * (-826.618) (-823.039) (-825.215) [-829.343] -- 0:00:14
756000 -- (-824.080) (-825.142) [-823.806] (-823.921) * [-823.944] (-824.569) (-824.243) (-825.298) -- 0:00:14
756500 -- [-823.599] (-824.428) (-827.827) (-827.316) * (-824.183) (-826.782) (-825.944) [-827.012] -- 0:00:14
757000 -- (-827.381) [-826.364] (-826.595) (-825.219) * [-823.388] (-826.429) (-831.093) (-823.691) -- 0:00:14
757500 -- (-825.194) [-825.857] (-827.007) (-824.845) * [-825.527] (-827.479) (-827.919) (-823.561) -- 0:00:14
758000 -- [-824.630] (-823.811) (-828.442) (-824.317) * (-824.187) [-825.127] (-827.574) (-824.137) -- 0:00:14
758500 -- (-824.465) [-823.782] (-825.594) (-824.405) * (-827.600) [-825.098] (-824.925) (-826.070) -- 0:00:14
759000 -- (-826.462) (-826.752) [-825.837] (-825.996) * [-826.823] (-825.385) (-826.602) (-824.771) -- 0:00:14
759500 -- (-823.947) (-827.983) (-824.265) [-823.445] * (-824.663) (-826.821) (-825.026) [-823.725] -- 0:00:14
760000 -- (-826.009) (-826.082) [-823.306] (-823.758) * (-824.828) (-827.092) (-825.962) [-823.651] -- 0:00:14
Average standard deviation of split frequencies: 0.010574
760500 -- (-824.268) (-825.500) [-823.792] (-826.379) * (-827.950) [-823.961] (-827.180) (-823.672) -- 0:00:14
761000 -- (-825.191) [-824.283] (-827.160) (-824.127) * (-825.210) (-824.636) (-825.528) [-824.261] -- 0:00:14
761500 -- (-829.743) (-824.126) (-828.893) [-825.952] * (-827.471) (-823.117) (-825.691) [-824.799] -- 0:00:14
762000 -- (-827.178) [-826.542] (-826.413) (-827.730) * (-829.047) [-823.435] (-825.446) (-827.090) -- 0:00:14
762500 -- [-827.838] (-823.434) (-827.506) (-824.371) * [-823.147] (-824.953) (-825.371) (-831.067) -- 0:00:14
763000 -- [-824.321] (-824.846) (-830.040) (-825.588) * (-824.192) [-823.834] (-823.851) (-825.931) -- 0:00:14
763500 -- (-823.215) (-826.215) [-824.318] (-829.535) * (-823.731) (-825.040) [-825.645] (-828.952) -- 0:00:14
764000 -- (-823.698) [-825.269] (-824.851) (-825.079) * [-824.092] (-823.219) (-823.581) (-825.672) -- 0:00:14
764500 -- (-829.140) (-826.388) (-825.533) [-825.042] * (-824.465) (-824.608) (-824.159) [-824.444] -- 0:00:14
765000 -- (-823.745) (-825.858) [-827.974] (-825.509) * [-824.275] (-825.035) (-824.404) (-825.051) -- 0:00:14
Average standard deviation of split frequencies: 0.010731
765500 -- (-825.085) (-824.100) (-834.107) [-823.126] * (-827.902) [-824.831] (-831.158) (-833.095) -- 0:00:14
766000 -- (-827.831) (-826.061) (-823.030) [-823.398] * (-823.466) (-825.106) (-827.896) [-824.927] -- 0:00:14
766500 -- (-833.837) [-827.273] (-825.951) (-825.852) * (-825.582) [-824.668] (-828.950) (-823.417) -- 0:00:14
767000 -- (-829.458) (-825.354) [-824.371] (-823.918) * (-825.691) (-824.344) [-824.056] (-824.573) -- 0:00:14
767500 -- (-823.906) [-827.365] (-824.642) (-824.578) * (-832.467) (-824.570) (-823.955) [-825.558] -- 0:00:14
768000 -- (-822.995) [-824.661] (-826.309) (-830.130) * (-824.572) (-824.707) [-823.609] (-824.173) -- 0:00:14
768500 -- [-824.747] (-823.674) (-825.263) (-824.487) * [-824.175] (-825.983) (-823.609) (-825.042) -- 0:00:14
769000 -- (-826.940) [-824.023] (-824.900) (-824.555) * (-823.673) (-823.926) [-824.503] (-826.358) -- 0:00:14
769500 -- [-827.386] (-826.020) (-824.875) (-825.218) * (-823.741) (-824.727) (-826.433) [-825.383] -- 0:00:14
770000 -- (-826.404) (-823.003) [-824.412] (-825.250) * [-824.109] (-825.183) (-828.374) (-825.418) -- 0:00:14
Average standard deviation of split frequencies: 0.010704
770500 -- (-825.185) (-824.311) [-824.557] (-824.692) * [-825.174] (-826.730) (-825.035) (-824.941) -- 0:00:13
771000 -- (-825.969) (-823.793) [-824.856] (-825.478) * [-825.730] (-824.130) (-825.639) (-823.623) -- 0:00:13
771500 -- (-825.984) (-824.533) (-828.490) [-827.353] * (-824.682) (-827.435) (-825.030) [-824.548] -- 0:00:13
772000 -- (-823.433) (-824.604) (-826.933) [-825.877] * (-826.570) (-824.822) [-824.663] (-824.075) -- 0:00:13
772500 -- (-824.977) (-829.850) (-823.608) [-823.277] * (-830.575) (-825.401) (-824.929) [-824.895] -- 0:00:13
773000 -- (-830.374) [-827.798] (-823.934) (-824.504) * (-827.204) (-825.044) (-825.196) [-823.941] -- 0:00:13
773500 -- (-828.176) (-823.248) [-826.453] (-824.194) * (-823.017) [-823.585] (-824.493) (-826.845) -- 0:00:13
774000 -- (-825.751) (-823.175) [-825.123] (-823.804) * (-824.590) (-823.668) [-825.323] (-826.871) -- 0:00:13
774500 -- [-824.810] (-823.535) (-826.014) (-826.653) * (-824.136) (-826.776) [-825.124] (-826.592) -- 0:00:13
775000 -- (-823.874) (-823.692) (-826.456) [-828.192] * (-825.045) [-824.326] (-823.794) (-826.426) -- 0:00:13
Average standard deviation of split frequencies: 0.010669
775500 -- [-825.052] (-825.218) (-824.020) (-823.577) * (-826.699) (-824.477) [-826.804] (-823.106) -- 0:00:13
776000 -- (-824.118) (-823.381) [-824.775] (-823.851) * (-825.720) [-825.150] (-824.822) (-823.279) -- 0:00:13
776500 -- (-826.106) (-823.801) (-823.230) [-824.076] * (-829.216) [-825.060] (-824.440) (-823.879) -- 0:00:13
777000 -- (-826.000) (-826.575) [-823.241] (-826.751) * (-828.075) (-826.558) (-826.261) [-825.870] -- 0:00:13
777500 -- [-825.445] (-829.083) (-829.285) (-823.286) * (-827.980) (-834.141) [-824.323] (-828.262) -- 0:00:13
778000 -- (-826.682) [-824.597] (-826.945) (-824.111) * (-828.578) (-830.894) [-826.555] (-828.228) -- 0:00:13
778500 -- (-829.142) (-824.754) (-825.093) [-826.038] * (-825.691) (-824.646) [-824.059] (-825.077) -- 0:00:13
779000 -- (-824.798) (-824.024) (-826.649) [-826.365] * [-824.879] (-828.820) (-823.282) (-824.939) -- 0:00:13
779500 -- (-826.165) [-824.657] (-828.542) (-827.663) * (-823.236) [-825.339] (-825.029) (-827.142) -- 0:00:13
780000 -- (-825.253) (-823.662) (-827.675) [-824.929] * [-823.666] (-823.470) (-826.246) (-826.454) -- 0:00:13
Average standard deviation of split frequencies: 0.010756
780500 -- (-825.102) (-823.656) (-826.933) [-826.868] * (-824.855) [-823.642] (-824.319) (-825.493) -- 0:00:13
781000 -- [-824.887] (-825.181) (-824.865) (-823.946) * (-825.965) (-823.824) (-825.391) [-823.507] -- 0:00:13
781500 -- (-824.205) (-824.831) [-824.931] (-828.097) * (-824.197) (-826.440) (-824.982) [-823.980] -- 0:00:13
782000 -- (-823.286) (-824.811) (-825.704) [-825.363] * (-824.727) (-827.481) (-828.571) [-827.166] -- 0:00:13
782500 -- (-825.758) [-826.283] (-826.280) (-825.316) * (-825.910) (-824.505) [-823.956] (-824.186) -- 0:00:13
783000 -- (-826.500) (-824.449) [-831.627] (-827.687) * [-825.757] (-825.467) (-823.624) (-825.468) -- 0:00:13
783500 -- [-824.334] (-824.208) (-830.169) (-832.124) * (-824.600) (-825.553) [-825.803] (-828.955) -- 0:00:13
784000 -- [-824.104] (-827.482) (-827.423) (-824.693) * (-825.421) [-824.964] (-827.286) (-828.136) -- 0:00:13
784500 -- [-824.114] (-825.754) (-825.045) (-829.653) * (-825.469) (-829.356) [-824.395] (-824.124) -- 0:00:13
785000 -- (-826.362) (-823.420) (-826.424) [-823.804] * (-825.319) [-827.380] (-827.385) (-823.614) -- 0:00:13
Average standard deviation of split frequencies: 0.011320
785500 -- [-825.137] (-823.238) (-824.341) (-826.383) * [-827.209] (-827.429) (-825.828) (-826.889) -- 0:00:13
786000 -- [-825.128] (-824.071) (-825.895) (-826.468) * (-829.332) (-825.946) (-823.954) [-825.408] -- 0:00:13
786500 -- (-828.272) (-827.108) [-825.217] (-823.305) * [-823.315] (-824.816) (-826.646) (-824.240) -- 0:00:13
787000 -- (-823.593) (-825.824) (-824.673) [-825.622] * (-826.518) (-826.203) (-824.212) [-823.830] -- 0:00:12
787500 -- [-823.108] (-825.489) (-826.515) (-824.731) * (-823.891) (-826.217) (-826.693) [-822.918] -- 0:00:12
788000 -- (-824.643) (-824.540) (-825.506) [-824.570] * [-825.037] (-826.366) (-826.265) (-827.038) -- 0:00:12
788500 -- (-824.489) [-825.359] (-824.694) (-830.690) * (-825.188) (-825.112) (-826.917) [-823.470] -- 0:00:12
789000 -- (-829.741) (-828.923) [-824.278] (-827.232) * (-831.712) (-825.072) [-826.763] (-827.572) -- 0:00:12
789500 -- (-824.233) (-825.733) [-824.144] (-826.406) * [-827.003] (-824.512) (-823.963) (-828.997) -- 0:00:12
790000 -- (-824.409) [-825.975] (-825.227) (-826.076) * (-826.137) (-827.146) (-825.324) [-824.741] -- 0:00:12
Average standard deviation of split frequencies: 0.010955
790500 -- (-824.577) (-827.258) [-826.609] (-826.343) * (-827.940) (-824.759) [-826.398] (-824.496) -- 0:00:12
791000 -- [-823.720] (-829.423) (-827.425) (-822.930) * [-828.550] (-826.153) (-826.558) (-824.307) -- 0:00:12
791500 -- [-824.120] (-823.675) (-827.447) (-823.145) * (-825.104) (-824.563) (-823.830) [-823.599] -- 0:00:12
792000 -- (-823.858) (-823.709) [-823.676] (-824.100) * (-828.038) [-824.491] (-824.232) (-825.364) -- 0:00:12
792500 -- (-824.029) (-825.589) [-824.155] (-823.544) * (-824.069) (-824.936) (-823.444) [-823.206] -- 0:00:12
793000 -- (-824.222) (-823.950) [-825.422] (-825.242) * (-823.008) (-829.003) (-823.271) [-823.021] -- 0:00:12
793500 -- [-823.895] (-823.591) (-827.942) (-824.650) * [-823.918] (-829.226) (-825.221) (-827.948) -- 0:00:12
794000 -- (-823.655) (-823.711) [-826.861] (-823.592) * [-823.795] (-823.793) (-826.736) (-825.759) -- 0:00:12
794500 -- (-831.014) [-824.180] (-825.624) (-823.747) * (-823.774) [-823.557] (-823.890) (-823.786) -- 0:00:12
795000 -- (-828.234) (-825.662) [-828.973] (-824.769) * (-825.651) [-825.843] (-825.566) (-824.157) -- 0:00:12
Average standard deviation of split frequencies: 0.010993
795500 -- (-824.467) [-824.605] (-825.363) (-824.362) * (-822.961) (-823.971) (-825.015) [-825.164] -- 0:00:12
796000 -- (-823.697) (-825.200) [-825.748] (-830.839) * (-826.751) (-827.506) [-835.435] (-823.445) -- 0:00:12
796500 -- (-825.739) (-824.216) [-823.431] (-824.189) * (-825.380) [-825.454] (-826.155) (-826.197) -- 0:00:12
797000 -- (-825.223) (-824.494) (-823.029) [-825.050] * (-824.515) (-825.903) [-823.272] (-823.892) -- 0:00:12
797500 -- (-825.559) (-829.900) [-825.506] (-823.937) * [-823.617] (-825.755) (-826.371) (-823.891) -- 0:00:12
798000 -- [-825.268] (-826.060) (-824.584) (-826.801) * (-824.778) [-826.248] (-825.185) (-825.663) -- 0:00:12
798500 -- (-824.870) (-826.188) [-823.141] (-825.012) * (-824.112) (-826.192) (-826.579) [-825.682] -- 0:00:12
799000 -- (-823.932) (-827.909) (-824.156) [-824.351] * (-827.837) (-826.768) (-825.922) [-826.128] -- 0:00:12
799500 -- (-823.468) (-826.378) (-827.430) [-823.560] * (-825.258) [-823.450] (-824.189) (-825.965) -- 0:00:12
800000 -- (-824.018) (-825.981) [-826.899] (-824.188) * (-827.843) [-823.893] (-825.091) (-825.819) -- 0:00:12
Average standard deviation of split frequencies: 0.010745
800500 -- (-824.737) [-825.282] (-824.739) (-823.896) * (-825.718) [-824.696] (-824.775) (-824.195) -- 0:00:12
801000 -- [-824.067] (-824.687) (-828.806) (-825.211) * (-824.468) (-826.047) (-824.763) [-824.487] -- 0:00:12
801500 -- (-828.245) (-825.531) [-827.346] (-827.847) * [-823.437] (-826.462) (-824.808) (-823.690) -- 0:00:12
802000 -- (-824.067) (-826.372) [-826.526] (-824.365) * (-824.800) (-825.221) [-824.814] (-825.602) -- 0:00:12
802500 -- (-824.377) (-825.070) (-826.537) [-823.920] * [-823.967] (-824.146) (-823.987) (-824.081) -- 0:00:12
803000 -- (-830.207) [-823.573] (-823.823) (-824.660) * [-824.163] (-825.328) (-824.731) (-824.537) -- 0:00:12
803500 -- (-823.781) (-827.260) [-823.463] (-824.182) * [-826.268] (-824.867) (-824.114) (-824.823) -- 0:00:11
804000 -- [-825.021] (-824.801) (-824.846) (-824.048) * (-826.661) [-823.499] (-826.257) (-824.865) -- 0:00:11
804500 -- (-823.350) [-825.942] (-827.782) (-827.733) * (-823.242) [-828.604] (-825.792) (-823.747) -- 0:00:11
805000 -- (-826.389) [-823.616] (-826.295) (-825.661) * (-826.875) (-823.519) (-824.135) [-827.365] -- 0:00:11
Average standard deviation of split frequencies: 0.010162
805500 -- [-824.064] (-824.864) (-824.014) (-829.208) * (-828.987) [-824.201] (-824.835) (-825.480) -- 0:00:11
806000 -- (-830.109) [-825.897] (-826.361) (-825.806) * (-829.981) (-823.566) [-823.316] (-823.535) -- 0:00:11
806500 -- (-829.279) (-827.213) (-825.056) [-825.045] * (-824.400) (-825.498) (-830.845) [-824.825] -- 0:00:11
807000 -- (-823.896) [-825.022] (-827.288) (-823.714) * (-826.564) (-826.459) (-826.249) [-824.021] -- 0:00:11
807500 -- (-824.785) (-825.613) (-827.046) [-826.723] * [-826.619] (-825.587) (-825.631) (-829.844) -- 0:00:11
808000 -- (-824.506) [-828.414] (-826.366) (-825.772) * (-824.291) (-826.260) [-825.337] (-828.484) -- 0:00:11
808500 -- (-825.333) [-824.840] (-825.208) (-823.748) * (-824.036) [-824.833] (-825.378) (-828.544) -- 0:00:11
809000 -- (-824.972) (-827.676) (-825.048) [-823.130] * (-824.587) (-828.349) [-823.553] (-826.950) -- 0:00:11
809500 -- (-823.953) [-825.497] (-828.857) (-827.316) * (-826.935) (-824.616) (-823.711) [-824.351] -- 0:00:11
810000 -- (-825.351) [-826.504] (-824.531) (-825.658) * (-825.811) (-824.295) [-823.972] (-825.487) -- 0:00:11
Average standard deviation of split frequencies: 0.010067
810500 -- (-828.941) [-827.925] (-826.565) (-823.047) * (-824.170) (-823.566) [-823.892] (-825.376) -- 0:00:11
811000 -- (-827.537) [-824.624] (-826.368) (-823.047) * (-824.684) (-824.909) [-823.611] (-824.660) -- 0:00:11
811500 -- [-823.246] (-824.477) (-825.510) (-828.550) * (-825.545) [-828.903] (-826.398) (-823.799) -- 0:00:11
812000 -- [-823.502] (-825.080) (-827.237) (-832.613) * (-823.259) (-823.463) (-826.291) [-825.286] -- 0:00:11
812500 -- (-826.266) (-825.696) (-825.588) [-824.310] * (-826.113) [-824.408] (-826.149) (-828.152) -- 0:00:11
813000 -- (-826.850) (-824.500) [-823.507] (-823.748) * [-826.947] (-823.171) (-823.381) (-825.184) -- 0:00:11
813500 -- (-826.517) (-823.418) [-826.368] (-825.401) * (-825.488) (-823.171) (-825.605) [-825.952] -- 0:00:11
814000 -- [-831.032] (-823.160) (-823.785) (-824.885) * (-825.185) (-826.117) [-824.736] (-824.961) -- 0:00:11
814500 -- (-826.982) (-824.006) (-826.896) [-824.478] * (-825.540) [-824.283] (-824.633) (-826.342) -- 0:00:11
815000 -- (-824.797) (-823.807) (-828.927) [-824.544] * (-824.025) (-823.706) (-823.987) [-828.797] -- 0:00:11
Average standard deviation of split frequencies: 0.010146
815500 -- (-826.483) (-824.918) (-830.142) [-823.245] * (-824.245) [-827.698] (-826.252) (-827.986) -- 0:00:11
816000 -- (-827.461) [-826.236] (-825.257) (-824.422) * (-823.989) (-827.727) [-824.695] (-827.460) -- 0:00:11
816500 -- (-824.976) [-826.164] (-826.326) (-824.697) * (-824.317) (-825.106) [-824.168] (-827.645) -- 0:00:11
817000 -- [-828.644] (-827.870) (-824.747) (-824.230) * (-825.951) (-824.416) [-823.900] (-824.601) -- 0:00:11
817500 -- (-827.071) (-829.688) (-824.020) [-823.381] * [-824.660] (-827.354) (-824.137) (-825.131) -- 0:00:11
818000 -- (-824.558) (-825.362) [-824.506] (-823.686) * (-823.796) (-825.653) (-826.993) [-824.749] -- 0:00:11
818500 -- [-823.179] (-829.015) (-825.339) (-825.862) * (-825.431) (-824.873) [-825.032] (-827.659) -- 0:00:11
819000 -- (-824.979) [-826.042] (-823.989) (-825.454) * (-825.380) (-828.299) [-824.223] (-831.083) -- 0:00:11
819500 -- (-827.337) [-826.807] (-824.829) (-829.680) * (-825.891) (-826.790) [-823.848] (-824.817) -- 0:00:11
820000 -- [-825.277] (-826.497) (-825.853) (-831.604) * (-824.585) [-825.134] (-824.074) (-831.735) -- 0:00:10
Average standard deviation of split frequencies: 0.010663
820500 -- (-827.108) (-826.102) (-826.489) [-826.540] * (-823.650) (-826.780) (-823.866) [-828.370] -- 0:00:10
821000 -- (-825.795) (-824.193) [-826.868] (-825.257) * [-824.239] (-823.863) (-825.339) (-828.871) -- 0:00:10
821500 -- (-825.792) (-825.597) [-823.853] (-826.641) * (-824.308) [-824.192] (-823.325) (-823.662) -- 0:00:10
822000 -- (-826.784) [-827.172] (-824.262) (-826.449) * (-827.757) (-823.471) (-825.963) [-823.639] -- 0:00:10
822500 -- [-827.527] (-828.325) (-828.181) (-830.075) * (-827.055) (-823.663) (-827.197) [-823.641] -- 0:00:10
823000 -- [-826.889] (-825.986) (-828.476) (-823.553) * (-823.783) (-824.070) (-827.173) [-823.332] -- 0:00:10
823500 -- (-826.882) (-824.101) [-826.124] (-823.878) * (-824.096) (-823.070) (-827.635) [-823.450] -- 0:00:10
824000 -- (-827.095) [-823.864] (-823.326) (-826.244) * (-824.057) (-823.086) (-826.145) [-823.612] -- 0:00:10
824500 -- [-824.132] (-828.335) (-827.221) (-823.219) * (-825.799) (-823.484) (-825.402) [-823.021] -- 0:00:10
825000 -- [-825.488] (-828.130) (-826.920) (-825.154) * (-824.242) (-826.310) [-826.527] (-823.919) -- 0:00:10
Average standard deviation of split frequencies: 0.010340
825500 -- [-825.558] (-823.387) (-829.102) (-828.660) * (-823.886) [-829.648] (-824.254) (-825.272) -- 0:00:10
826000 -- (-825.069) (-823.177) [-828.961] (-825.013) * (-824.177) (-828.317) (-823.984) [-824.820] -- 0:00:10
826500 -- (-825.089) (-825.718) (-826.673) [-824.453] * (-829.811) (-826.296) (-824.776) [-823.625] -- 0:00:10
827000 -- [-827.066] (-825.047) (-824.892) (-823.437) * [-830.029] (-827.489) (-826.734) (-824.261) -- 0:00:10
827500 -- (-826.241) (-823.176) (-824.467) [-824.967] * (-824.180) (-824.187) [-823.001] (-824.953) -- 0:00:10
828000 -- (-827.674) (-826.341) [-823.794] (-823.352) * (-823.343) (-826.691) [-823.108] (-823.181) -- 0:00:10
828500 -- (-824.111) [-823.543] (-827.596) (-824.015) * [-826.860] (-826.001) (-824.620) (-823.660) -- 0:00:10
829000 -- (-825.288) [-824.467] (-825.087) (-824.258) * (-824.442) (-828.829) [-824.449] (-822.902) -- 0:00:10
829500 -- [-825.914] (-825.078) (-824.853) (-825.713) * (-826.538) (-828.322) (-826.001) [-824.260] -- 0:00:10
830000 -- (-823.450) (-825.947) (-824.049) [-825.192] * [-825.275] (-824.816) (-826.464) (-825.767) -- 0:00:10
Average standard deviation of split frequencies: 0.010282
830500 -- (-826.443) (-824.022) (-826.432) [-826.456] * (-824.046) (-826.563) (-825.796) [-827.945] -- 0:00:10
831000 -- [-826.761] (-825.233) (-825.296) (-830.390) * (-823.284) (-824.858) [-824.227] (-827.164) -- 0:00:10
831500 -- (-825.603) [-824.407] (-823.624) (-824.444) * (-825.826) (-825.225) [-823.301] (-823.258) -- 0:00:10
832000 -- (-824.326) [-823.617] (-826.708) (-823.434) * (-829.784) [-827.467] (-825.050) (-823.121) -- 0:00:10
832500 -- (-825.051) (-827.421) (-826.779) [-823.183] * (-830.279) (-824.326) (-824.175) [-824.764] -- 0:00:10
833000 -- (-823.342) (-826.698) (-825.837) [-823.513] * [-827.712] (-829.117) (-824.585) (-825.766) -- 0:00:10
833500 -- [-823.445] (-826.349) (-823.678) (-823.352) * [-827.501] (-826.255) (-826.197) (-823.931) -- 0:00:10
834000 -- (-825.095) (-825.182) [-823.858] (-824.083) * (-828.491) (-824.490) [-825.544] (-824.572) -- 0:00:10
834500 -- [-828.404] (-825.689) (-825.211) (-823.355) * (-827.241) (-826.503) (-823.989) [-824.329] -- 0:00:10
835000 -- (-825.486) [-824.665] (-826.835) (-826.586) * (-828.044) (-824.288) [-823.987] (-823.771) -- 0:00:10
Average standard deviation of split frequencies: 0.010415
835500 -- [-825.048] (-825.454) (-826.801) (-826.618) * (-826.733) (-823.902) [-824.115] (-824.196) -- 0:00:10
836000 -- (-824.807) (-824.774) [-825.885] (-823.180) * [-826.210] (-824.287) (-823.665) (-827.913) -- 0:00:10
836500 -- (-826.971) (-824.745) [-829.837] (-825.552) * (-826.210) [-827.782] (-823.871) (-828.337) -- 0:00:09
837000 -- (-825.834) (-825.483) (-825.883) [-825.449] * [-827.027] (-823.771) (-825.041) (-825.875) -- 0:00:09
837500 -- (-825.674) (-826.225) [-824.653] (-823.008) * (-826.558) [-823.549] (-824.374) (-827.588) -- 0:00:09
838000 -- (-823.824) (-824.547) (-828.074) [-823.472] * (-827.023) (-823.720) [-823.263] (-828.403) -- 0:00:09
838500 -- (-823.414) (-825.881) (-825.970) [-825.360] * (-827.006) [-825.006] (-823.859) (-830.032) -- 0:00:09
839000 -- (-823.872) (-823.307) (-825.274) [-825.954] * (-829.953) [-823.905] (-824.548) (-825.612) -- 0:00:09
839500 -- (-823.631) (-825.234) [-823.737] (-824.050) * (-826.546) (-826.607) [-825.533] (-825.066) -- 0:00:09
840000 -- (-825.191) [-825.035] (-825.561) (-823.614) * (-830.322) [-823.205] (-827.048) (-824.053) -- 0:00:09
Average standard deviation of split frequencies: 0.010127
840500 -- (-826.663) [-826.896] (-828.196) (-825.363) * (-827.415) (-823.440) [-823.961] (-825.063) -- 0:00:09
841000 -- (-827.532) (-829.388) (-827.844) [-825.139] * (-824.548) (-823.250) [-823.644] (-826.868) -- 0:00:09
841500 -- (-824.015) (-828.284) [-827.189] (-827.020) * (-824.954) [-824.985] (-823.937) (-826.343) -- 0:00:09
842000 -- (-823.464) (-828.926) [-824.448] (-826.588) * (-824.231) (-828.614) (-826.053) [-824.476] -- 0:00:09
842500 -- [-826.651] (-825.263) (-825.606) (-830.661) * [-823.485] (-824.744) (-823.903) (-824.856) -- 0:00:09
843000 -- (-827.279) (-826.489) (-824.395) [-826.891] * (-828.205) (-824.045) (-824.680) [-824.005] -- 0:00:09
843500 -- (-829.239) (-824.009) [-823.950] (-826.639) * (-823.769) [-825.541] (-824.086) (-825.420) -- 0:00:09
844000 -- (-832.914) (-826.264) (-825.265) [-823.385] * [-824.862] (-825.021) (-823.319) (-825.180) -- 0:00:09
844500 -- (-827.795) (-824.687) (-824.690) [-824.954] * (-823.898) [-824.149] (-824.804) (-825.474) -- 0:00:09
845000 -- (-827.263) (-826.075) [-824.174] (-824.750) * [-829.516] (-826.081) (-825.380) (-828.319) -- 0:00:09
Average standard deviation of split frequencies: 0.010194
845500 -- [-826.088] (-824.691) (-825.113) (-830.944) * (-826.846) (-825.474) (-823.555) [-824.144] -- 0:00:09
846000 -- (-830.196) (-828.253) (-824.605) [-827.830] * (-824.427) [-825.915] (-827.836) (-825.286) -- 0:00:09
846500 -- (-825.922) (-827.006) (-824.094) [-824.971] * [-825.408] (-824.310) (-829.319) (-827.430) -- 0:00:09
847000 -- [-823.196] (-824.689) (-824.990) (-830.334) * (-825.609) [-826.137] (-824.887) (-824.922) -- 0:00:09
847500 -- [-824.287] (-826.702) (-824.074) (-827.928) * (-825.439) (-825.156) [-824.705] (-826.914) -- 0:00:09
848000 -- [-824.215] (-824.446) (-823.208) (-823.841) * (-827.416) [-825.501] (-824.494) (-825.874) -- 0:00:09
848500 -- (-824.280) (-825.708) (-825.170) [-823.426] * [-824.705] (-827.975) (-824.457) (-823.573) -- 0:00:09
849000 -- (-824.937) (-825.069) [-823.828] (-823.696) * (-824.532) [-824.055] (-827.806) (-823.538) -- 0:00:09
849500 -- (-823.828) (-828.777) [-826.116] (-824.818) * (-824.409) (-828.342) [-824.530] (-826.442) -- 0:00:09
850000 -- (-824.106) [-824.071] (-824.477) (-824.689) * (-825.099) (-826.713) [-823.340] (-826.202) -- 0:00:09
Average standard deviation of split frequencies: 0.010366
850500 -- (-825.267) (-827.150) [-823.915] (-823.602) * (-827.062) [-826.027] (-827.773) (-823.426) -- 0:00:09
851000 -- (-829.129) [-825.512] (-826.259) (-824.399) * (-823.904) [-825.146] (-828.845) (-824.187) -- 0:00:09
851500 -- (-825.117) [-825.874] (-824.596) (-824.490) * [-824.084] (-825.088) (-826.844) (-825.519) -- 0:00:09
852000 -- (-825.651) (-826.988) (-827.742) [-824.737] * (-828.925) (-829.966) [-828.255] (-826.153) -- 0:00:09
852500 -- (-826.745) (-823.644) (-828.148) [-824.593] * (-824.638) [-824.672] (-825.056) (-824.341) -- 0:00:08
853000 -- (-825.843) [-827.154] (-825.157) (-824.232) * [-824.507] (-823.872) (-826.071) (-826.117) -- 0:00:08
853500 -- (-824.327) (-829.362) (-826.989) [-823.444] * [-824.409] (-828.186) (-825.070) (-827.454) -- 0:00:08
854000 -- (-830.803) (-829.455) (-824.122) [-825.532] * (-827.598) [-827.381] (-829.968) (-826.376) -- 0:00:08
854500 -- (-826.494) [-826.759] (-824.645) (-823.298) * (-828.416) (-827.861) (-827.726) [-825.601] -- 0:00:08
855000 -- [-827.344] (-825.673) (-824.728) (-823.575) * (-826.100) (-825.214) (-826.311) [-825.625] -- 0:00:08
Average standard deviation of split frequencies: 0.009978
855500 -- (-827.893) (-829.898) [-825.471] (-823.890) * (-828.084) (-824.236) (-823.696) [-823.822] -- 0:00:08
856000 -- (-829.452) [-827.668] (-830.395) (-823.436) * (-824.956) (-826.520) [-823.881] (-824.003) -- 0:00:08
856500 -- [-823.907] (-824.330) (-824.057) (-824.347) * (-825.531) [-825.479] (-826.469) (-823.158) -- 0:00:08
857000 -- (-825.332) (-825.352) [-824.624] (-825.020) * (-824.910) (-825.239) (-825.218) [-823.817] -- 0:00:08
857500 -- (-827.588) (-829.723) (-825.096) [-825.096] * [-824.465] (-827.982) (-823.871) (-827.490) -- 0:00:08
858000 -- (-827.902) (-826.412) [-823.863] (-823.999) * [-823.826] (-824.983) (-826.341) (-826.588) -- 0:00:08
858500 -- (-824.222) [-825.085] (-828.171) (-831.832) * [-825.665] (-824.581) (-824.982) (-824.506) -- 0:00:08
859000 -- (-824.064) (-824.914) [-824.305] (-827.961) * (-823.945) [-823.866] (-823.828) (-825.330) -- 0:00:08
859500 -- [-824.375] (-825.543) (-824.095) (-826.702) * (-823.107) (-823.652) [-825.874] (-823.772) -- 0:00:08
860000 -- (-825.494) (-823.773) [-823.806] (-823.644) * (-824.150) (-823.906) (-825.259) [-823.926] -- 0:00:08
Average standard deviation of split frequencies: 0.009891
860500 -- (-825.129) (-824.978) (-825.103) [-824.414] * (-822.963) (-823.826) (-824.736) [-825.704] -- 0:00:08
861000 -- (-825.658) (-825.806) (-828.388) [-824.507] * (-827.277) [-824.194] (-827.043) (-824.110) -- 0:00:08
861500 -- (-825.113) (-825.666) [-824.804] (-824.307) * (-828.300) (-827.282) [-823.932] (-824.976) -- 0:00:08
862000 -- (-823.543) (-825.888) [-827.461] (-827.669) * [-824.512] (-827.618) (-827.567) (-829.731) -- 0:00:08
862500 -- (-823.145) (-828.994) (-824.759) [-826.664] * (-826.341) (-825.664) (-824.990) [-824.791] -- 0:00:08
863000 -- (-823.050) (-825.642) [-825.138] (-827.934) * (-824.756) [-824.134] (-825.294) (-826.754) -- 0:00:08
863500 -- [-823.285] (-825.887) (-825.350) (-823.852) * [-824.606] (-826.242) (-824.788) (-826.239) -- 0:00:08
864000 -- (-824.212) (-825.983) (-824.861) [-828.631] * (-824.924) (-824.041) (-828.578) [-824.924] -- 0:00:08
864500 -- (-825.300) (-824.801) (-824.618) [-826.115] * (-825.314) (-823.651) [-825.752] (-824.891) -- 0:00:08
865000 -- (-823.544) (-824.267) [-827.634] (-824.904) * (-825.224) [-823.529] (-826.386) (-824.857) -- 0:00:08
Average standard deviation of split frequencies: 0.009830
865500 -- [-823.135] (-823.557) (-825.532) (-825.581) * (-829.681) [-825.761] (-824.084) (-826.188) -- 0:00:08
866000 -- [-825.179] (-826.584) (-827.267) (-825.273) * (-824.365) (-825.046) (-824.270) [-823.865] -- 0:00:08
866500 -- (-827.611) [-823.790] (-823.840) (-826.626) * (-826.229) (-829.601) [-823.428] (-824.126) -- 0:00:08
867000 -- (-825.060) (-824.887) (-823.636) [-826.270] * (-825.206) (-828.960) (-825.605) [-826.066] -- 0:00:08
867500 -- (-827.688) [-823.569] (-824.424) (-825.496) * (-825.805) [-824.078] (-824.910) (-824.349) -- 0:00:08
868000 -- (-824.571) (-829.701) (-828.878) [-824.443] * [-827.133] (-827.315) (-824.837) (-825.368) -- 0:00:08
868500 -- [-825.809] (-825.350) (-824.520) (-825.388) * (-825.262) (-829.470) (-824.793) [-827.000] -- 0:00:08
869000 -- (-824.523) [-827.562] (-824.036) (-827.006) * [-824.439] (-825.809) (-825.610) (-826.126) -- 0:00:07
869500 -- [-824.608] (-823.808) (-825.844) (-826.301) * [-823.373] (-827.727) (-823.841) (-825.641) -- 0:00:07
870000 -- [-824.233] (-825.931) (-826.249) (-825.932) * (-826.277) (-826.193) [-824.978] (-825.228) -- 0:00:07
Average standard deviation of split frequencies: 0.009586
870500 -- [-824.104] (-824.400) (-826.042) (-823.573) * (-826.989) (-827.510) (-824.444) [-825.249] -- 0:00:07
871000 -- [-825.613] (-827.922) (-825.681) (-824.534) * (-826.762) [-823.610] (-825.636) (-826.759) -- 0:00:07
871500 -- (-823.779) (-826.046) (-827.065) [-825.148] * (-833.302) (-826.038) (-826.746) [-823.625] -- 0:00:07
872000 -- [-823.889] (-825.677) (-825.637) (-824.899) * (-825.204) [-824.411] (-829.037) (-824.202) -- 0:00:07
872500 -- (-823.249) (-825.006) [-825.275] (-825.002) * (-824.760) [-823.570] (-824.486) (-826.125) -- 0:00:07
873000 -- (-827.876) (-827.611) (-824.811) [-825.508] * [-824.416] (-826.996) (-824.612) (-824.068) -- 0:00:07
873500 -- (-827.075) (-827.725) [-824.223] (-826.559) * (-827.874) [-824.174] (-826.591) (-824.190) -- 0:00:07
874000 -- (-825.740) (-828.176) (-824.723) [-823.687] * [-826.977] (-825.211) (-825.799) (-826.643) -- 0:00:07
874500 -- [-826.131] (-824.026) (-824.936) (-825.199) * (-828.074) [-825.091] (-830.558) (-827.263) -- 0:00:07
875000 -- (-823.334) [-826.266] (-824.673) (-825.396) * (-823.745) [-824.892] (-829.554) (-827.059) -- 0:00:07
Average standard deviation of split frequencies: 0.009940
875500 -- (-823.919) (-823.749) [-824.047] (-826.839) * (-824.868) (-824.046) (-825.333) [-824.349] -- 0:00:07
876000 -- (-824.079) [-823.224] (-822.933) (-823.913) * (-824.008) (-823.436) [-825.724] (-824.228) -- 0:00:07
876500 -- (-829.098) (-823.542) [-823.071] (-828.568) * (-826.646) [-824.499] (-826.201) (-824.010) -- 0:00:07
877000 -- (-825.944) [-824.211] (-824.318) (-823.815) * (-828.425) (-824.341) [-828.358] (-828.874) -- 0:00:07
877500 -- (-827.378) (-828.031) [-823.110] (-828.430) * (-829.473) (-824.589) [-825.377] (-824.774) -- 0:00:07
878000 -- (-823.128) (-826.869) (-826.533) [-824.168] * [-827.438] (-824.460) (-825.505) (-826.582) -- 0:00:07
878500 -- [-823.915] (-826.031) (-828.193) (-823.850) * [-824.798] (-826.971) (-827.352) (-824.916) -- 0:00:07
879000 -- [-827.265] (-823.445) (-827.861) (-825.453) * [-825.926] (-825.917) (-824.609) (-826.490) -- 0:00:07
879500 -- [-825.546] (-823.644) (-828.766) (-823.743) * (-823.842) (-829.135) [-824.282] (-829.479) -- 0:00:07
880000 -- (-824.015) (-824.798) [-825.375] (-823.505) * (-827.781) (-831.857) [-828.069] (-826.026) -- 0:00:07
Average standard deviation of split frequencies: 0.009635
880500 -- (-825.220) [-825.770] (-825.150) (-823.991) * (-823.847) [-825.325] (-825.749) (-825.057) -- 0:00:07
881000 -- (-825.747) [-825.853] (-825.958) (-823.937) * (-824.491) (-825.048) (-826.815) [-824.369] -- 0:00:07
881500 -- (-824.841) (-826.212) (-825.684) [-824.691] * (-823.976) (-824.215) [-825.316] (-828.079) -- 0:00:07
882000 -- (-823.732) (-823.530) (-824.379) [-823.907] * (-823.021) (-823.465) [-823.904] (-823.767) -- 0:00:07
882500 -- (-825.073) (-824.852) [-824.679] (-831.446) * (-823.182) [-825.132] (-825.987) (-831.249) -- 0:00:07
883000 -- (-830.256) (-823.211) [-825.893] (-827.682) * (-824.076) [-823.748] (-823.801) (-825.816) -- 0:00:07
883500 -- [-825.767] (-826.569) (-829.082) (-825.301) * (-826.760) (-826.243) (-823.717) [-825.051] -- 0:00:07
884000 -- (-826.592) [-823.127] (-825.756) (-828.673) * (-824.992) [-824.929] (-826.205) (-825.245) -- 0:00:07
884500 -- (-824.304) [-823.569] (-825.506) (-823.173) * (-825.778) (-828.164) [-826.821] (-828.357) -- 0:00:07
885000 -- (-823.740) (-828.945) [-825.333] (-823.436) * (-829.940) (-826.285) [-823.912] (-823.693) -- 0:00:07
Average standard deviation of split frequencies: 0.009765
885500 -- (-826.965) (-829.801) [-825.582] (-826.255) * [-827.587] (-825.014) (-828.453) (-824.837) -- 0:00:06
886000 -- [-823.861] (-825.650) (-823.778) (-824.456) * (-823.849) (-826.157) (-828.061) [-829.347] -- 0:00:06
886500 -- (-826.515) (-826.669) [-823.314] (-824.622) * (-823.497) [-824.743] (-826.833) (-825.199) -- 0:00:06
887000 -- (-825.458) (-824.826) (-826.137) [-824.650] * [-823.345] (-825.532) (-823.774) (-825.857) -- 0:00:06
887500 -- [-823.048] (-824.267) (-827.254) (-823.444) * (-823.402) [-824.315] (-825.561) (-827.087) -- 0:00:06
888000 -- (-825.030) (-826.244) (-825.536) [-823.112] * [-823.583] (-826.362) (-824.558) (-824.822) -- 0:00:06
888500 -- (-825.439) [-824.616] (-825.026) (-825.193) * (-826.056) [-824.670] (-825.012) (-823.996) -- 0:00:06
889000 -- (-823.900) (-824.748) (-824.089) [-825.276] * (-825.133) (-827.162) [-823.980] (-828.046) -- 0:00:06
889500 -- [-823.786] (-823.868) (-823.216) (-826.015) * (-825.226) (-823.268) (-822.849) [-824.393] -- 0:00:06
890000 -- (-823.912) (-827.263) (-824.768) [-822.952] * (-824.978) (-825.755) (-826.079) [-824.852] -- 0:00:06
Average standard deviation of split frequencies: 0.009714
890500 -- [-823.814] (-824.568) (-824.266) (-823.336) * (-826.188) (-823.998) [-824.609] (-825.007) -- 0:00:06
891000 -- (-827.273) [-826.769] (-824.958) (-826.720) * (-826.155) (-825.795) (-825.824) [-823.950] -- 0:00:06
891500 -- [-826.907] (-826.122) (-824.195) (-824.914) * (-823.454) [-825.241] (-831.100) (-822.905) -- 0:00:06
892000 -- [-824.622] (-825.668) (-825.918) (-826.231) * (-824.856) [-824.858] (-825.963) (-823.845) -- 0:00:06
892500 -- (-826.365) (-824.314) [-825.350] (-827.409) * [-825.193] (-824.980) (-824.061) (-828.909) -- 0:00:06
893000 -- (-825.849) (-824.931) (-825.443) [-825.869] * (-827.330) (-826.617) (-822.845) [-829.021] -- 0:00:06
893500 -- [-829.339] (-826.009) (-825.163) (-825.541) * (-824.021) [-824.945] (-823.542) (-824.724) -- 0:00:06
894000 -- (-827.690) (-828.548) [-827.712] (-831.199) * (-825.403) [-826.737] (-828.094) (-828.777) -- 0:00:06
894500 -- (-823.933) (-827.109) (-825.710) [-827.179] * (-825.405) (-825.162) (-826.474) [-829.321] -- 0:00:06
895000 -- (-824.708) [-824.736] (-823.761) (-823.577) * [-824.952] (-825.841) (-828.435) (-823.417) -- 0:00:06
Average standard deviation of split frequencies: 0.009996
895500 -- (-825.005) [-826.738] (-823.693) (-825.941) * [-824.386] (-825.674) (-824.915) (-824.639) -- 0:00:06
896000 -- (-829.882) (-823.831) [-823.698] (-823.695) * [-825.613] (-824.739) (-823.085) (-824.135) -- 0:00:06
896500 -- [-824.909] (-824.388) (-823.638) (-824.173) * (-824.518) (-827.338) [-825.728] (-825.315) -- 0:00:06
897000 -- [-826.322] (-825.858) (-825.376) (-825.722) * (-825.965) [-823.328] (-826.240) (-824.545) -- 0:00:06
897500 -- [-824.424] (-827.144) (-825.414) (-825.145) * (-827.485) (-824.976) (-824.615) [-824.115] -- 0:00:06
898000 -- (-824.729) [-824.902] (-826.327) (-824.624) * (-826.187) (-824.053) [-824.636] (-826.948) -- 0:00:06
898500 -- [-823.722] (-827.026) (-828.386) (-825.178) * [-824.080] (-825.603) (-824.600) (-826.747) -- 0:00:06
899000 -- [-823.555] (-825.439) (-824.943) (-827.063) * (-827.752) (-825.473) [-825.349] (-823.872) -- 0:00:06
899500 -- (-823.925) [-825.879] (-825.834) (-828.725) * [-826.089] (-825.240) (-823.480) (-824.882) -- 0:00:06
900000 -- (-823.103) (-825.505) (-826.047) [-827.824] * (-825.066) [-824.520] (-824.218) (-826.582) -- 0:00:06
Average standard deviation of split frequencies: 0.009483
900500 -- (-823.774) (-826.301) (-826.270) [-824.564] * [-823.649] (-824.197) (-824.597) (-824.041) -- 0:00:06
901000 -- (-825.470) [-823.575] (-824.610) (-824.765) * [-824.105] (-825.021) (-826.449) (-824.444) -- 0:00:06
901500 -- [-824.647] (-823.599) (-824.479) (-824.886) * [-824.183] (-827.790) (-827.972) (-830.078) -- 0:00:06
902000 -- (-825.321) [-825.454] (-823.792) (-824.736) * [-824.454] (-825.653) (-829.541) (-827.672) -- 0:00:05
902500 -- (-824.151) (-828.250) [-823.267] (-827.468) * (-825.349) (-824.563) [-823.609] (-823.206) -- 0:00:05
903000 -- (-824.151) [-827.346] (-823.976) (-825.192) * (-825.526) (-827.066) (-825.996) [-824.160] -- 0:00:05
903500 -- [-823.702] (-826.363) (-823.352) (-825.405) * [-823.681] (-824.403) (-824.028) (-828.269) -- 0:00:05
904000 -- (-823.594) (-827.462) [-823.311] (-825.911) * (-823.047) (-824.679) (-828.392) [-824.112] -- 0:00:05
904500 -- (-824.520) (-827.679) (-827.730) [-827.260] * [-829.992] (-825.414) (-826.099) (-827.874) -- 0:00:05
905000 -- (-826.097) (-824.647) [-824.174] (-825.228) * (-826.062) (-824.805) (-826.873) [-822.858] -- 0:00:05
Average standard deviation of split frequencies: 0.009702
905500 -- (-824.893) (-826.337) [-825.754] (-824.037) * (-826.784) (-827.222) (-823.807) [-823.084] -- 0:00:05
906000 -- (-823.721) (-826.065) [-827.298] (-823.302) * (-825.428) [-826.999] (-823.689) (-823.175) -- 0:00:05
906500 -- (-824.107) [-826.113] (-825.036) (-825.173) * [-825.227] (-825.298) (-824.689) (-823.815) -- 0:00:05
907000 -- [-828.305] (-826.505) (-826.940) (-825.152) * [-825.640] (-829.293) (-824.471) (-824.719) -- 0:00:05
907500 -- [-824.285] (-823.284) (-823.187) (-825.258) * (-826.139) [-826.595] (-824.656) (-824.390) -- 0:00:05
908000 -- (-823.274) (-823.376) [-823.814] (-823.920) * (-827.474) (-828.956) [-828.461] (-824.856) -- 0:00:05
908500 -- (-823.629) [-823.465] (-823.885) (-826.642) * (-825.340) (-824.515) [-824.860] (-823.637) -- 0:00:05
909000 -- (-824.090) (-826.542) (-828.129) [-824.246] * (-827.761) (-824.799) (-823.217) [-825.097] -- 0:00:05
909500 -- (-827.122) (-824.702) [-827.026] (-827.426) * (-824.713) [-824.298] (-828.787) (-824.459) -- 0:00:05
910000 -- [-825.628] (-824.702) (-824.907) (-827.200) * [-824.212] (-826.149) (-830.461) (-823.289) -- 0:00:05
Average standard deviation of split frequencies: 0.009592
910500 -- (-830.792) [-824.034] (-825.170) (-824.451) * (-823.837) (-825.021) (-826.817) [-827.859] -- 0:00:05
911000 -- (-828.761) (-829.651) (-824.565) [-824.702] * (-827.761) [-823.402] (-826.446) (-823.655) -- 0:00:05
911500 -- (-830.558) (-824.001) (-823.576) [-824.310] * (-824.975) (-823.394) (-824.993) [-824.002] -- 0:00:05
912000 -- (-829.413) [-823.039] (-826.166) (-826.439) * (-829.427) (-823.326) (-823.154) [-825.908] -- 0:00:05
912500 -- (-824.675) [-825.318] (-826.617) (-824.930) * (-827.829) (-824.786) (-824.040) [-825.027] -- 0:00:05
913000 -- (-827.620) [-825.862] (-827.519) (-823.611) * [-824.543] (-824.879) (-824.627) (-823.783) -- 0:00:05
913500 -- (-827.919) [-823.807] (-826.603) (-825.655) * [-823.909] (-826.663) (-825.012) (-823.319) -- 0:00:05
914000 -- (-825.242) [-825.598] (-826.531) (-823.287) * (-824.858) [-826.640] (-823.956) (-824.315) -- 0:00:05
914500 -- (-824.565) [-827.185] (-824.050) (-823.008) * (-824.184) (-825.545) [-823.808] (-824.332) -- 0:00:05
915000 -- (-824.605) (-825.480) (-823.938) [-824.668] * (-825.174) (-823.342) [-822.858] (-824.859) -- 0:00:05
Average standard deviation of split frequencies: 0.009203
915500 -- [-826.024] (-826.643) (-824.104) (-829.558) * (-824.460) (-823.723) [-825.109] (-824.572) -- 0:00:05
916000 -- (-824.790) (-824.169) (-828.370) [-825.849] * (-825.236) (-824.676) [-824.705] (-823.853) -- 0:00:05
916500 -- (-824.889) [-823.788] (-824.595) (-824.824) * (-823.788) (-829.828) (-825.205) [-824.046] -- 0:00:05
917000 -- (-825.205) (-824.311) (-826.003) [-824.190] * (-825.399) (-824.765) [-823.522] (-824.577) -- 0:00:05
917500 -- (-827.319) (-824.371) (-824.539) [-824.361] * (-823.940) (-824.031) [-824.273] (-831.272) -- 0:00:05
918000 -- (-826.587) [-825.843] (-824.055) (-824.635) * (-824.585) (-823.976) (-825.651) [-824.643] -- 0:00:05
918500 -- (-826.497) [-825.373] (-825.671) (-825.320) * [-823.361] (-825.614) (-830.413) (-826.932) -- 0:00:04
919000 -- (-826.799) (-823.355) [-827.489] (-823.006) * [-823.690] (-824.190) (-827.819) (-827.785) -- 0:00:04
919500 -- (-828.181) (-823.942) [-826.981] (-823.006) * [-825.718] (-823.774) (-825.841) (-823.805) -- 0:00:04
920000 -- [-827.202] (-823.704) (-828.264) (-823.929) * [-824.873] (-827.544) (-824.404) (-824.542) -- 0:00:04
Average standard deviation of split frequencies: 0.009247
920500 -- (-824.243) (-826.627) (-827.472) [-824.798] * [-825.408] (-828.247) (-822.993) (-825.683) -- 0:00:04
921000 -- (-828.156) [-825.087] (-824.410) (-823.965) * [-825.243] (-826.115) (-825.008) (-823.544) -- 0:00:04
921500 -- (-827.321) (-825.113) (-825.331) [-823.856] * [-823.720] (-826.911) (-825.420) (-827.420) -- 0:00:04
922000 -- (-827.773) [-825.291] (-825.903) (-823.737) * (-823.854) (-824.791) (-827.004) [-824.468] -- 0:00:04
922500 -- (-824.921) (-827.138) [-825.053] (-824.987) * (-824.762) (-823.442) (-825.933) [-827.440] -- 0:00:04
923000 -- (-825.293) (-825.155) [-823.559] (-823.835) * (-826.399) (-827.174) (-824.452) [-823.541] -- 0:00:04
923500 -- (-826.186) (-825.773) [-825.970] (-824.465) * (-824.480) (-825.684) [-824.075] (-822.937) -- 0:00:04
924000 -- [-825.767] (-828.406) (-828.369) (-824.203) * (-827.533) (-825.727) (-824.767) [-825.049] -- 0:00:04
924500 -- (-831.168) (-825.761) (-824.935) [-827.295] * [-823.595] (-825.928) (-826.460) (-823.650) -- 0:00:04
925000 -- (-828.001) [-829.410] (-825.218) (-825.219) * (-825.197) (-828.970) (-825.288) [-824.858] -- 0:00:04
Average standard deviation of split frequencies: 0.009163
925500 -- (-824.966) (-824.369) (-825.776) [-824.299] * [-824.421] (-824.657) (-824.957) (-823.579) -- 0:00:04
926000 -- [-828.657] (-824.061) (-830.773) (-823.690) * (-830.176) (-824.444) (-828.509) [-824.286] -- 0:00:04
926500 -- [-823.437] (-824.230) (-829.015) (-825.363) * (-823.658) (-827.536) (-823.612) [-823.430] -- 0:00:04
927000 -- (-828.077) (-824.532) [-823.444] (-824.130) * (-823.578) [-824.799] (-824.565) (-823.889) -- 0:00:04
927500 -- (-827.041) (-823.494) [-827.848] (-827.223) * [-824.064] (-824.954) (-823.576) (-825.062) -- 0:00:04
928000 -- (-825.326) [-824.656] (-825.255) (-827.147) * [-823.818] (-823.403) (-824.312) (-824.847) -- 0:00:04
928500 -- [-828.241] (-829.352) (-823.821) (-824.095) * (-827.863) [-823.826] (-826.654) (-825.486) -- 0:00:04
929000 -- (-826.873) (-826.433) [-823.703] (-826.774) * [-823.466] (-824.692) (-829.594) (-824.652) -- 0:00:04
929500 -- [-824.209] (-829.454) (-824.803) (-828.067) * (-823.513) (-825.144) (-824.152) [-828.114] -- 0:00:04
930000 -- (-825.835) [-823.482] (-826.404) (-825.548) * [-823.228] (-824.178) (-824.284) (-826.485) -- 0:00:04
Average standard deviation of split frequencies: 0.008939
930500 -- (-826.043) (-826.044) (-827.662) [-824.902] * (-828.710) [-823.725] (-830.166) (-826.303) -- 0:00:04
931000 -- [-825.319] (-822.940) (-825.312) (-826.041) * (-823.116) (-825.045) (-826.656) [-825.838] -- 0:00:04
931500 -- (-824.994) [-823.783] (-827.300) (-824.249) * [-826.734] (-825.480) (-824.472) (-823.324) -- 0:00:04
932000 -- (-825.149) (-827.133) (-831.080) [-830.079] * [-823.758] (-828.884) (-826.320) (-824.233) -- 0:00:04
932500 -- [-824.430] (-825.253) (-824.441) (-827.886) * [-824.672] (-829.908) (-823.985) (-826.981) -- 0:00:04
933000 -- (-824.553) (-824.970) [-826.157] (-825.505) * (-824.473) (-824.313) (-824.878) [-825.598] -- 0:00:04
933500 -- (-824.681) [-824.551] (-824.908) (-825.771) * (-824.701) [-823.806] (-825.621) (-825.562) -- 0:00:04
934000 -- (-824.195) (-824.905) [-828.406] (-826.160) * [-824.117] (-824.802) (-823.577) (-825.881) -- 0:00:04
934500 -- (-824.966) (-828.044) [-824.442] (-825.995) * [-825.818] (-826.886) (-824.594) (-825.881) -- 0:00:03
935000 -- (-826.852) [-824.777] (-823.756) (-826.207) * (-826.967) (-826.440) [-824.472] (-825.125) -- 0:00:03
Average standard deviation of split frequencies: 0.008443
935500 -- [-823.834] (-824.610) (-825.298) (-826.356) * (-823.302) (-826.216) (-831.312) [-823.387] -- 0:00:03
936000 -- (-825.344) [-826.355] (-826.907) (-828.466) * (-828.967) (-825.536) (-826.255) [-825.792] -- 0:00:03
936500 -- (-823.514) (-824.341) [-825.995] (-824.654) * (-827.978) (-826.471) (-824.631) [-825.179] -- 0:00:03
937000 -- (-825.328) (-825.732) [-824.378] (-826.443) * [-823.023] (-826.786) (-823.439) (-824.386) -- 0:00:03
937500 -- (-827.452) (-824.976) [-826.171] (-823.944) * (-823.774) (-824.599) [-825.110] (-828.405) -- 0:00:03
938000 -- [-826.629] (-826.801) (-826.070) (-824.795) * (-830.743) [-825.318] (-826.068) (-827.570) -- 0:00:03
938500 -- [-828.351] (-825.586) (-823.929) (-824.218) * (-825.605) (-824.429) [-823.649] (-823.727) -- 0:00:03
939000 -- [-827.987] (-825.169) (-822.899) (-824.737) * (-823.926) (-828.152) [-825.518] (-825.798) -- 0:00:03
939500 -- (-824.072) (-825.020) [-823.338] (-824.377) * (-824.242) (-826.866) [-823.078] (-827.915) -- 0:00:03
940000 -- (-826.872) (-826.602) [-822.952] (-826.778) * [-823.011] (-825.592) (-827.487) (-828.316) -- 0:00:03
Average standard deviation of split frequencies: 0.008490
940500 -- (-823.704) (-823.725) [-822.807] (-826.779) * (-829.204) (-824.971) (-825.698) [-823.366] -- 0:00:03
941000 -- (-824.792) [-823.504] (-826.734) (-825.535) * (-827.102) (-824.522) (-823.118) [-825.085] -- 0:00:03
941500 -- (-824.068) (-823.932) [-825.334] (-826.828) * (-824.187) (-826.334) (-825.135) [-824.518] -- 0:00:03
942000 -- [-825.089] (-825.521) (-826.073) (-824.827) * [-825.741] (-828.047) (-824.553) (-823.146) -- 0:00:03
942500 -- (-823.779) (-828.152) (-823.653) [-826.735] * (-824.401) (-826.068) (-824.621) [-824.214] -- 0:00:03
943000 -- (-827.338) (-823.453) (-825.718) [-825.660] * (-827.854) [-827.940] (-824.158) (-824.708) -- 0:00:03
943500 -- (-827.250) (-824.785) (-825.341) [-823.605] * (-823.800) (-827.166) [-823.642] (-823.677) -- 0:00:03
944000 -- (-825.351) [-826.650] (-825.775) (-824.823) * [-824.450] (-825.636) (-825.192) (-826.740) -- 0:00:03
944500 -- (-826.113) (-824.819) [-826.267] (-824.706) * (-827.011) (-824.932) (-827.343) [-826.300] -- 0:00:03
945000 -- (-825.562) [-832.508] (-823.978) (-823.232) * [-823.444] (-825.381) (-824.288) (-827.578) -- 0:00:03
Average standard deviation of split frequencies: 0.008413
945500 -- (-830.845) (-826.043) [-824.125] (-824.862) * (-826.256) [-826.303] (-827.139) (-823.345) -- 0:00:03
946000 -- (-825.841) [-824.827] (-825.786) (-825.184) * (-823.934) (-833.208) [-824.774] (-824.730) -- 0:00:03
946500 -- (-824.933) (-824.071) [-824.785] (-828.383) * [-824.646] (-825.678) (-826.963) (-825.238) -- 0:00:03
947000 -- (-824.016) [-823.939] (-824.305) (-827.246) * [-825.856] (-823.609) (-823.988) (-824.359) -- 0:00:03
947500 -- (-829.719) (-823.285) [-827.085] (-825.010) * (-825.222) (-824.535) (-823.633) [-824.468] -- 0:00:03
948000 -- [-829.198] (-826.437) (-828.144) (-827.632) * (-824.292) (-824.608) [-825.627] (-825.544) -- 0:00:03
948500 -- (-828.266) (-825.086) [-827.026] (-822.997) * (-824.302) [-824.506] (-823.420) (-825.315) -- 0:00:03
949000 -- (-826.699) [-823.756] (-825.026) (-825.442) * (-824.088) (-826.927) [-827.645] (-828.504) -- 0:00:03
949500 -- (-825.007) [-825.588] (-825.717) (-824.346) * (-824.602) (-828.607) (-828.164) [-825.778] -- 0:00:03
950000 -- [-824.479] (-822.901) (-824.703) (-824.740) * [-822.908] (-826.320) (-828.429) (-824.301) -- 0:00:03
Average standard deviation of split frequencies: 0.008546
950500 -- (-824.606) [-823.423] (-825.701) (-824.842) * (-824.361) (-825.778) (-823.329) [-824.055] -- 0:00:03
951000 -- (-828.858) [-824.235] (-827.503) (-825.054) * (-823.063) (-823.867) (-823.692) [-824.980] -- 0:00:02
951500 -- (-829.192) [-824.172] (-825.490) (-824.895) * [-828.567] (-824.846) (-823.306) (-825.224) -- 0:00:02
952000 -- (-827.377) (-825.435) [-823.958] (-825.932) * [-826.105] (-825.511) (-824.849) (-826.164) -- 0:00:02
952500 -- (-824.205) [-824.472] (-825.285) (-829.117) * [-825.621] (-824.232) (-827.421) (-823.816) -- 0:00:02
953000 -- (-824.745) [-824.231] (-826.823) (-823.998) * (-825.270) (-823.444) (-827.855) [-826.676] -- 0:00:02
953500 -- (-825.386) [-825.110] (-823.907) (-824.769) * [-824.236] (-824.761) (-823.900) (-830.634) -- 0:00:02
954000 -- (-830.596) (-824.296) [-823.792] (-823.359) * (-825.818) (-825.368) [-824.897] (-826.419) -- 0:00:02
954500 -- (-824.039) (-825.753) [-826.272] (-825.072) * (-824.827) (-825.735) (-824.615) [-825.436] -- 0:00:02
955000 -- (-826.042) [-823.227] (-825.525) (-825.437) * (-825.680) (-827.160) (-824.651) [-825.078] -- 0:00:02
Average standard deviation of split frequencies: 0.008238
955500 -- (-824.647) [-825.754] (-823.165) (-827.627) * [-824.059] (-825.840) (-823.680) (-823.598) -- 0:00:02
956000 -- [-823.067] (-827.083) (-824.220) (-827.363) * [-826.938] (-827.560) (-825.026) (-824.363) -- 0:00:02
956500 -- (-823.583) (-826.510) (-824.554) [-823.970] * (-825.649) (-824.292) (-823.752) [-824.340] -- 0:00:02
957000 -- [-825.870] (-825.835) (-827.041) (-828.476) * (-824.658) (-823.127) (-822.905) [-824.201] -- 0:00:02
957500 -- (-826.328) (-823.906) [-823.711] (-826.486) * (-826.177) (-824.188) (-823.676) [-826.672] -- 0:00:02
958000 -- [-826.221] (-823.175) (-826.310) (-825.701) * [-824.806] (-829.511) (-824.698) (-825.493) -- 0:00:02
958500 -- (-828.640) [-825.643] (-824.723) (-825.836) * (-826.823) (-825.729) (-825.139) [-823.851] -- 0:00:02
959000 -- (-829.296) [-826.793] (-823.160) (-823.598) * (-824.753) [-825.030] (-827.758) (-823.705) -- 0:00:02
959500 -- (-825.746) (-824.205) (-825.150) [-824.560] * (-823.855) [-824.789] (-826.680) (-824.128) -- 0:00:02
960000 -- (-825.225) (-824.585) [-824.993] (-825.041) * (-824.177) [-824.053] (-829.694) (-823.616) -- 0:00:02
Average standard deviation of split frequencies: 0.008573
960500 -- [-823.278] (-823.073) (-826.510) (-824.568) * (-823.549) [-823.394] (-824.362) (-823.554) -- 0:00:02
961000 -- (-825.194) (-823.612) [-823.529] (-823.968) * (-824.715) (-824.640) [-824.125] (-826.892) -- 0:00:02
961500 -- (-827.448) [-824.796] (-823.842) (-823.968) * [-832.385] (-823.891) (-823.743) (-828.613) -- 0:00:02
962000 -- (-827.011) [-823.869] (-824.947) (-827.721) * (-824.446) (-823.912) (-826.898) [-827.629] -- 0:00:02
962500 -- (-827.214) [-823.565] (-824.948) (-827.196) * (-824.441) (-825.187) [-824.581] (-826.201) -- 0:00:02
963000 -- (-823.562) (-825.938) (-823.853) [-828.019] * (-824.722) [-824.684] (-824.278) (-826.059) -- 0:00:02
963500 -- (-823.446) [-825.842] (-826.801) (-827.233) * (-823.663) (-824.861) [-824.948] (-827.822) -- 0:00:02
964000 -- [-825.876] (-824.878) (-824.660) (-826.236) * (-826.754) (-826.825) (-824.324) [-825.979] -- 0:00:02
964500 -- (-824.587) (-824.178) [-825.723] (-825.700) * (-824.919) (-824.506) (-825.716) [-824.422] -- 0:00:02
965000 -- (-822.947) (-828.179) (-823.903) [-824.395] * (-823.109) [-824.848] (-826.513) (-824.622) -- 0:00:02
Average standard deviation of split frequencies: 0.008612
965500 -- (-825.311) [-827.001] (-825.140) (-824.990) * (-824.277) (-825.838) [-826.007] (-826.528) -- 0:00:02
966000 -- [-825.841] (-827.901) (-824.387) (-826.882) * (-824.882) (-823.171) [-824.006] (-828.741) -- 0:00:02
966500 -- (-824.184) (-824.494) [-829.188] (-825.928) * (-823.914) (-826.592) [-823.953] (-827.266) -- 0:00:02
967000 -- (-823.814) [-826.692] (-823.420) (-824.473) * (-823.315) (-826.475) [-824.892] (-824.697) -- 0:00:02
967500 -- (-823.367) (-831.060) [-825.270] (-824.230) * (-827.112) (-825.572) [-827.293] (-825.044) -- 0:00:01
968000 -- (-825.088) [-825.003] (-829.415) (-823.806) * (-824.155) (-825.081) (-824.561) [-824.616] -- 0:00:01
968500 -- (-824.452) (-823.892) (-829.146) [-826.617] * (-826.773) (-829.103) (-826.349) [-823.481] -- 0:00:01
969000 -- [-825.584] (-823.960) (-830.683) (-823.158) * (-826.364) (-826.063) [-827.798] (-827.852) -- 0:00:01
969500 -- (-824.581) (-824.714) [-825.595] (-825.385) * (-824.840) (-826.655) (-823.140) [-823.492] -- 0:00:01
970000 -- [-823.028] (-825.619) (-824.696) (-829.892) * (-823.962) (-825.678) [-823.983] (-823.662) -- 0:00:01
Average standard deviation of split frequencies: 0.008513
970500 -- (-823.783) (-826.489) (-826.012) [-824.208] * [-826.566] (-824.010) (-824.771) (-826.590) -- 0:00:01
971000 -- [-824.557] (-825.116) (-825.335) (-823.691) * [-824.898] (-824.733) (-826.375) (-825.071) -- 0:00:01
971500 -- [-824.773] (-826.416) (-825.339) (-823.641) * (-826.525) [-825.669] (-826.267) (-823.154) -- 0:00:01
972000 -- (-826.350) [-823.277] (-824.312) (-824.113) * (-823.499) (-825.611) [-825.450] (-823.546) -- 0:00:01
972500 -- (-825.873) [-824.400] (-823.505) (-824.142) * (-826.852) (-825.662) [-824.521] (-823.985) -- 0:00:01
973000 -- (-827.258) (-824.116) (-828.729) [-826.718] * (-828.683) (-826.507) [-827.823] (-827.249) -- 0:00:01
973500 -- (-827.163) [-825.845] (-829.375) (-826.320) * [-825.247] (-824.959) (-825.497) (-824.181) -- 0:00:01
974000 -- [-832.594] (-831.011) (-826.338) (-826.351) * (-829.379) (-825.197) [-825.322] (-824.706) -- 0:00:01
974500 -- (-828.833) (-833.179) (-826.685) [-824.790] * (-826.448) (-825.969) (-828.357) [-824.341] -- 0:00:01
975000 -- (-825.565) (-830.036) [-823.642] (-823.975) * (-824.202) [-822.967] (-823.769) (-825.315) -- 0:00:01
Average standard deviation of split frequencies: 0.008381
975500 -- (-826.271) (-825.026) [-826.953] (-824.930) * (-825.769) [-824.385] (-825.772) (-826.795) -- 0:00:01
976000 -- [-828.985] (-824.538) (-827.488) (-825.408) * (-825.139) (-824.538) [-824.746] (-823.668) -- 0:00:01
976500 -- (-829.043) [-823.601] (-829.314) (-826.147) * [-827.139] (-823.825) (-824.558) (-824.626) -- 0:00:01
977000 -- [-826.740] (-825.578) (-829.773) (-826.959) * (-829.545) (-824.108) (-824.289) [-825.028] -- 0:00:01
977500 -- [-825.492] (-826.489) (-831.898) (-825.807) * (-828.773) [-824.219] (-824.651) (-824.014) -- 0:00:01
978000 -- [-823.613] (-824.178) (-827.131) (-827.768) * (-825.967) (-825.763) [-824.493] (-823.937) -- 0:00:01
978500 -- (-826.154) [-824.732] (-828.010) (-825.041) * [-825.745] (-826.859) (-829.975) (-824.803) -- 0:00:01
979000 -- (-824.221) (-824.477) (-824.305) [-823.790] * (-825.757) (-825.219) (-825.779) [-824.865] -- 0:00:01
979500 -- (-823.228) (-826.032) (-827.285) [-823.942] * [-825.786] (-824.076) (-825.747) (-825.893) -- 0:00:01
980000 -- [-823.713] (-823.831) (-827.592) (-827.027) * (-824.918) (-824.728) [-826.243] (-828.926) -- 0:00:01
Average standard deviation of split frequencies: 0.008568
980500 -- (-823.351) (-826.004) [-824.086] (-825.897) * (-826.067) [-825.441] (-828.135) (-828.489) -- 0:00:01
981000 -- (-824.738) (-826.406) [-825.452] (-826.725) * (-825.021) [-825.709] (-828.871) (-824.467) -- 0:00:01
981500 -- (-824.220) (-837.188) [-825.494] (-826.151) * [-824.449] (-825.394) (-824.986) (-831.408) -- 0:00:01
982000 -- (-824.277) (-829.158) [-824.451] (-825.113) * (-827.074) (-824.400) (-823.827) [-823.362] -- 0:00:01
982500 -- [-826.222] (-829.050) (-824.671) (-824.875) * (-826.430) (-826.752) (-827.270) [-823.888] -- 0:00:01
983000 -- (-822.833) (-828.784) [-824.690] (-824.616) * (-826.833) (-824.121) [-823.803] (-826.247) -- 0:00:01
983500 -- [-824.397] (-832.122) (-826.973) (-825.173) * (-823.668) (-826.464) [-823.343] (-826.578) -- 0:00:01
984000 -- (-825.709) [-824.551] (-830.623) (-826.239) * [-823.932] (-825.399) (-828.199) (-827.787) -- 0:00:00
984500 -- (-826.969) [-823.939] (-824.623) (-824.157) * (-826.136) [-823.549] (-827.727) (-824.628) -- 0:00:00
985000 -- (-827.867) (-823.596) [-825.427] (-825.590) * (-824.943) (-825.959) (-823.724) [-824.830] -- 0:00:00
Average standard deviation of split frequencies: 0.008465
985500 -- (-826.193) (-825.343) (-825.915) [-826.174] * (-824.106) (-827.476) (-824.278) [-823.295] -- 0:00:00
986000 -- (-824.075) [-823.875] (-825.534) (-828.987) * (-825.900) [-824.325] (-826.290) (-825.567) -- 0:00:00
986500 -- [-827.731] (-826.529) (-826.750) (-824.147) * [-828.643] (-824.122) (-826.527) (-829.108) -- 0:00:00
987000 -- (-824.811) [-823.509] (-824.306) (-825.135) * (-826.366) [-823.365] (-828.825) (-829.178) -- 0:00:00
987500 -- [-823.989] (-825.883) (-823.894) (-824.481) * (-830.132) (-824.778) (-825.316) [-823.551] -- 0:00:00
988000 -- [-825.213] (-829.082) (-824.178) (-825.824) * [-827.680] (-825.787) (-828.313) (-824.267) -- 0:00:00
988500 -- [-823.770] (-828.770) (-824.854) (-824.328) * [-824.019] (-825.229) (-827.166) (-824.654) -- 0:00:00
989000 -- (-826.876) (-825.266) (-824.501) [-824.381] * (-826.804) (-827.577) [-826.493] (-825.178) -- 0:00:00
989500 -- (-825.425) [-826.992] (-823.441) (-823.843) * (-829.503) [-825.342] (-828.666) (-823.148) -- 0:00:00
990000 -- (-823.050) [-826.100] (-828.434) (-829.918) * (-824.418) [-825.230] (-828.547) (-825.043) -- 0:00:00
Average standard deviation of split frequencies: 0.008509
990500 -- [-823.862] (-828.468) (-824.958) (-825.810) * (-823.444) (-825.488) [-825.679] (-827.772) -- 0:00:00
991000 -- (-824.172) [-830.258] (-826.493) (-824.987) * (-823.098) (-829.402) (-827.063) [-827.915] -- 0:00:00
991500 -- (-825.053) [-826.712] (-824.289) (-823.899) * (-826.504) [-825.783] (-824.453) (-825.002) -- 0:00:00
992000 -- (-827.582) (-824.221) [-828.377] (-828.298) * (-823.646) (-824.976) (-825.195) [-824.749] -- 0:00:00
992500 -- (-831.538) [-830.692] (-827.003) (-824.722) * [-824.597] (-825.428) (-828.214) (-824.859) -- 0:00:00
993000 -- (-824.688) (-830.229) (-823.730) [-822.938] * (-827.824) (-825.026) [-827.740] (-822.909) -- 0:00:00
993500 -- (-823.450) (-825.373) [-823.915] (-824.806) * (-827.988) (-824.736) (-829.556) [-825.140] -- 0:00:00
994000 -- (-824.705) (-827.381) [-824.784] (-826.003) * (-827.778) (-824.987) [-824.782] (-824.776) -- 0:00:00
994500 -- [-825.278] (-825.598) (-823.527) (-825.586) * (-825.153) (-825.419) [-826.780] (-825.697) -- 0:00:00
995000 -- (-826.984) (-825.772) (-824.098) [-824.601] * [-825.724] (-828.382) (-825.295) (-823.288) -- 0:00:00
Average standard deviation of split frequencies: 0.008686
995500 -- (-827.064) (-825.645) [-824.589] (-827.767) * (-825.415) [-826.029] (-827.636) (-826.261) -- 0:00:00
996000 -- (-824.162) [-824.665] (-824.169) (-825.075) * [-826.212] (-825.822) (-825.477) (-828.232) -- 0:00:00
996500 -- (-824.374) (-824.656) [-824.003] (-825.965) * (-829.804) [-826.058] (-827.893) (-828.853) -- 0:00:00
997000 -- (-825.436) [-826.552] (-825.887) (-825.402) * (-825.807) (-825.476) (-823.919) [-824.721] -- 0:00:00
997500 -- [-825.440] (-826.738) (-823.571) (-826.279) * [-825.202] (-823.630) (-824.936) (-824.053) -- 0:00:00
998000 -- (-827.307) (-827.894) (-824.219) [-825.006] * [-826.548] (-824.830) (-824.973) (-825.584) -- 0:00:00
998500 -- [-828.362] (-824.907) (-826.243) (-823.649) * (-825.570) [-824.672] (-826.579) (-826.965) -- 0:00:00
999000 -- [-826.903] (-824.264) (-826.419) (-824.804) * (-823.101) [-823.663] (-824.008) (-824.609) -- 0:00:00
999500 -- (-823.971) (-823.547) (-830.485) [-829.746] * [-825.427] (-824.875) (-823.396) (-824.386) -- 0:00:00
1000000 -- (-824.835) [-830.483] (-826.798) (-825.642) * [-825.347] (-826.844) (-827.322) (-823.268) -- 0:00:00
Average standard deviation of split frequencies: 0.008674
Analysis completed in 1 mins 1 seconds
Analysis used 59.55 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -822.73
Likelihood of best state for "cold" chain of run 2 was -822.73
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.8 % ( 26 %) Dirichlet(Pi{all})
31.6 % ( 28 %) Slider(Pi{all})
78.4 % ( 59 %) Multiplier(Alpha{1,2})
77.6 % ( 53 %) Multiplier(Alpha{3})
21.6 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.3 % ( 21 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.7 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.3 % ( 27 %) Dirichlet(Pi{all})
31.3 % ( 20 %) Slider(Pi{all})
79.1 % ( 57 %) Multiplier(Alpha{1,2})
77.4 % ( 55 %) Multiplier(Alpha{3})
21.8 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.3 % ( 96 %) Nodeslider(V{all})
30.4 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167247 0.82 0.67
3 | 167028 166373 0.84
4 | 166378 166863 166111
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166443 0.82 0.67
3 | 166901 166003 0.84
4 | 166132 167688 166833
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -824.33
| 2 |
| 1 2 2 1 |
| 1 2 1 2 |
| 1 1 2 2 2 |
|11 21 11 2 1 2 22 22 2 |
| 2 12 2 2 2 2 2 1 |
| 1 2 1 11 1 2 11 21 |
| 1 1 212 11 2 * 21 2 * 21 1 1 2 |
|222 2 22 2 1 1 2 2 1 1 |
| 2 22 1 2 1 12 1 11 1 2 |
| 1 1 21 2 2 2 1 2 1 2|
| 1 1 1 |
| 2 * 1 1 1 2 1 1 |
| 1 |
| 2 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -826.06
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -824.48 -828.10
2 -824.43 -832.81
--------------------------------------
TOTAL -824.45 -832.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902062 0.090375 0.375774 1.494995 0.862235 1167.24 1209.83 1.000
r(A<->C){all} 0.171222 0.021477 0.000015 0.458164 0.133241 103.90 142.99 1.000
r(A<->G){all} 0.160730 0.018244 0.000001 0.425366 0.123770 217.48 243.95 1.005
r(A<->T){all} 0.165640 0.020777 0.000012 0.452990 0.124760 146.44 173.61 1.008
r(C<->G){all} 0.168381 0.019257 0.000001 0.446332 0.132605 136.62 221.24 1.000
r(C<->T){all} 0.173742 0.022424 0.000084 0.483896 0.134587 109.56 140.07 1.000
r(G<->T){all} 0.160285 0.018903 0.000106 0.445578 0.120189 215.69 254.79 1.000
pi(A){all} 0.204833 0.000266 0.171000 0.235488 0.204575 1346.96 1373.97 1.000
pi(C){all} 0.342839 0.000353 0.305697 0.378751 0.342688 1311.50 1326.57 1.001
pi(G){all} 0.263805 0.000316 0.229447 0.297174 0.263101 1188.49 1193.46 1.000
pi(T){all} 0.188524 0.000251 0.159156 0.221013 0.188565 989.34 1125.90 1.000
alpha{1,2} 0.402391 0.212236 0.000183 1.345854 0.234310 1165.12 1229.13 1.001
alpha{3} 0.451294 0.245016 0.000105 1.441277 0.285330 1225.64 1276.78 1.001
pinvar{all} 0.997418 0.000010 0.991361 0.999999 0.998367 1304.64 1324.27 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- .*..*.
9 -- .*.***
10 -- .**.**
11 -- ...**.
12 -- ..*.*.
13 -- .*...*
14 -- .****.
15 -- ...*.*
16 -- .***.*
17 -- ..**..
18 -- ....**
19 -- .**...
20 -- ..****
21 -- ..*..*
22 -- ...***
23 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 450 0.149900 0.008480 0.143904 0.155896 2
8 450 0.149900 0.005653 0.145903 0.153897 2
9 450 0.149900 0.012248 0.141239 0.158561 2
10 449 0.149567 0.000471 0.149234 0.149900 2
11 442 0.147235 0.010364 0.139907 0.154564 2
12 439 0.146236 0.011777 0.137908 0.154564 2
13 438 0.145903 0.010364 0.138574 0.153231 2
14 436 0.145237 0.023555 0.128581 0.161892 2
15 434 0.144570 0.010364 0.137242 0.151899 2
16 429 0.142905 0.003298 0.140573 0.145237 2
17 428 0.142572 0.007537 0.137242 0.147901 2
18 410 0.136576 0.006595 0.131912 0.141239 2
19 404 0.134577 0.006595 0.129913 0.139241 2
20 403 0.134244 0.004240 0.131246 0.137242 2
21 358 0.119254 0.000000 0.119254 0.119254 2
22 288 0.095936 0.011306 0.087941 0.103931 2
23 287 0.095603 0.014604 0.085276 0.105929 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.104933 0.010807 0.000035 0.313560 0.072346 1.000 2
length{all}[2] 0.101741 0.010390 0.000067 0.308100 0.070872 1.000 2
length{all}[3] 0.096201 0.009169 0.000005 0.290776 0.067254 1.000 2
length{all}[4] 0.099838 0.010575 0.000033 0.300495 0.069315 1.000 2
length{all}[5] 0.098916 0.010530 0.000014 0.292739 0.067586 1.000 2
length{all}[6] 0.097842 0.009426 0.000021 0.294158 0.068750 1.000 2
length{all}[7] 0.099149 0.008970 0.000425 0.301088 0.069688 1.008 2
length{all}[8] 0.093375 0.009744 0.000082 0.285341 0.061508 0.998 2
length{all}[9] 0.091291 0.008009 0.000024 0.256077 0.069786 0.999 2
length{all}[10] 0.101559 0.010661 0.000260 0.292836 0.068201 0.999 2
length{all}[11] 0.099151 0.011097 0.000190 0.304490 0.070404 0.998 2
length{all}[12] 0.107365 0.011476 0.000183 0.315227 0.069573 0.999 2
length{all}[13] 0.099801 0.009939 0.000073 0.314483 0.072322 1.002 2
length{all}[14] 0.093617 0.008525 0.000557 0.266861 0.066854 0.998 2
length{all}[15] 0.107094 0.011519 0.000160 0.308011 0.073063 0.998 2
length{all}[16] 0.101294 0.009759 0.000362 0.308969 0.077320 1.000 2
length{all}[17] 0.110319 0.012361 0.000455 0.348509 0.078832 1.004 2
length{all}[18] 0.098058 0.009996 0.000184 0.286541 0.071872 0.999 2
length{all}[19] 0.110719 0.010457 0.000075 0.299332 0.083104 0.998 2
length{all}[20] 0.098395 0.008892 0.000077 0.291230 0.067370 1.000 2
length{all}[21] 0.094955 0.009545 0.000171 0.286123 0.066353 0.998 2
length{all}[22] 0.109282 0.009477 0.000429 0.308473 0.085047 0.997 2
length{all}[23] 0.105385 0.008033 0.000640 0.266498 0.088537 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008674
Maximum standard deviation of split frequencies = 0.023555
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 606
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 202 / 202 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 202 / 202 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030619 0.065378 0.101014 0.072889 0.075656 0.092904 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -887.481416
Iterating by ming2
Initial: fx= 887.481416
x= 0.03062 0.06538 0.10101 0.07289 0.07566 0.09290 0.30000 1.30000
1 h-m-p 0.0000 0.0002 485.5115 ++ 851.251620 m 0.0002 13 | 1/8
2 h-m-p 0.0160 8.0000 15.4635 -------------.. | 1/8
3 h-m-p 0.0000 0.0002 444.9807 +++ 816.467970 m 0.0002 47 | 2/8
4 h-m-p 0.0029 1.2080 23.8943 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 400.2197 ++ 810.394135 m 0.0000 79 | 3/8
6 h-m-p 0.0016 0.8207 26.5955 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 346.8046 ++ 808.713806 m 0.0000 110 | 4/8
8 h-m-p 0.0021 1.0695 20.4384 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 282.9414 ++ 801.710664 m 0.0001 142 | 5/8
10 h-m-p 0.0030 1.4903 14.3855 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 200.5486 ++ 800.055262 m 0.0000 174 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ---------Y 800.055262 0 0.0000 194 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 ---N 800.055262 0 0.0001 210
Out..
lnL = -800.055262
211 lfun, 211 eigenQcodon, 1266 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029562 0.038562 0.062792 0.085321 0.055519 0.032631 0.300094 0.787980 0.192749
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.310245
np = 9
lnL0 = -858.596427
Iterating by ming2
Initial: fx= 858.596427
x= 0.02956 0.03856 0.06279 0.08532 0.05552 0.03263 0.30009 0.78798 0.19275
1 h-m-p 0.0000 0.0002 453.6978 ++ 825.221051 m 0.0002 14 | 1/9
2 h-m-p 0.0000 0.0001 215.7734 ++ 822.185372 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 14760.2099 ++ 817.659536 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 7014571089.5635
h-m-p: 2.37339391e-12 1.18669695e-11 7.01457109e+09 817.659536
.. | 3/9
5 h-m-p 0.0000 0.0001 335.6151 ++ 807.581051 m 0.0001 59 | 4/9
6 h-m-p 0.0003 0.0013 51.8484 ++ 804.621586 m 0.0013 71 | 5/9
7 h-m-p 0.0000 0.0000 2886.5797 ++ 801.365650 m 0.0000 83 | 6/9
8 h-m-p 0.0059 0.0906 3.0648 ------------.. | 6/9
9 h-m-p 0.0000 0.0000 199.2153 ++ 800.055255 m 0.0000 117 | 7/9
10 h-m-p 0.0604 8.0000 0.0000 ++++ 800.055255 m 8.0000 131 | 7/9
11 h-m-p 0.4427 8.0000 0.0001 +++ 800.055255 m 8.0000 146 | 7/9
12 h-m-p 0.0137 6.8494 0.3817 +++Y 800.055254 0 0.6425 163 | 7/9
13 h-m-p 1.6000 8.0000 0.0075 Y 800.055254 0 1.1414 177 | 7/9
14 h-m-p 1.6000 8.0000 0.0003 ------C 800.055254 0 0.0001 197 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 ----C 800.055254 0 0.0016 215
Out..
lnL = -800.055254
216 lfun, 648 eigenQcodon, 2592 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027342 0.072978 0.039668 0.047874 0.031576 0.014148 0.530116 1.083542 0.592834 0.115663 1.439735
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.503932
np = 11
lnL0 = -844.796394
Iterating by ming2
Initial: fx= 844.796394
x= 0.02734 0.07298 0.03967 0.04787 0.03158 0.01415 0.53012 1.08354 0.59283 0.11566 1.43974
1 h-m-p 0.0000 0.0001 448.9201 ++ 829.077409 m 0.0001 16 | 1/11
2 h-m-p 0.0002 0.0011 108.0858 ++ 817.077468 m 0.0011 30 | 2/11
3 h-m-p 0.0005 0.0027 38.0268 ++ 816.163835 m 0.0027 44 | 3/11
4 h-m-p 0.0000 0.0001 296.7728 ++ 811.782943 m 0.0001 58 | 4/11
5 h-m-p 0.0006 0.0032 29.4047 ++ 811.562091 m 0.0032 72 | 5/11
6 h-m-p 0.0001 0.0004 67.9163 ++ 809.786143 m 0.0004 86 | 6/11
7 h-m-p 0.0009 0.0043 16.5255 ++ 800.055253 m 0.0043 100 | 7/11
8 h-m-p 1.6000 8.0000 0.0006 --------C 800.055253 0 0.0000 122
Out..
lnL = -800.055253
123 lfun, 492 eigenQcodon, 2214 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -800.065570 S = -800.052606 -0.004963
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:02
did 20 / 53 patterns 0:02
did 30 / 53 patterns 0:02
did 40 / 53 patterns 0:02
did 50 / 53 patterns 0:02
did 53 / 53 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018455 0.103922 0.092751 0.032333 0.041647 0.066625 0.585971 0.423759 1.802569
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.711275
np = 9
lnL0 = -868.561646
Iterating by ming2
Initial: fx= 868.561646
x= 0.01846 0.10392 0.09275 0.03233 0.04165 0.06662 0.58597 0.42376 1.80257
1 h-m-p 0.0000 0.0001 455.9491 ++ 848.006095 m 0.0001 14 | 1/9
2 h-m-p 0.0020 0.0195 19.8451 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 424.3453 ++ 834.812121 m 0.0001 48 | 2/9
4 h-m-p 0.0019 0.0165 14.4936 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 384.1914 ++ 827.629572 m 0.0000 82 | 3/9
6 h-m-p 0.0014 0.0591 11.5047 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 334.4012 ++ 812.918247 m 0.0001 115 | 4/9
8 h-m-p 0.0043 0.0688 8.2949 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 277.6592 ++ 802.359016 m 0.0001 149 | 5/9
10 h-m-p 0.0068 0.1408 3.9040 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 199.4077 ++ 800.055254 m 0.0001 184 | 6/9
12 h-m-p 0.0922 8.0000 0.0000 ++++ 800.055254 m 8.0000 198 | 6/9
13 h-m-p 0.0393 8.0000 0.0005 ----------Y 800.055254 0 0.0000 223
Out..
lnL = -800.055254
224 lfun, 2464 eigenQcodon, 13440 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070686 0.014402 0.018058 0.079853 0.075281 0.015880 0.585870 0.900000 0.601482 1.964537 1.299995
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.081141
np = 11
lnL0 = -852.248780
Iterating by ming2
Initial: fx= 852.248780
x= 0.07069 0.01440 0.01806 0.07985 0.07528 0.01588 0.58587 0.90000 0.60148 1.96454 1.30000
1 h-m-p 0.0000 0.0001 446.3107 ++ 836.421992 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0001 152.5595 ++ 834.991347 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0000 137.8580 ++ 833.268070 m 0.0000 44 | 3/11
4 h-m-p 0.0001 0.0060 82.4572 ++++ 802.251008 m 0.0060 60 | 4/11
5 h-m-p 0.0000 0.0000 4929.0319 ++ 800.770558 m 0.0000 74 | 5/11
6 h-m-p 0.0004 0.0031 116.6132 ++ 800.653510 m 0.0031 88 | 6/11
7 h-m-p 0.0017 0.0136 160.6216
QuantileBeta(0.15, 0.00500, 2.15180) = 1.227969e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.31224) = 1.122009e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
+ 800.079759 m 0.0136 102
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.039468e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
| 6/11
8 h-m-p 0.0018 0.0092 346.5758
QuantileBeta(0.15, 0.00500, 2.40377) = 1.069298e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49808) = 1.019885e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52165) = 1.008231e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52755) = 1.005358e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52902) = 1.004643e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52939) = 1.004464e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52948) = 1.004419e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52950) = 1.004408e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004405e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004405e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.039468e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
| 6/11
9 h-m-p 0.0000 0.0000 200.6049
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
+ 800.055256 m 0.0000 140
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.039468e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
| 7/11
10 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
Y 800.055256 0 0.0160 154
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
Out..
lnL = -800.055256
155 lfun, 1860 eigenQcodon, 10230 P(t)
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -800.054463 S = -800.050895 -0.001563
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:09
did 20 / 53 patterns 0:09
did 30 / 53 patterns 0:09
did 40 / 53 patterns 0:09
did 50 / 53 patterns 0:10
did 53 / 53 patterns 0:10
QuantileBeta(0.15, 0.00500, 2.52951) = 1.004404e-160 2000 rounds
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=202
NC_011896_1_WP_010908129_1_1138_MLBR_RS05335 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
NC_002677_1_NP_301805_1_677_ML1099 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI
**************************************************
NC_011896_1_WP_010908129_1_1138_MLBR_RS05335 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
NC_002677_1_NP_301805_1_677_ML1099 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985 STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS
**************************************************
NC_011896_1_WP_010908129_1_1138_MLBR_RS05335 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
NC_002677_1_NP_301805_1_677_ML1099 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985 AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV
**************************************************
NC_011896_1_WP_010908129_1_1138_MLBR_RS05335 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
NC_002677_1_NP_301805_1_677_ML1099 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985 PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA
**************************************************
NC_011896_1_WP_010908129_1_1138_MLBR_RS05335 GG
NC_002677_1_NP_301805_1_677_ML1099 GG
NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875 GG
NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845 GG
NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865 GG
NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985 GG
**
>NC_011896_1_WP_010908129_1_1138_MLBR_RS05335 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC GGCGGC >NC_002677_1_NP_301805_1_677_ML1099 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC GGCGGC >NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC GGCGGC >NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC GGCGGC >NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC GGCGGC >NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985 GTGCGCGATGTGTGGTCACTACCCTGTCGCAAGTCACTACTGGGCGTGGC AGCTGTCGTGTTGGTCTCCGGGACATTAACCGGCTGTAGTTCCGGGGACT CCACGGTTGCAAAGACGCCAGTGCCCCCCTCTACCACCACCGGGACCATT TCAACCATCATCTCCAGTGCACCGAGCCCGCCATTCGCAACAGCTGCCCC GCCCACCAGCAACACACCACCGGACGATCCGTGCGCGGTCAATCTTGCCT CACCCACAATCGCCAGGGTGGTCTCTGAGCTGCCCCGCGATCCGCGCAGT GCGCAGCCCTGGAATCCAGAACCATTGGCCGGTAATTACAACGAGTGCGC TCAGCTATCGGCGGTGATCATTAAGGCCAACACGAACGCGGTCAACCCCA CCACCCGGGCTGTGCTGTTTCATCTTGGCCGATTCATCCCGCAAGGTGTT CCTGACACCTACGGGTTCAACGGCATTGACCCAGCGCAAACCACTGGCGA CACGGTGGCGTTGACATACCCTAGCAGCATTGACGGCTTAGCCACCGCTG TGAGGTTCCATTGGAACGGCAACGCGGTAGAGCTCATCAGTAACATCGCC GGCGGC
>NC_011896_1_WP_010908129_1_1138_MLBR_RS05335 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA GG >NC_002677_1_NP_301805_1_677_ML1099 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA GG >NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA GG >NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA GG >NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA GG >NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985 VRDVWSLPCRKSLLGVAAVVLVSGTLTGCSSGDSTVAKTPVPPSTTTGTI STIISSAPSPPFATAAPPTSNTPPDDPCAVNLASPTIARVVSELPRDPRS AQPWNPEPLAGNYNECAQLSAVIIKANTNAVNPTTRAVLFHLGRFIPQGV PDTYGFNGIDPAQTTGDTVALTYPSSIDGLATAVRFHWNGNAVELISNIA GG
#NEXUS
[ID: 5153035139]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908129_1_1138_MLBR_RS05335
NC_002677_1_NP_301805_1_677_ML1099
NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875
NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845
NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865
NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908129_1_1138_MLBR_RS05335,
2 NC_002677_1_NP_301805_1_677_ML1099,
3 NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875,
4 NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845,
5 NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865,
6 NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07234633,2:0.07087231,3:0.06725448,4:0.06931533,5:0.06758635,6:0.06875009);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07234633,2:0.07087231,3:0.06725448,4:0.06931533,5:0.06758635,6:0.06875009);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -824.48 -828.10
2 -824.43 -832.81
--------------------------------------
TOTAL -824.45 -832.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1099/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902062 0.090375 0.375774 1.494995 0.862235 1167.24 1209.83 1.000
r(A<->C){all} 0.171222 0.021477 0.000015 0.458164 0.133241 103.90 142.99 1.000
r(A<->G){all} 0.160730 0.018244 0.000001 0.425366 0.123770 217.48 243.95 1.005
r(A<->T){all} 0.165640 0.020777 0.000012 0.452990 0.124760 146.44 173.61 1.008
r(C<->G){all} 0.168381 0.019257 0.000001 0.446332 0.132605 136.62 221.24 1.000
r(C<->T){all} 0.173742 0.022424 0.000084 0.483896 0.134587 109.56 140.07 1.000
r(G<->T){all} 0.160285 0.018903 0.000106 0.445578 0.120189 215.69 254.79 1.000
pi(A){all} 0.204833 0.000266 0.171000 0.235488 0.204575 1346.96 1373.97 1.000
pi(C){all} 0.342839 0.000353 0.305697 0.378751 0.342688 1311.50 1326.57 1.001
pi(G){all} 0.263805 0.000316 0.229447 0.297174 0.263101 1188.49 1193.46 1.000
pi(T){all} 0.188524 0.000251 0.159156 0.221013 0.188565 989.34 1125.90 1.000
alpha{1,2} 0.402391 0.212236 0.000183 1.345854 0.234310 1165.12 1229.13 1.001
alpha{3} 0.451294 0.245016 0.000105 1.441277 0.285330 1225.64 1276.78 1.001
pinvar{all} 0.997418 0.000010 0.991361 0.999999 0.998367 1304.64 1324.27 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1099/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 202
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 2 2
TTC 4 4 4 4 4 4 | TCC 4 4 4 4 4 4 | TAC 3 3 3 3 3 3 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 8 8 8 8 8 8 | CAC 0 0 0 0 0 0 | CGC 4 4 4 4 4 4
CTA 3 3 3 3 3 3 | CCA 6 6 6 6 6 6 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 7 7 7 7 7 7 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 4 4 4 4 4 4
ATC 7 7 7 7 7 7 | ACC 12 12 12 12 12 12 | AAC 9 9 9 9 9 9 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 5 5 5 5 5 5 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 4 4 4 4 4 4 | AAG 3 3 3 3 3 3 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 3 3 3 3 3 3 | Gly GGT 2 2 2 2 2 2
GTC 5 5 5 5 5 5 | GCC 7 7 7 7 7 7 | GAC 6 6 6 6 6 6 | GGC 9 9 9 9 9 9
GTA 1 1 1 1 1 1 | GCA 4 4 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 10 10 10 10 10 10 | GCG 7 7 7 7 7 7 | GAG 3 3 3 3 3 3 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908129_1_1138_MLBR_RS05335
position 1: T:0.15347 C:0.21782 A:0.28713 G:0.34158
position 2: T:0.23762 C:0.39109 A:0.18317 G:0.18812
position 3: T:0.17327 C:0.42079 A:0.14356 G:0.26238
Average T:0.18812 C:0.34323 A:0.20462 G:0.26403
#2: NC_002677_1_NP_301805_1_677_ML1099
position 1: T:0.15347 C:0.21782 A:0.28713 G:0.34158
position 2: T:0.23762 C:0.39109 A:0.18317 G:0.18812
position 3: T:0.17327 C:0.42079 A:0.14356 G:0.26238
Average T:0.18812 C:0.34323 A:0.20462 G:0.26403
#3: NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875
position 1: T:0.15347 C:0.21782 A:0.28713 G:0.34158
position 2: T:0.23762 C:0.39109 A:0.18317 G:0.18812
position 3: T:0.17327 C:0.42079 A:0.14356 G:0.26238
Average T:0.18812 C:0.34323 A:0.20462 G:0.26403
#4: NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845
position 1: T:0.15347 C:0.21782 A:0.28713 G:0.34158
position 2: T:0.23762 C:0.39109 A:0.18317 G:0.18812
position 3: T:0.17327 C:0.42079 A:0.14356 G:0.26238
Average T:0.18812 C:0.34323 A:0.20462 G:0.26403
#5: NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865
position 1: T:0.15347 C:0.21782 A:0.28713 G:0.34158
position 2: T:0.23762 C:0.39109 A:0.18317 G:0.18812
position 3: T:0.17327 C:0.42079 A:0.14356 G:0.26238
Average T:0.18812 C:0.34323 A:0.20462 G:0.26403
#6: NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985
position 1: T:0.15347 C:0.21782 A:0.28713 G:0.34158
position 2: T:0.23762 C:0.39109 A:0.18317 G:0.18812
position 3: T:0.17327 C:0.42079 A:0.14356 G:0.26238
Average T:0.18812 C:0.34323 A:0.20462 G:0.26403
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 0 | Cys C TGT 12
TTC 24 | TCC 24 | TAC 18 | TGC 12
Leu L TTA 12 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 6 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 0
CTC 6 | CCC 48 | CAC 0 | CGC 24
CTA 18 | CCA 36 | Gln Q CAA 12 | CGA 6
CTG 18 | CCG 42 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 24
ATC 42 | ACC 72 | AAC 54 | AGC 24
ATA 0 | ACA 30 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 0 | ACG 24 | AAG 18 | AGG 12
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 30 | Asp D GAT 18 | Gly G GGT 12
GTC 30 | GCC 42 | GAC 36 | GGC 54
GTA 6 | GCA 24 | Glu E GAA 6 | GGA 0
GTG 60 | GCG 42 | GAG 18 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15347 C:0.21782 A:0.28713 G:0.34158
position 2: T:0.23762 C:0.39109 A:0.18317 G:0.18812
position 3: T:0.17327 C:0.42079 A:0.14356 G:0.26238
Average T:0.18812 C:0.34323 A:0.20462 G:0.26403
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -800.055262 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300094 1.299995
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908129_1_1138_MLBR_RS05335: 0.000004, NC_002677_1_NP_301805_1_677_ML1099: 0.000004, NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875: 0.000004, NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845: 0.000004, NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865: 0.000004, NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30009
omega (dN/dS) = 1.30000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.0 158.0 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 448.0 158.0 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 448.0 158.0 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 448.0 158.0 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 448.0 158.0 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 448.0 158.0 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -800.055254 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.530116 0.785091 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908129_1_1138_MLBR_RS05335: 0.000004, NC_002677_1_NP_301805_1_677_ML1099: 0.000004, NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875: 0.000004, NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845: 0.000004, NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865: 0.000004, NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.53012
MLEs of dN/dS (w) for site classes (K=2)
p: 0.78509 0.21491
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 446.7 159.3 0.2149 0.0000 0.0000 0.0 0.0
7..2 0.000 446.7 159.3 0.2149 0.0000 0.0000 0.0 0.0
7..3 0.000 446.7 159.3 0.2149 0.0000 0.0000 0.0 0.0
7..4 0.000 446.7 159.3 0.2149 0.0000 0.0000 0.0 0.0
7..5 0.000 446.7 159.3 0.2149 0.0000 0.0000 0.0 0.0
7..6 0.000 446.7 159.3 0.2149 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -800.055253 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.585971 0.546698 0.283606 0.000001 1.562073
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908129_1_1138_MLBR_RS05335: 0.000004, NC_002677_1_NP_301805_1_677_ML1099: 0.000004, NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875: 0.000004, NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845: 0.000004, NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865: 0.000004, NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.58597
MLEs of dN/dS (w) for site classes (K=3)
p: 0.54670 0.28361 0.16970
w: 0.00000 1.00000 1.56207
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 446.4 159.6 0.5487 0.0000 0.0000 0.0 0.0
7..2 0.000 446.4 159.6 0.5487 0.0000 0.0000 0.0 0.0
7..3 0.000 446.4 159.6 0.5487 0.0000 0.0000 0.0 0.0
7..4 0.000 446.4 159.6 0.5487 0.0000 0.0000 0.0 0.0
7..5 0.000 446.4 159.6 0.5487 0.0000 0.0000 0.0 0.0
7..6 0.000 446.4 159.6 0.5487 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908129_1_1138_MLBR_RS05335)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908129_1_1138_MLBR_RS05335)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -800.055254 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.585870 0.423660 1.802454
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908129_1_1138_MLBR_RS05335: 0.000004, NC_002677_1_NP_301805_1_677_ML1099: 0.000004, NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875: 0.000004, NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845: 0.000004, NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865: 0.000004, NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.58587
Parameters in M7 (beta):
p = 0.42366 q = 1.80245
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00042 0.00558 0.01877 0.04208 0.07774 0.12861 0.19899 0.29626 0.43598 0.66902
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 446.4 159.6 0.1873 0.0000 0.0000 0.0 0.0
7..2 0.000 446.4 159.6 0.1873 0.0000 0.0000 0.0 0.0
7..3 0.000 446.4 159.6 0.1873 0.0000 0.0000 0.0 0.0
7..4 0.000 446.4 159.6 0.1873 0.0000 0.0000 0.0 0.0
7..5 0.000 446.4 159.6 0.1873 0.0000 0.0000 0.0 0.0
7..6 0.000 446.4 159.6 0.1873 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -800.055256 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.486908 0.000010 0.005000 2.529511 3.957750
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908129_1_1138_MLBR_RS05335: 0.000004, NC_002677_1_NP_301805_1_677_ML1099: 0.000004, NZ_LVXE01000024_1_WP_010908129_1_1006_A3216_RS07875: 0.000004, NZ_LYPH01000021_1_WP_010908129_1_809_A8144_RS03845: 0.000004, NZ_CP029543_1_WP_010908129_1_1158_DIJ64_RS05865: 0.000004, NZ_AP014567_1_WP_010908129_1_1182_JK2ML_RS05985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.48691
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.52951
(p1 = 0.99999) w = 3.95775
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.95775
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 446.9 159.1 3.9577 0.0000 0.0000 0.0 0.0
7..2 0.000 446.9 159.1 3.9577 0.0000 0.0000 0.0 0.0
7..3 0.000 446.9 159.1 3.9577 0.0000 0.0000 0.0 0.0
7..4 0.000 446.9 159.1 3.9577 0.0000 0.0000 0.0 0.0
7..5 0.000 446.9 159.1 3.9577 0.0000 0.0000 0.0 0.0
7..6 0.000 446.9 159.1 3.9577 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908129_1_1138_MLBR_RS05335)
Pr(w>1) post mean +- SE for w
1 V 1.000** 3.958
2 R 1.000** 3.958
3 D 1.000** 3.958
4 V 1.000** 3.958
5 W 1.000** 3.958
6 S 1.000** 3.958
7 L 1.000** 3.958
8 P 1.000** 3.958
9 C 1.000** 3.958
10 R 1.000** 3.958
11 K 1.000** 3.958
12 S 1.000** 3.958
13 L 1.000** 3.958
14 L 1.000** 3.958
15 G 1.000** 3.958
16 V 1.000** 3.958
17 A 1.000** 3.958
18 A 1.000** 3.958
19 V 1.000** 3.958
20 V 1.000** 3.958
21 L 1.000** 3.958
22 V 1.000** 3.958
23 S 1.000** 3.958
24 G 1.000** 3.958
25 T 1.000** 3.958
26 L 1.000** 3.958
27 T 1.000** 3.958
28 G 1.000** 3.958
29 C 1.000** 3.958
30 S 1.000** 3.958
31 S 1.000** 3.958
32 G 1.000** 3.958
33 D 1.000** 3.958
34 S 1.000** 3.958
35 T 1.000** 3.958
36 V 1.000** 3.958
37 A 1.000** 3.958
38 K 1.000** 3.958
39 T 1.000** 3.958
40 P 1.000** 3.958
41 V 1.000** 3.958
42 P 1.000** 3.958
43 P 1.000** 3.958
44 S 1.000** 3.958
45 T 1.000** 3.958
46 T 1.000** 3.958
47 T 1.000** 3.958
48 G 1.000** 3.958
49 T 1.000** 3.958
50 I 1.000** 3.958
51 S 1.000** 3.958
52 T 1.000** 3.958
53 I 1.000** 3.958
54 I 1.000** 3.958
55 S 1.000** 3.958
56 S 1.000** 3.958
57 A 1.000** 3.958
58 P 1.000** 3.958
59 S 1.000** 3.958
60 P 1.000** 3.958
61 P 1.000** 3.958
62 F 1.000** 3.958
63 A 1.000** 3.958
64 T 1.000** 3.958
65 A 1.000** 3.958
66 A 1.000** 3.958
67 P 1.000** 3.958
68 P 1.000** 3.958
69 T 1.000** 3.958
70 S 1.000** 3.958
71 N 1.000** 3.958
72 T 1.000** 3.958
73 P 1.000** 3.958
74 P 1.000** 3.958
75 D 1.000** 3.958
76 D 1.000** 3.958
77 P 1.000** 3.958
78 C 1.000** 3.958
79 A 1.000** 3.958
80 V 1.000** 3.958
81 N 1.000** 3.958
82 L 1.000** 3.958
83 A 1.000** 3.958
84 S 1.000** 3.958
85 P 1.000** 3.958
86 T 1.000** 3.958
87 I 1.000** 3.958
88 A 1.000** 3.958
89 R 1.000** 3.958
90 V 1.000** 3.958
91 V 1.000** 3.958
92 S 1.000** 3.958
93 E 1.000** 3.958
94 L 1.000** 3.958
95 P 1.000** 3.958
96 R 1.000** 3.958
97 D 1.000** 3.958
98 P 1.000** 3.958
99 R 1.000** 3.958
100 S 1.000** 3.958
101 A 1.000** 3.958
102 Q 1.000** 3.958
103 P 1.000** 3.958
104 W 1.000** 3.958
105 N 1.000** 3.958
106 P 1.000** 3.958
107 E 1.000** 3.958
108 P 1.000** 3.958
109 L 1.000** 3.958
110 A 1.000** 3.958
111 G 1.000** 3.958
112 N 1.000** 3.958
113 Y 1.000** 3.958
114 N 1.000** 3.958
115 E 1.000** 3.958
116 C 1.000** 3.958
117 A 1.000** 3.958
118 Q 1.000** 3.958
119 L 1.000** 3.958
120 S 1.000** 3.958
121 A 1.000** 3.958
122 V 1.000** 3.958
123 I 1.000** 3.958
124 I 1.000** 3.958
125 K 1.000** 3.958
126 A 1.000** 3.958
127 N 1.000** 3.958
128 T 1.000** 3.958
129 N 1.000** 3.958
130 A 1.000** 3.958
131 V 1.000** 3.958
132 N 1.000** 3.958
133 P 1.000** 3.958
134 T 1.000** 3.958
135 T 1.000** 3.958
136 R 1.000** 3.958
137 A 1.000** 3.958
138 V 1.000** 3.958
139 L 1.000** 3.958
140 F 1.000** 3.958
141 H 1.000** 3.958
142 L 1.000** 3.958
143 G 1.000** 3.958
144 R 1.000** 3.958
145 F 1.000** 3.958
146 I 1.000** 3.958
147 P 1.000** 3.958
148 Q 1.000** 3.958
149 G 1.000** 3.958
150 V 1.000** 3.958
151 P 1.000** 3.958
152 D 1.000** 3.958
153 T 1.000** 3.958
154 Y 1.000** 3.958
155 G 1.000** 3.958
156 F 1.000** 3.958
157 N 1.000** 3.958
158 G 1.000** 3.958
159 I 1.000** 3.958
160 D 1.000** 3.958
161 P 1.000** 3.958
162 A 1.000** 3.958
163 Q 1.000** 3.958
164 T 1.000** 3.958
165 T 1.000** 3.958
166 G 1.000** 3.958
167 D 1.000** 3.958
168 T 1.000** 3.958
169 V 1.000** 3.958
170 A 1.000** 3.958
171 L 1.000** 3.958
172 T 1.000** 3.958
173 Y 1.000** 3.958
174 P 1.000** 3.958
175 S 1.000** 3.958
176 S 1.000** 3.958
177 I 1.000** 3.958
178 D 1.000** 3.958
179 G 1.000** 3.958
180 L 1.000** 3.958
181 A 1.000** 3.958
182 T 1.000** 3.958
183 A 1.000** 3.958
184 V 1.000** 3.958
185 R 1.000** 3.958
186 F 1.000** 3.958
187 H 1.000** 3.958
188 W 1.000** 3.958
189 N 1.000** 3.958
190 G 1.000** 3.958
191 N 1.000** 3.958
192 A 1.000** 3.958
193 V 1.000** 3.958
194 E 1.000** 3.958
195 L 1.000** 3.958
196 I 1.000** 3.958
197 S 1.000** 3.958
198 N 1.000** 3.958
199 I 1.000** 3.958
200 A 1.000** 3.958
201 G 1.000** 3.958
202 G 1.000** 3.958
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908129_1_1138_MLBR_RS05335)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:10
Model 1: NearlyNeutral -800.055254 Model 2: PositiveSelection -800.055253 Model 0: one-ratio -800.055262 Model 7: beta -800.055254 Model 8: beta&w>1 -800.055256 Model 0 vs 1 1.5999999959603883E-5 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 3.999999989900971E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
