--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:48:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1115/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -773.00          -777.97
2       -773.00          -776.21
--------------------------------------
TOTAL     -773.00          -777.44
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894177    0.084197    0.383995    1.461167    0.855900   1501.00   1501.00    1.001
r(A<->C){all}   0.164484    0.020497    0.000028    0.456643    0.126515    196.81    200.43    1.000
r(A<->G){all}   0.163031    0.019268    0.000001    0.432411    0.126110    110.57    258.19    1.000
r(A<->T){all}   0.162398    0.018275    0.000017    0.439707    0.132458    321.60    339.96    1.000
r(C<->G){all}   0.163441    0.020112    0.000001    0.455415    0.121497    108.00    156.71    1.001
r(C<->T){all}   0.173371    0.021721    0.000095    0.466102    0.134788    143.05    178.57    1.001
r(G<->T){all}   0.173275    0.021290    0.000048    0.463911    0.135435    202.27    223.61    1.000
pi(A){all}      0.202737    0.000278    0.171995    0.237212    0.202208   1169.20   1317.46    1.000
pi(C){all}      0.251685    0.000342    0.214565    0.286784    0.252294   1253.13   1296.60    1.000
pi(G){all}      0.328915    0.000382    0.290249    0.366322    0.328613   1320.51   1376.22    1.000
pi(T){all}      0.216663    0.000296    0.182273    0.249708    0.216129   1266.65   1273.42    1.000
alpha{1,2}      0.417422    0.217565    0.000117    1.382974    0.252048   1222.63   1333.96    1.000
alpha{3}        0.470663    0.258414    0.000127    1.473455    0.304404    752.31    957.63    1.000
pinvar{all}     0.997213    0.000010    0.990779    1.000000    0.998228   1235.41   1305.76    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-752.262039
Model 2: PositiveSelection	-752.262194
Model 0: one-ratio	-752.262039
Model 7: beta	-752.262039
Model 8: beta&w>1	-752.262039


Model 0 vs 1	0.0

Model 2 vs 1	3.1000000012681994E-4

Model 8 vs 7	0.0
>C1
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C2
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C3
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C4
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C5
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C6
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=188 

C1              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C2              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C3              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C4              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C5              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C6              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
                **************************************************

C1              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C2              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C3              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C4              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C5              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C6              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
                **************************************************

C1              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C2              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C3              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C4              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C5              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C6              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
                **************************************************

C1              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C2              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C3              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C4              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C5              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C6              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
                **************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5640]--->[5640]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.477 Mb, Max= 30.729 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C2              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C3              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C4              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C5              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C6              VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
                **************************************************

C1              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C2              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C3              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C4              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C5              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C6              HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
                **************************************************

C1              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C2              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C3              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C4              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C5              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C6              SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
                **************************************************

C1              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C2              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C3              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C4              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C5              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C6              IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
                **************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C2              GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C3              GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C4              GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C5              GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C6              GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
                **************************************************

C1              GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C2              GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C3              GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C4              GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C5              GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C6              GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
                **************************************************

C1              ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C2              ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C3              ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C4              ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C5              ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C6              ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
                **************************************************

C1              CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C2              CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C3              CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C4              CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C5              CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C6              CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
                **************************************************

C1              GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C2              GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C3              GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C4              GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C5              GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C6              GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
                **************************************************

C1              GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C2              GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C3              GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C4              GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C5              GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C6              GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
                **************************************************

C1              TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C2              TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C3              TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C4              TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C5              TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C6              TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
                **************************************************

C1              GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C2              GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C3              GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C4              GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C5              GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C6              GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
                **************************************************

C1              TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C2              TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C3              TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C4              TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C5              TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C6              TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
                **************************************************

C1              ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C2              ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C3              ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C4              ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C5              ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C6              ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
                **************************************************

C1              GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C2              GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C3              GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C4              GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C5              GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C6              GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
                **************************************************

C1              TTGCTAACTCGAAA
C2              TTGCTAACTCGAAA
C3              TTGCTAACTCGAAA
C4              TTGCTAACTCGAAA
C5              TTGCTAACTCGAAA
C6              TTGCTAACTCGAAA
                **************



>C1
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C2
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C3
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C4
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C5
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C6
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C1
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C2
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C3
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C4
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C5
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C6
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 564 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855618
      Setting output file names to "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 833175045
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5526162807
      Seed = 997195948
      Swapseed = 1579855618
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1262.258963 -- -24.965149
         Chain 2 -- -1262.258963 -- -24.965149
         Chain 3 -- -1262.259036 -- -24.965149
         Chain 4 -- -1262.258963 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1262.258963 -- -24.965149
         Chain 2 -- -1262.259036 -- -24.965149
         Chain 3 -- -1262.259036 -- -24.965149
         Chain 4 -- -1262.258963 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1262.259] (-1262.259) (-1262.259) (-1262.259) * [-1262.259] (-1262.259) (-1262.259) (-1262.259) 
        500 -- [-777.540] (-789.212) (-780.517) (-786.977) * (-786.537) (-782.173) [-787.334] (-789.759) -- 0:00:00
       1000 -- (-787.763) [-789.686] (-786.284) (-786.484) * [-786.277] (-779.201) (-782.389) (-793.156) -- 0:00:00
       1500 -- (-784.267) [-777.978] (-791.055) (-787.108) * (-783.752) (-780.269) (-784.180) [-783.938] -- 0:00:00
       2000 -- (-785.611) [-778.489] (-779.716) (-782.435) * [-782.135] (-778.282) (-783.261) (-786.531) -- 0:00:00
       2500 -- (-779.501) (-786.815) (-779.088) [-782.609] * (-788.832) (-778.056) (-778.779) [-777.008] -- 0:00:00
       3000 -- (-778.930) (-784.909) (-787.832) [-784.388] * (-779.504) (-781.623) (-778.875) [-783.032] -- 0:00:00
       3500 -- (-784.642) (-787.059) [-782.569] (-784.888) * [-780.794] (-781.324) (-780.295) (-783.395) -- 0:00:00
       4000 -- (-780.742) (-790.516) [-776.230] (-782.193) * (-780.323) (-781.694) (-790.007) [-780.565] -- 0:00:00
       4500 -- (-787.896) (-783.469) (-783.717) [-779.741] * [-777.089] (-784.113) (-789.546) (-784.918) -- 0:00:00
       5000 -- (-782.524) [-782.496] (-784.679) (-783.487) * (-780.486) (-780.343) (-777.147) [-777.480] -- 0:00:00

      Average standard deviation of split frequencies: 0.068319

       5500 -- [-777.801] (-788.892) (-778.688) (-780.819) * (-780.404) (-780.208) (-788.885) [-777.872] -- 0:00:00
       6000 -- (-778.372) (-786.339) (-784.005) [-779.742] * (-786.042) [-778.301] (-781.537) (-789.131) -- 0:00:00
       6500 -- (-781.050) [-778.980] (-785.172) (-781.462) * [-784.858] (-781.997) (-782.897) (-785.127) -- 0:00:00
       7000 -- (-779.918) (-787.386) (-779.940) [-781.063] * (-782.949) (-785.764) (-786.083) [-778.480] -- 0:00:00
       7500 -- (-779.979) (-787.888) (-785.475) [-781.126] * (-795.074) [-781.900] (-783.716) (-782.853) -- 0:00:00
       8000 -- (-786.302) (-778.970) (-785.463) [-779.476] * (-796.808) [-783.964] (-780.255) (-786.154) -- 0:00:00
       8500 -- (-784.598) (-788.877) [-778.928] (-781.377) * (-777.194) [-781.904] (-785.165) (-782.782) -- 0:00:00
       9000 -- (-787.917) (-783.835) (-783.982) [-782.617] * [-773.593] (-788.551) (-783.352) (-782.035) -- 0:00:00
       9500 -- (-784.320) (-786.228) [-782.403] (-779.184) * (-774.633) [-784.669] (-784.818) (-780.587) -- 0:00:00
      10000 -- (-788.404) (-781.391) [-789.313] (-789.848) * (-777.682) (-784.589) [-778.311] (-789.351) -- 0:00:00

      Average standard deviation of split frequencies: 0.071202

      10500 -- [-777.465] (-785.640) (-784.299) (-783.871) * [-776.315] (-786.292) (-777.866) (-782.022) -- 0:00:00
      11000 -- [-789.296] (-776.967) (-779.076) (-782.149) * (-774.528) (-783.603) [-798.546] (-795.668) -- 0:00:00
      11500 -- (-779.558) (-781.493) [-781.366] (-777.621) * (-771.858) [-780.532] (-777.511) (-778.574) -- 0:00:00
      12000 -- (-788.549) [-782.290] (-787.605) (-784.648) * [-772.302] (-783.663) (-775.313) (-786.709) -- 0:01:22
      12500 -- (-794.020) (-779.054) [-779.945] (-788.059) * [-772.811] (-780.182) (-774.117) (-783.760) -- 0:01:19
      13000 -- (-788.778) (-787.489) [-781.721] (-786.148) * (-772.790) [-777.038] (-775.734) (-783.647) -- 0:01:15
      13500 -- (-792.637) (-784.372) (-777.989) [-786.463] * [-772.210] (-776.907) (-778.247) (-783.068) -- 0:01:13
      14000 -- (-779.799) (-783.077) [-784.056] (-784.271) * (-772.344) (-787.158) [-775.358] (-788.820) -- 0:01:10
      14500 -- (-783.378) (-782.424) [-779.497] (-785.033) * (-776.080) [-778.654] (-774.247) (-782.018) -- 0:01:07
      15000 -- (-786.473) [-783.739] (-783.123) (-785.424) * (-779.658) [-780.529] (-773.630) (-785.603) -- 0:01:05

      Average standard deviation of split frequencies: 0.048527

      15500 -- (-780.787) [-779.595] (-782.920) (-788.583) * (-776.146) [-778.101] (-773.863) (-786.155) -- 0:01:03
      16000 -- (-788.285) (-784.556) (-780.789) [-779.537] * [-775.271] (-780.941) (-774.530) (-783.906) -- 0:01:01
      16500 -- (-783.152) (-785.440) (-781.432) [-782.619] * [-772.280] (-785.034) (-773.502) (-784.209) -- 0:00:59
      17000 -- (-781.114) (-791.341) (-782.900) [-779.289] * (-772.207) (-778.889) [-774.033] (-782.010) -- 0:00:57
      17500 -- (-791.710) (-779.617) (-792.305) [-783.232] * (-774.706) (-782.914) (-774.441) [-778.089] -- 0:00:56
      18000 -- (-780.028) (-782.884) [-779.867] (-788.998) * (-773.223) (-781.116) (-775.129) [-780.557] -- 0:00:54
      18500 -- (-780.506) [-787.483] (-792.945) (-782.614) * (-774.423) (-785.455) (-772.571) [-776.042] -- 0:00:53
      19000 -- [-778.294] (-790.945) (-778.427) (-781.542) * (-772.562) (-779.128) (-773.821) [-782.054] -- 0:00:51
      19500 -- (-781.381) (-780.491) (-777.987) [-785.345] * [-772.179] (-777.451) (-772.620) (-790.186) -- 0:00:50
      20000 -- [-785.329] (-783.957) (-784.557) (-785.268) * [-772.245] (-777.496) (-773.399) (-783.507) -- 0:00:49

      Average standard deviation of split frequencies: 0.040253

      20500 -- [-782.628] (-776.678) (-781.187) (-783.885) * (-775.421) (-790.321) (-773.290) [-782.185] -- 0:00:47
      21000 -- (-779.523) [-772.444] (-789.891) (-785.807) * (-773.703) (-781.659) (-776.371) [-777.753] -- 0:00:46
      21500 -- (-781.896) (-775.318) [-782.618] (-780.398) * (-773.234) (-786.176) (-777.113) [-787.897] -- 0:00:45
      22000 -- (-778.266) (-776.661) [-786.338] (-788.610) * [-772.853] (-783.559) (-777.546) (-783.649) -- 0:00:44
      22500 -- [-782.532] (-774.432) (-781.325) (-788.401) * [-773.470] (-778.756) (-775.880) (-799.665) -- 0:00:43
      23000 -- (-785.283) [-773.706] (-779.451) (-787.354) * (-775.696) [-779.521] (-773.307) (-781.926) -- 0:00:42
      23500 -- (-792.180) (-772.982) [-779.415] (-789.829) * [-774.418] (-777.634) (-773.087) (-787.607) -- 0:00:41
      24000 -- (-808.575) [-775.102] (-786.044) (-785.858) * (-772.805) (-786.097) (-773.372) [-782.176] -- 0:00:40
      24500 -- (-776.296) [-774.773] (-786.754) (-781.828) * (-776.655) (-776.026) (-775.151) [-776.834] -- 0:00:39
      25000 -- [-772.993] (-772.159) (-781.085) (-783.450) * [-773.179] (-783.476) (-772.679) (-786.986) -- 0:00:39

      Average standard deviation of split frequencies: 0.037989

      25500 -- (-771.674) (-772.794) (-786.600) [-780.683] * [-771.885] (-789.237) (-775.520) (-781.036) -- 0:00:38
      26000 -- (-776.721) [-773.196] (-787.237) (-779.206) * [-771.610] (-785.674) (-776.945) (-783.992) -- 0:01:14
      26500 -- (-776.524) (-773.362) [-779.556] (-779.898) * (-771.542) [-783.791] (-774.489) (-780.277) -- 0:01:13
      27000 -- [-777.661] (-774.173) (-787.646) (-782.977) * (-772.198) (-786.143) (-773.854) [-778.521] -- 0:01:12
      27500 -- (-774.144) [-774.765] (-781.184) (-785.258) * [-772.329] (-778.666) (-775.422) (-781.395) -- 0:01:10
      28000 -- [-774.021] (-775.957) (-783.681) (-777.608) * (-773.383) (-779.546) [-773.030] (-782.426) -- 0:01:09
      28500 -- (-775.690) (-776.224) (-792.748) [-776.933] * [-772.453] (-787.235) (-772.581) (-783.367) -- 0:01:08
      29000 -- (-773.643) (-776.380) [-782.163] (-778.035) * (-776.175) (-782.396) [-773.619] (-781.618) -- 0:01:06
      29500 -- (-772.637) [-778.997] (-783.822) (-783.609) * (-773.824) (-781.887) [-772.701] (-785.608) -- 0:01:05
      30000 -- (-775.827) (-775.051) [-785.252] (-784.169) * (-774.750) (-799.415) (-775.504) [-781.276] -- 0:01:04

      Average standard deviation of split frequencies: 0.038025

      30500 -- [-773.049] (-773.077) (-781.193) (-781.186) * (-772.821) (-780.873) [-771.856] (-782.204) -- 0:01:03
      31000 -- (-772.558) (-776.580) [-784.555] (-778.791) * [-774.238] (-791.740) (-775.944) (-787.410) -- 0:01:02
      31500 -- (-771.576) [-774.416] (-783.146) (-785.333) * (-773.783) (-782.827) [-772.708] (-790.817) -- 0:01:01
      32000 -- (-773.446) (-771.743) [-784.460] (-782.245) * (-773.575) (-781.757) (-774.302) [-777.451] -- 0:01:00
      32500 -- (-773.240) (-772.159) [-779.933] (-778.496) * (-774.361) [-783.628] (-772.527) (-787.706) -- 0:00:59
      33000 -- (-772.663) (-774.760) [-780.837] (-782.744) * [-773.565] (-780.728) (-774.106) (-796.658) -- 0:00:58
      33500 -- (-772.291) (-772.781) [-776.828] (-778.736) * (-775.565) [-779.860] (-773.468) (-791.378) -- 0:00:57
      34000 -- (-772.979) (-772.972) (-778.777) [-781.618] * (-776.285) [-781.945] (-773.367) (-780.931) -- 0:00:56
      34500 -- (-773.882) (-772.058) [-779.375] (-779.781) * (-772.046) (-784.816) (-773.609) [-774.356] -- 0:00:55
      35000 -- (-773.868) (-775.963) [-784.767] (-781.544) * [-772.992] (-781.192) (-773.626) (-776.027) -- 0:00:55

      Average standard deviation of split frequencies: 0.041595

      35500 -- (-772.392) [-773.826] (-779.747) (-792.750) * [-772.147] (-776.532) (-775.363) (-774.823) -- 0:00:54
      36000 -- (-774.430) [-774.870] (-780.635) (-780.010) * [-771.853] (-777.648) (-774.181) (-777.370) -- 0:00:53
      36500 -- (-772.969) (-775.775) [-781.474] (-775.162) * (-773.004) (-774.917) [-775.530] (-773.707) -- 0:00:52
      37000 -- (-772.799) (-773.223) [-788.788] (-774.068) * (-772.942) (-772.416) (-776.174) [-772.726] -- 0:00:52
      37500 -- (-775.515) (-773.050) (-806.363) [-771.994] * (-778.465) [-772.857] (-774.629) (-772.650) -- 0:00:51
      38000 -- (-773.364) [-772.349] (-788.154) (-774.378) * (-774.672) (-775.937) (-777.866) [-773.719] -- 0:00:50
      38500 -- (-772.148) [-772.499] (-789.308) (-775.914) * [-772.256] (-775.645) (-775.447) (-771.489) -- 0:00:49
      39000 -- (-773.356) [-775.044] (-784.812) (-774.979) * (-772.635) (-774.574) (-773.838) [-773.255] -- 0:00:49
      39500 -- (-773.387) (-772.400) (-775.991) [-772.430] * (-773.066) (-781.826) (-771.984) [-773.018] -- 0:00:48
      40000 -- (-771.628) (-775.256) (-776.006) [-774.047] * (-775.129) (-779.661) (-771.826) [-774.087] -- 0:00:48

      Average standard deviation of split frequencies: 0.047012

      40500 -- [-772.011] (-777.235) (-772.525) (-774.760) * (-772.753) (-776.427) [-774.178] (-773.406) -- 0:01:11
      41000 -- (-773.449) (-776.700) [-773.619] (-774.674) * (-772.827) [-774.117] (-779.227) (-773.740) -- 0:01:10
      41500 -- [-774.275] (-777.163) (-773.431) (-771.992) * [-772.485] (-777.075) (-778.699) (-775.733) -- 0:01:09
      42000 -- (-773.076) (-773.878) [-776.540] (-772.692) * (-773.499) (-779.060) [-776.552] (-773.529) -- 0:01:08
      42500 -- (-773.853) [-775.358] (-772.633) (-775.162) * (-773.616) (-782.691) [-772.611] (-772.089) -- 0:01:07
      43000 -- (-773.115) (-773.596) (-774.276) [-771.941] * (-776.071) (-774.787) [-771.735] (-779.530) -- 0:01:06
      43500 -- (-772.615) [-776.276] (-774.847) (-774.456) * (-773.158) (-772.868) [-776.506] (-773.769) -- 0:01:05
      44000 -- (-774.149) (-777.739) (-772.311) [-773.991] * (-774.511) (-772.295) (-777.359) [-773.500] -- 0:01:05
      44500 -- (-773.277) [-774.411] (-772.448) (-772.451) * (-775.594) [-772.027] (-773.176) (-778.735) -- 0:01:04
      45000 -- (-773.654) (-775.109) (-772.992) [-776.306] * (-777.251) (-771.919) (-774.791) [-772.812] -- 0:01:03

      Average standard deviation of split frequencies: 0.040479

      45500 -- [-775.879] (-773.138) (-773.976) (-775.019) * (-777.063) (-771.711) [-772.326] (-773.619) -- 0:01:02
      46000 -- [-773.423] (-772.410) (-772.134) (-773.913) * (-773.158) [-771.502] (-776.266) (-775.706) -- 0:01:02
      46500 -- [-773.047] (-773.271) (-774.101) (-773.415) * (-772.336) (-777.418) [-774.326] (-773.904) -- 0:01:01
      47000 -- (-778.015) (-772.031) (-772.816) [-771.944] * [-772.885] (-779.997) (-774.646) (-774.529) -- 0:01:00
      47500 -- [-775.167] (-775.304) (-780.932) (-773.559) * (-772.605) (-772.159) [-773.465] (-775.817) -- 0:01:00
      48000 -- (-774.674) (-771.898) (-774.244) [-772.624] * (-772.439) (-775.846) (-775.374) [-773.740] -- 0:00:59
      48500 -- (-775.483) (-776.904) [-775.958] (-773.658) * (-772.416) (-777.396) [-777.435] (-771.797) -- 0:00:58
      49000 -- [-774.307] (-776.755) (-774.265) (-775.617) * (-772.502) (-778.499) [-772.082] (-772.181) -- 0:00:58
      49500 -- (-773.934) (-777.629) [-774.260] (-772.627) * (-773.336) (-775.238) (-771.521) [-772.775] -- 0:00:57
      50000 -- [-774.662] (-776.350) (-774.783) (-773.597) * (-781.786) [-772.890] (-772.725) (-773.644) -- 0:00:57

      Average standard deviation of split frequencies: 0.037216

      50500 -- (-775.359) (-773.523) (-774.184) [-773.184] * (-774.859) (-774.588) (-775.266) [-773.409] -- 0:00:56
      51000 -- (-774.513) (-772.820) [-775.768] (-773.200) * (-773.062) (-773.432) (-774.182) [-775.461] -- 0:00:55
      51500 -- (-771.706) (-772.550) (-773.544) [-773.897] * (-771.950) [-773.436] (-774.738) (-777.189) -- 0:00:55
      52000 -- (-774.289) (-773.627) [-773.380] (-775.511) * (-772.087) (-771.910) (-775.739) [-776.000] -- 0:00:54
      52500 -- (-772.273) (-772.439) [-772.949] (-774.156) * (-776.666) [-774.178] (-776.436) (-779.586) -- 0:00:54
      53000 -- (-774.526) (-772.719) (-772.964) [-773.282] * [-774.769] (-775.044) (-776.716) (-776.024) -- 0:00:53
      53500 -- (-773.624) (-773.120) (-773.737) [-774.288] * [-775.090] (-773.169) (-772.340) (-774.094) -- 0:00:53
      54000 -- (-772.114) (-774.241) [-774.880] (-775.450) * (-775.457) (-773.792) (-773.303) [-773.501] -- 0:00:52
      54500 -- (-772.987) [-773.816] (-779.012) (-773.806) * (-775.531) [-772.753] (-772.647) (-772.951) -- 0:00:52
      55000 -- [-771.820] (-774.220) (-773.272) (-773.201) * (-774.336) (-773.101) [-773.049] (-772.302) -- 0:00:51

      Average standard deviation of split frequencies: 0.034167

      55500 -- [-772.799] (-773.810) (-772.737) (-774.811) * (-774.326) [-772.874] (-772.842) (-776.153) -- 0:00:51
      56000 -- (-774.201) (-778.200) [-774.815] (-775.615) * [-771.812] (-774.619) (-775.293) (-780.594) -- 0:01:07
      56500 -- (-772.894) (-773.237) (-771.857) [-772.397] * [-774.597] (-778.752) (-777.233) (-775.162) -- 0:01:06
      57000 -- [-774.014] (-772.398) (-772.545) (-774.505) * [-772.121] (-773.489) (-773.120) (-775.801) -- 0:01:06
      57500 -- (-774.263) (-772.675) (-772.667) [-774.401] * (-772.205) (-773.051) [-772.029] (-774.993) -- 0:01:05
      58000 -- [-772.166] (-776.632) (-773.555) (-771.396) * (-771.685) (-773.609) (-775.034) [-772.338] -- 0:01:04
      58500 -- (-773.489) (-774.975) (-773.815) [-771.609] * (-771.899) [-773.480] (-777.698) (-773.614) -- 0:01:04
      59000 -- [-772.906] (-774.336) (-776.059) (-773.456) * (-771.719) (-777.836) (-774.878) [-773.385] -- 0:01:03
      59500 -- (-772.685) [-772.685] (-774.700) (-772.979) * (-772.178) (-772.895) [-774.430] (-774.197) -- 0:01:03
      60000 -- (-773.220) (-774.413) (-776.879) [-775.485] * [-772.605] (-772.187) (-774.450) (-774.908) -- 0:01:02

      Average standard deviation of split frequencies: 0.037557

      60500 -- (-772.543) (-774.811) [-775.295] (-772.605) * (-772.528) [-772.645] (-773.531) (-775.439) -- 0:01:02
      61000 -- (-774.449) (-773.365) [-773.244] (-772.985) * (-773.598) (-772.542) [-772.606] (-772.794) -- 0:01:01
      61500 -- (-775.445) [-773.718] (-777.802) (-774.249) * (-772.209) (-772.454) [-777.561] (-775.060) -- 0:01:01
      62000 -- [-773.743] (-772.945) (-778.545) (-774.727) * (-773.251) [-775.768] (-778.422) (-775.961) -- 0:01:00
      62500 -- (-771.999) (-778.108) (-777.294) [-774.675] * [-772.661] (-775.240) (-772.502) (-774.176) -- 0:01:00
      63000 -- (-773.447) (-773.426) [-776.562] (-775.889) * (-772.626) [-774.200] (-774.188) (-772.405) -- 0:00:59
      63500 -- (-777.725) [-774.981] (-778.909) (-772.629) * (-771.562) [-775.943] (-773.289) (-774.646) -- 0:00:58
      64000 -- (-774.672) (-774.908) (-774.826) [-773.344] * (-773.608) [-772.536] (-772.681) (-771.844) -- 0:00:58
      64500 -- (-773.319) (-773.201) (-772.191) [-773.269] * (-773.014) (-776.227) [-774.381] (-774.639) -- 0:00:58
      65000 -- (-774.063) [-776.857] (-775.261) (-772.961) * [-775.419] (-772.733) (-773.148) (-773.723) -- 0:00:57

      Average standard deviation of split frequencies: 0.034209

      65500 -- (-775.341) (-776.188) (-773.497) [-774.023] * [-773.217] (-773.373) (-773.699) (-774.287) -- 0:00:57
      66000 -- (-775.973) (-775.495) [-773.379] (-774.840) * (-773.435) (-773.893) [-773.450] (-776.621) -- 0:00:56
      66500 -- (-776.422) (-775.120) (-775.160) [-773.410] * (-773.738) (-772.269) [-775.524] (-772.411) -- 0:00:56
      67000 -- (-772.465) (-773.970) [-773.019] (-774.228) * [-772.991] (-772.186) (-778.945) (-772.702) -- 0:00:55
      67500 -- (-774.617) (-772.470) [-773.557] (-775.724) * [-772.569] (-774.463) (-777.332) (-773.884) -- 0:00:55
      68000 -- (-772.956) (-772.635) [-772.848] (-775.883) * (-773.878) (-772.148) (-777.266) [-772.013] -- 0:00:54
      68500 -- (-775.280) [-772.430] (-774.466) (-775.100) * (-773.387) (-773.386) (-782.391) [-779.891] -- 0:00:54
      69000 -- (-773.767) (-771.913) (-772.328) [-772.374] * (-774.034) (-775.282) (-775.955) [-777.710] -- 0:00:53
      69500 -- (-774.393) [-772.554] (-773.092) (-772.168) * (-779.661) [-774.778] (-773.964) (-773.623) -- 0:00:53
      70000 -- [-773.763] (-772.122) (-774.175) (-771.822) * (-772.700) [-772.900] (-776.391) (-773.153) -- 0:00:53

      Average standard deviation of split frequencies: 0.028439

      70500 -- (-771.890) [-772.859] (-772.688) (-771.960) * (-773.760) [-775.327] (-775.532) (-771.851) -- 0:00:52
      71000 -- [-772.750] (-773.241) (-773.722) (-778.177) * (-773.811) (-775.368) [-773.831] (-773.458) -- 0:01:05
      71500 -- (-773.154) (-775.115) (-774.881) [-772.002] * (-778.189) (-773.713) (-771.884) [-773.049] -- 0:01:04
      72000 -- (-772.936) (-777.633) (-772.459) [-771.568] * (-772.920) [-772.542] (-773.396) (-772.104) -- 0:01:04
      72500 -- (-773.680) (-773.008) [-773.187] (-775.776) * [-774.727] (-777.214) (-777.258) (-776.899) -- 0:01:03
      73000 -- (-778.675) [-773.131] (-774.018) (-774.461) * (-772.291) [-771.901] (-773.800) (-773.526) -- 0:01:03
      73500 -- (-776.035) [-776.722] (-777.497) (-773.238) * (-774.191) (-772.346) [-774.874] (-772.773) -- 0:01:03
      74000 -- (-773.910) [-772.991] (-776.198) (-774.331) * (-773.188) (-772.883) (-775.200) [-771.853] -- 0:01:02
      74500 -- (-773.701) (-772.021) [-777.487] (-774.067) * (-772.911) [-772.194] (-772.992) (-776.123) -- 0:01:02
      75000 -- [-774.718] (-773.249) (-785.263) (-774.297) * (-773.825) (-772.244) [-772.422] (-775.919) -- 0:01:01

      Average standard deviation of split frequencies: 0.030361

      75500 -- (-772.045) [-772.900] (-774.627) (-774.888) * [-772.095] (-773.129) (-774.005) (-773.596) -- 0:01:01
      76000 -- [-772.754] (-774.559) (-772.988) (-774.940) * [-773.323] (-772.946) (-775.434) (-772.982) -- 0:01:00
      76500 -- (-772.901) (-775.688) (-771.760) [-776.073] * [-774.132] (-775.584) (-773.373) (-772.930) -- 0:01:00
      77000 -- (-775.612) (-774.336) [-772.287] (-773.468) * (-775.861) (-773.407) (-772.408) [-772.850] -- 0:00:59
      77500 -- (-776.034) (-775.721) [-775.807] (-774.701) * [-773.671] (-777.090) (-772.963) (-773.728) -- 0:00:59
      78000 -- (-772.758) (-775.492) (-775.342) [-773.692] * (-774.472) [-775.426] (-775.518) (-773.057) -- 0:00:59
      78500 -- (-771.958) (-771.388) [-772.470] (-773.507) * [-773.587] (-772.953) (-775.796) (-772.529) -- 0:00:58
      79000 -- (-773.922) (-773.888) [-772.425] (-773.865) * [-774.824] (-774.009) (-776.253) (-775.736) -- 0:00:58
      79500 -- (-773.446) (-777.928) [-775.755] (-773.798) * [-774.757] (-773.111) (-776.459) (-777.860) -- 0:00:57
      80000 -- (-772.558) (-773.032) (-776.184) [-776.544] * (-773.110) [-774.027] (-776.378) (-773.863) -- 0:00:57

      Average standard deviation of split frequencies: 0.029219

      80500 -- (-772.421) [-773.172] (-774.812) (-777.550) * (-773.303) (-773.860) [-773.917] (-774.168) -- 0:00:57
      81000 -- [-773.536] (-774.785) (-778.262) (-773.323) * (-772.814) [-773.666] (-772.278) (-772.492) -- 0:00:56
      81500 -- (-773.437) (-773.249) (-780.046) [-775.612] * [-772.798] (-774.561) (-772.909) (-773.323) -- 0:00:56
      82000 -- [-773.666] (-773.583) (-774.160) (-772.444) * (-775.398) (-776.411) [-772.219] (-772.873) -- 0:00:55
      82500 -- (-774.648) [-772.978] (-775.305) (-772.278) * (-772.284) [-774.156] (-774.880) (-773.345) -- 0:00:55
      83000 -- [-773.301] (-772.365) (-775.699) (-772.961) * [-774.478] (-772.860) (-776.460) (-772.993) -- 0:00:55
      83500 -- [-776.585] (-774.483) (-774.221) (-773.323) * [-774.029] (-772.123) (-771.982) (-772.946) -- 0:00:54
      84000 -- (-772.901) [-772.330] (-772.396) (-773.564) * (-774.970) (-777.345) (-773.111) [-774.066] -- 0:00:54
      84500 -- [-774.746] (-772.178) (-773.229) (-773.785) * [-772.879] (-775.368) (-775.394) (-771.781) -- 0:00:54
      85000 -- (-774.600) (-773.484) [-773.889] (-775.097) * (-773.632) [-772.136] (-775.802) (-772.343) -- 0:00:53

      Average standard deviation of split frequencies: 0.027696

      85500 -- (-775.428) (-773.900) [-772.749] (-774.374) * (-774.173) [-777.627] (-780.636) (-772.720) -- 0:00:53
      86000 -- (-774.353) [-774.181] (-772.766) (-772.126) * [-772.154] (-774.284) (-776.562) (-773.244) -- 0:00:53
      86500 -- [-771.890] (-773.451) (-775.615) (-774.050) * (-772.810) (-776.525) [-781.587] (-775.618) -- 0:00:52
      87000 -- (-773.525) (-773.279) (-772.312) [-774.378] * (-772.095) (-774.514) (-774.953) [-773.676] -- 0:01:02
      87500 -- (-775.684) (-774.037) [-772.889] (-773.523) * (-777.085) (-773.189) [-775.039] (-772.772) -- 0:01:02
      88000 -- (-778.526) (-773.859) [-771.654] (-775.893) * (-782.882) (-771.848) [-773.466] (-773.896) -- 0:01:02
      88500 -- [-780.217] (-774.257) (-774.071) (-775.814) * (-775.777) [-772.597] (-773.461) (-772.262) -- 0:01:01
      89000 -- (-776.674) [-772.411] (-774.071) (-773.093) * (-774.310) [-773.709] (-774.541) (-773.392) -- 0:01:01
      89500 -- (-774.047) [-772.984] (-772.158) (-771.965) * (-777.897) (-773.004) (-772.562) [-772.203] -- 0:01:01
      90000 -- (-776.715) (-773.267) [-772.164] (-775.590) * (-775.274) (-774.645) (-773.621) [-772.744] -- 0:01:00

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-776.473) (-773.174) [-772.973] (-774.398) * [-775.088] (-775.256) (-772.740) (-777.143) -- 0:01:00
      91000 -- (-771.885) (-772.642) (-772.847) [-772.811] * (-774.567) (-774.007) [-771.774] (-776.927) -- 0:00:59
      91500 -- (-774.598) (-776.926) [-772.682] (-773.517) * [-774.456] (-775.826) (-774.019) (-771.900) -- 0:00:59
      92000 -- [-772.407] (-775.319) (-773.934) (-772.941) * (-774.897) [-778.288] (-772.991) (-776.343) -- 0:00:59
      92500 -- (-773.769) [-772.919] (-773.460) (-772.479) * [-773.129] (-773.371) (-774.760) (-776.277) -- 0:00:58
      93000 -- (-774.082) (-772.224) [-773.865] (-773.684) * (-774.892) (-773.611) (-774.803) [-775.117] -- 0:00:58
      93500 -- (-775.399) (-773.749) [-775.008] (-772.279) * [-775.527] (-773.431) (-775.566) (-777.640) -- 0:00:58
      94000 -- (-774.788) (-773.680) (-772.061) [-772.279] * [-772.373] (-773.526) (-773.634) (-779.146) -- 0:00:57
      94500 -- (-773.676) (-773.440) (-779.929) [-774.595] * (-772.918) [-771.837] (-772.359) (-778.709) -- 0:00:57
      95000 -- [-772.114] (-774.649) (-774.415) (-773.344) * (-772.175) (-771.763) [-772.158] (-776.659) -- 0:00:57

      Average standard deviation of split frequencies: 0.025586

      95500 -- (-777.521) (-775.164) (-776.260) [-772.253] * (-772.520) (-772.244) (-773.217) [-772.452] -- 0:00:56
      96000 -- (-774.479) (-777.377) [-775.375] (-772.403) * (-772.910) (-772.148) (-773.901) [-773.351] -- 0:00:56
      96500 -- (-774.947) (-775.663) (-772.125) [-773.247] * [-776.560] (-772.358) (-776.980) (-774.432) -- 0:00:56
      97000 -- (-772.902) [-774.398] (-774.699) (-773.620) * [-773.374] (-771.993) (-781.443) (-773.184) -- 0:00:55
      97500 -- (-776.386) [-772.527] (-775.506) (-775.315) * [-773.327] (-776.568) (-780.221) (-776.389) -- 0:00:55
      98000 -- [-772.578] (-773.195) (-774.852) (-773.089) * (-777.156) (-777.684) (-775.630) [-775.428] -- 0:00:55
      98500 -- (-774.232) (-772.278) [-772.331] (-772.018) * [-774.514] (-775.748) (-773.296) (-776.024) -- 0:00:54
      99000 -- (-776.945) [-773.067] (-772.128) (-772.018) * (-775.953) (-775.283) [-774.383] (-772.191) -- 0:00:54
      99500 -- (-773.334) (-775.507) [-772.276] (-773.594) * (-779.698) (-773.672) (-775.442) [-771.517] -- 0:00:54
      100000 -- [-777.273] (-772.812) (-772.079) (-771.679) * (-773.777) (-775.315) (-773.855) [-774.465] -- 0:00:54

      Average standard deviation of split frequencies: 0.024791

      100500 -- (-778.169) (-774.050) [-772.376] (-772.273) * (-779.371) (-773.352) (-773.501) [-775.482] -- 0:00:53
      101000 -- (-772.670) (-771.467) (-773.178) [-774.394] * (-774.461) (-772.963) (-773.395) [-773.289] -- 0:00:53
      101500 -- (-773.342) [-771.672] (-772.070) (-774.577) * (-776.268) [-773.179] (-772.117) (-776.510) -- 0:00:53
      102000 -- [-776.862] (-772.271) (-773.053) (-776.621) * (-772.984) (-775.048) [-771.870] (-774.264) -- 0:00:52
      102500 -- (-776.150) (-772.847) (-773.761) [-773.157] * (-772.459) (-777.298) (-771.754) [-773.227] -- 0:01:01
      103000 -- (-775.787) (-773.861) [-772.247] (-773.466) * (-776.028) (-783.876) (-774.624) [-772.573] -- 0:01:00
      103500 -- (-777.290) (-775.268) (-773.473) [-771.762] * (-776.651) (-773.452) (-773.492) [-773.131] -- 0:01:00
      104000 -- (-773.060) (-774.984) [-773.344] (-773.286) * (-773.213) [-773.338] (-773.223) (-772.517) -- 0:01:00
      104500 -- (-774.577) (-773.086) [-772.913] (-772.487) * (-772.651) (-774.110) [-772.748] (-779.848) -- 0:00:59
      105000 -- (-773.717) (-775.182) [-775.583] (-773.537) * [-772.198] (-773.138) (-775.861) (-777.805) -- 0:00:59

      Average standard deviation of split frequencies: 0.026683

      105500 -- (-774.012) (-782.497) (-778.608) [-773.386] * (-772.013) [-773.728] (-775.607) (-774.051) -- 0:00:59
      106000 -- (-772.939) (-774.972) [-772.380] (-775.205) * (-773.319) (-774.580) (-773.207) [-777.392] -- 0:00:59
      106500 -- (-772.678) (-772.401) (-776.583) [-772.979] * (-772.474) [-772.305] (-774.989) (-775.624) -- 0:00:58
      107000 -- (-775.444) [-771.962] (-776.143) (-774.701) * (-775.314) (-773.801) (-772.746) [-772.746] -- 0:00:58
      107500 -- (-774.374) (-773.104) [-774.398] (-774.287) * (-774.393) (-773.423) (-772.747) [-772.203] -- 0:00:58
      108000 -- (-773.208) (-774.459) (-772.788) [-773.108] * (-772.747) (-775.003) (-772.051) [-771.831] -- 0:00:57
      108500 -- [-773.392] (-773.896) (-775.379) (-774.977) * [-773.209] (-779.725) (-771.918) (-771.875) -- 0:00:57
      109000 -- (-775.682) [-773.434] (-776.260) (-775.906) * (-772.634) [-777.176] (-771.541) (-774.378) -- 0:00:57
      109500 -- (-774.528) (-772.325) [-774.138] (-772.944) * (-772.952) (-772.698) (-772.524) [-775.735] -- 0:00:56
      110000 -- [-773.829] (-773.533) (-774.408) (-772.500) * (-773.402) [-772.865] (-775.494) (-773.710) -- 0:00:56

      Average standard deviation of split frequencies: 0.024305

      110500 -- (-779.668) (-775.363) (-774.148) [-773.476] * (-776.281) [-773.588] (-771.486) (-776.144) -- 0:00:56
      111000 -- [-781.102] (-772.278) (-772.134) (-772.863) * [-772.991] (-771.596) (-776.025) (-774.526) -- 0:00:56
      111500 -- [-775.255] (-772.910) (-774.190) (-773.581) * (-773.870) (-775.624) [-772.300] (-772.959) -- 0:00:55
      112000 -- (-775.066) [-774.465] (-775.644) (-777.168) * (-773.294) [-773.605] (-774.076) (-772.847) -- 0:00:55
      112500 -- (-773.303) [-774.113] (-775.774) (-772.303) * (-775.246) (-772.591) (-773.451) [-772.729] -- 0:00:55
      113000 -- (-775.304) (-775.134) (-773.794) [-773.234] * (-778.285) (-774.739) (-774.317) [-775.172] -- 0:00:54
      113500 -- (-775.247) (-774.136) [-773.993] (-773.088) * (-775.374) (-772.475) [-775.758] (-772.170) -- 0:00:54
      114000 -- (-774.827) (-775.403) [-771.998] (-774.154) * (-773.370) (-772.515) [-773.476] (-772.444) -- 0:00:54
      114500 -- (-773.433) (-776.734) [-775.156] (-778.353) * (-771.501) (-776.341) [-773.746] (-773.735) -- 0:00:54
      115000 -- [-772.384] (-776.417) (-771.991) (-777.137) * (-772.286) (-772.885) (-774.363) [-774.087] -- 0:00:53

      Average standard deviation of split frequencies: 0.021753

      115500 -- (-773.079) (-774.240) (-776.125) [-775.752] * (-772.284) (-775.157) (-774.091) [-773.021] -- 0:00:53
      116000 -- (-774.155) [-774.321] (-775.241) (-773.390) * [-772.893] (-775.085) (-774.862) (-772.536) -- 0:00:53
      116500 -- (-772.431) (-772.289) (-773.945) [-772.771] * [-771.705] (-773.232) (-780.023) (-774.736) -- 0:00:53
      117000 -- (-775.511) [-771.557] (-774.428) (-776.739) * (-777.162) [-774.116] (-774.170) (-773.739) -- 0:00:52
      117500 -- (-775.172) (-773.549) [-773.745] (-773.855) * (-777.484) (-773.726) (-772.771) [-773.120] -- 0:00:52
      118000 -- (-774.365) [-773.690] (-776.665) (-773.927) * [-775.168] (-773.334) (-771.804) (-775.767) -- 0:00:52
      118500 -- [-772.545] (-773.310) (-773.097) (-771.798) * (-775.994) (-773.674) (-775.533) [-772.319] -- 0:00:52
      119000 -- (-773.468) (-775.308) [-773.778] (-771.917) * [-774.691] (-773.153) (-774.428) (-772.473) -- 0:00:51
      119500 -- [-771.691] (-774.835) (-775.999) (-773.707) * (-774.680) (-780.748) (-777.115) [-772.288] -- 0:00:58
      120000 -- [-773.460] (-772.659) (-776.292) (-775.440) * (-774.569) [-774.968] (-776.091) (-772.415) -- 0:00:58

      Average standard deviation of split frequencies: 0.022061

      120500 -- (-775.430) [-773.416] (-773.947) (-774.496) * (-772.739) [-773.668] (-773.763) (-772.513) -- 0:00:58
      121000 -- (-775.243) [-774.161] (-774.221) (-772.266) * (-772.826) (-772.438) (-776.074) [-773.356] -- 0:00:58
      121500 -- (-772.742) [-774.177] (-774.568) (-771.720) * (-774.484) (-772.479) (-772.152) [-773.396] -- 0:00:57
      122000 -- (-774.581) [-773.242] (-775.487) (-777.621) * (-774.319) (-774.166) [-772.471] (-773.073) -- 0:00:57
      122500 -- (-774.283) [-773.524] (-776.282) (-773.606) * (-775.445) (-773.965) [-773.869] (-775.180) -- 0:00:57
      123000 -- [-775.608] (-773.295) (-785.089) (-773.017) * (-777.774) [-773.082] (-773.986) (-776.440) -- 0:00:57
      123500 -- [-776.499] (-773.096) (-779.910) (-773.875) * (-777.642) [-772.138] (-773.564) (-772.944) -- 0:00:56
      124000 -- (-774.310) [-772.440] (-778.680) (-773.548) * [-772.841] (-773.895) (-777.698) (-771.969) -- 0:00:56
      124500 -- (-774.198) [-772.191] (-775.685) (-774.478) * (-772.302) (-775.222) [-777.871] (-772.316) -- 0:00:56
      125000 -- (-774.637) [-771.764] (-775.003) (-774.842) * (-773.708) (-774.091) [-774.893] (-777.473) -- 0:00:56

      Average standard deviation of split frequencies: 0.024208

      125500 -- (-774.299) [-772.053] (-776.621) (-776.217) * (-774.750) (-772.074) (-773.256) [-774.269] -- 0:00:55
      126000 -- (-774.575) (-773.352) [-777.669] (-773.945) * (-771.788) (-775.071) (-777.049) [-772.852] -- 0:00:55
      126500 -- (-771.943) (-773.005) [-776.370] (-779.885) * (-773.636) (-774.154) [-777.849] (-772.545) -- 0:00:55
      127000 -- (-775.704) (-773.292) [-777.674] (-774.843) * (-773.901) (-773.319) [-775.758] (-773.677) -- 0:00:54
      127500 -- (-774.613) (-775.173) (-772.682) [-774.586] * [-775.761] (-772.365) (-774.141) (-775.098) -- 0:00:54
      128000 -- [-773.071] (-775.107) (-776.010) (-774.429) * [-773.862] (-772.547) (-771.826) (-775.870) -- 0:00:54
      128500 -- (-773.183) (-775.597) [-773.120] (-773.358) * (-773.840) (-773.370) (-774.940) [-773.829] -- 0:00:54
      129000 -- [-774.536] (-774.424) (-776.197) (-773.235) * (-771.989) [-772.299] (-776.677) (-773.883) -- 0:00:54
      129500 -- (-778.788) (-772.988) [-772.024] (-776.606) * (-773.250) [-771.790] (-777.369) (-773.279) -- 0:00:53
      130000 -- (-775.283) [-775.268] (-772.938) (-780.615) * (-774.662) (-772.705) (-777.108) [-773.025] -- 0:00:53

      Average standard deviation of split frequencies: 0.023768

      130500 -- (-774.809) (-772.603) (-775.582) [-773.844] * (-772.664) (-774.387) (-772.023) [-772.534] -- 0:00:53
      131000 -- (-773.131) (-771.946) [-772.973] (-773.406) * (-772.869) (-774.001) (-772.688) [-773.379] -- 0:00:53
      131500 -- (-772.190) (-773.069) (-774.587) [-771.344] * (-776.377) (-773.632) [-774.053] (-772.875) -- 0:00:52
      132000 -- (-774.352) (-775.081) (-775.715) [-771.697] * (-774.753) [-774.299] (-774.357) (-771.702) -- 0:00:52
      132500 -- (-774.292) (-775.250) [-773.810] (-771.471) * [-772.947] (-774.048) (-773.635) (-773.439) -- 0:00:52
      133000 -- [-772.693] (-772.510) (-773.503) (-771.764) * (-772.320) (-775.313) [-775.972] (-772.903) -- 0:00:52
      133500 -- (-773.206) (-771.921) (-773.596) [-774.508] * (-772.051) [-773.252] (-772.625) (-772.614) -- 0:00:58
      134000 -- [-772.961] (-774.965) (-772.160) (-772.937) * (-773.321) (-776.627) [-773.437] (-778.730) -- 0:00:58
      134500 -- (-776.524) [-772.438] (-772.052) (-772.904) * (-772.396) [-774.044] (-774.859) (-774.921) -- 0:00:57
      135000 -- (-773.505) (-772.145) [-771.361] (-773.714) * (-771.809) [-774.511] (-774.937) (-773.301) -- 0:00:57

      Average standard deviation of split frequencies: 0.020027

      135500 -- (-773.418) [-773.006] (-773.443) (-774.119) * (-776.035) [-772.561] (-771.867) (-774.415) -- 0:00:57
      136000 -- (-774.006) (-774.156) [-771.726] (-776.487) * (-783.232) (-773.085) [-773.005] (-774.267) -- 0:00:57
      136500 -- (-773.003) (-776.223) (-773.277) [-776.002] * (-777.462) [-772.449] (-773.489) (-773.303) -- 0:00:56
      137000 -- (-775.016) [-778.389] (-774.339) (-775.211) * (-774.523) [-773.942] (-772.018) (-778.052) -- 0:00:56
      137500 -- (-773.107) (-775.584) [-771.875] (-779.045) * [-774.766] (-776.129) (-773.539) (-774.228) -- 0:00:56
      138000 -- [-772.790] (-775.283) (-771.955) (-771.963) * (-772.292) (-776.353) [-772.052] (-773.624) -- 0:00:56
      138500 -- (-775.694) [-773.675] (-771.658) (-774.590) * (-774.034) (-776.116) [-772.618] (-773.492) -- 0:00:55
      139000 -- [-772.503] (-777.424) (-772.214) (-772.695) * (-773.585) (-772.668) [-773.447] (-773.457) -- 0:00:55
      139500 -- (-773.620) [-774.727] (-771.711) (-772.188) * (-773.660) [-772.319] (-773.531) (-772.612) -- 0:00:55
      140000 -- (-783.294) (-773.425) [-773.943] (-775.587) * (-774.462) (-773.089) [-772.148] (-771.672) -- 0:00:55

      Average standard deviation of split frequencies: 0.021290

      140500 -- (-774.698) (-775.154) (-772.939) [-773.540] * (-774.856) [-772.246] (-775.323) (-772.320) -- 0:00:55
      141000 -- (-775.481) (-776.817) (-773.107) [-773.113] * (-773.227) (-772.649) [-773.328] (-771.530) -- 0:00:54
      141500 -- (-774.942) (-772.521) (-778.188) [-775.868] * (-772.847) [-773.390] (-772.235) (-771.888) -- 0:00:54
      142000 -- (-774.544) (-773.960) (-773.433) [-774.757] * [-772.191] (-772.711) (-775.502) (-774.075) -- 0:00:54
      142500 -- (-776.663) (-771.974) [-772.154] (-775.485) * (-776.473) (-773.614) [-774.301] (-774.282) -- 0:00:54
      143000 -- (-779.571) (-773.711) [-771.774] (-774.603) * [-772.854] (-773.216) (-777.740) (-774.095) -- 0:00:53
      143500 -- (-773.158) (-773.403) [-772.403] (-778.521) * (-775.883) (-772.943) [-773.247] (-776.793) -- 0:00:53
      144000 -- (-774.345) (-772.553) (-775.107) [-771.935] * (-773.425) (-773.207) (-773.807) [-772.113] -- 0:00:53
      144500 -- [-773.793] (-772.985) (-774.438) (-774.603) * (-772.934) (-773.106) [-772.785] (-775.374) -- 0:00:53
      145000 -- (-775.613) (-772.343) (-775.341) [-776.177] * (-771.657) (-773.747) (-772.646) [-772.877] -- 0:00:53

      Average standard deviation of split frequencies: 0.020628

      145500 -- (-774.085) [-771.339] (-777.820) (-773.255) * (-771.740) (-779.917) (-774.011) [-772.862] -- 0:00:52
      146000 -- [-772.131] (-771.335) (-776.424) (-774.510) * (-771.987) (-772.301) [-774.014] (-777.011) -- 0:00:52
      146500 -- (-773.753) [-772.137] (-772.915) (-771.698) * (-773.204) (-772.897) [-772.472] (-773.406) -- 0:00:52
      147000 -- (-773.052) (-771.993) (-773.245) [-772.120] * (-773.472) [-772.484] (-774.231) (-774.333) -- 0:00:52
      147500 -- [-775.676] (-772.070) (-771.969) (-772.145) * (-774.563) (-772.467) (-775.123) [-772.656] -- 0:00:52
      148000 -- [-774.964] (-772.278) (-772.436) (-781.425) * (-773.242) [-773.116] (-774.808) (-772.185) -- 0:00:51
      148500 -- [-775.179] (-772.297) (-775.446) (-779.090) * (-774.626) (-776.359) [-774.355] (-772.537) -- 0:00:51
      149000 -- (-775.981) [-774.532] (-775.880) (-777.916) * (-774.832) [-774.634] (-772.847) (-773.706) -- 0:00:51
      149500 -- (-773.587) (-772.930) [-771.885] (-781.508) * (-774.627) (-776.504) [-774.474] (-774.824) -- 0:00:51
      150000 -- (-773.386) (-773.527) (-773.228) [-774.239] * (-772.236) (-773.872) (-776.407) [-773.385] -- 0:00:56

      Average standard deviation of split frequencies: 0.021717

      150500 -- (-773.346) (-773.752) [-772.390] (-772.591) * (-773.008) (-776.140) (-773.918) [-772.142] -- 0:00:56
      151000 -- [-773.405] (-775.437) (-776.181) (-772.276) * (-775.978) (-772.662) [-774.188] (-775.541) -- 0:00:56
      151500 -- [-778.675] (-773.444) (-774.387) (-774.900) * (-773.261) [-772.355] (-775.812) (-773.773) -- 0:00:56
      152000 -- (-774.138) [-778.253] (-772.201) (-775.569) * (-776.667) (-775.922) (-774.028) [-773.864] -- 0:00:55
      152500 -- (-773.894) [-773.741] (-771.756) (-781.189) * (-776.072) (-777.687) (-776.407) [-775.593] -- 0:00:55
      153000 -- [-771.882] (-772.155) (-772.725) (-778.705) * [-773.052] (-772.561) (-773.919) (-774.658) -- 0:00:55
      153500 -- (-772.114) (-776.162) (-772.921) [-777.614] * (-772.040) [-773.605] (-774.544) (-772.768) -- 0:00:55
      154000 -- (-773.818) (-776.195) (-772.075) [-771.531] * (-773.843) (-773.363) (-776.012) [-776.148] -- 0:00:54
      154500 -- [-773.050] (-774.102) (-771.946) (-773.446) * (-773.866) (-776.019) [-775.624] (-778.099) -- 0:00:54
      155000 -- (-772.781) (-773.877) (-775.400) [-774.390] * (-776.863) [-775.455] (-772.741) (-772.869) -- 0:00:54

      Average standard deviation of split frequencies: 0.020620

      155500 -- [-772.992] (-776.014) (-776.542) (-775.925) * (-773.601) (-774.086) (-772.331) [-772.961] -- 0:00:54
      156000 -- [-773.228] (-774.518) (-775.597) (-773.112) * (-773.629) (-773.574) [-771.897] (-773.035) -- 0:00:54
      156500 -- (-771.966) [-773.440] (-776.501) (-772.904) * (-773.870) (-776.337) [-772.176] (-774.037) -- 0:00:53
      157000 -- (-775.280) [-774.070] (-775.292) (-772.445) * (-779.810) (-777.677) (-775.180) [-772.196] -- 0:00:53
      157500 -- [-773.076] (-774.156) (-774.838) (-772.494) * (-772.997) [-772.711] (-772.566) (-772.801) -- 0:00:53
      158000 -- [-774.390] (-774.952) (-774.557) (-775.892) * [-773.887] (-775.280) (-773.446) (-773.333) -- 0:00:53
      158500 -- (-773.457) [-771.408] (-773.774) (-776.195) * [-773.799] (-773.395) (-772.677) (-773.538) -- 0:00:53
      159000 -- [-771.867] (-776.754) (-773.497) (-773.063) * (-775.586) (-776.454) [-774.281] (-773.199) -- 0:00:52
      159500 -- [-778.133] (-774.615) (-777.259) (-773.598) * [-773.680] (-772.641) (-775.029) (-774.430) -- 0:00:52
      160000 -- (-776.207) (-772.763) (-776.479) [-774.845] * (-773.302) (-772.782) (-779.761) [-772.710] -- 0:00:52

      Average standard deviation of split frequencies: 0.020355

      160500 -- (-773.321) (-774.073) (-777.132) [-773.279] * (-772.323) (-771.474) (-776.060) [-776.846] -- 0:00:52
      161000 -- [-774.431] (-773.208) (-776.891) (-772.552) * [-775.027] (-779.443) (-775.811) (-775.352) -- 0:00:52
      161500 -- (-774.394) (-780.878) [-773.799] (-773.757) * [-772.663] (-777.415) (-775.256) (-772.761) -- 0:00:51
      162000 -- (-778.811) (-774.533) (-777.925) [-775.307] * (-776.308) [-775.613] (-775.716) (-772.094) -- 0:00:51
      162500 -- (-777.197) (-774.940) (-772.544) [-772.566] * (-775.286) (-773.489) [-775.668] (-773.135) -- 0:00:51
      163000 -- (-773.833) (-774.739) (-772.782) [-772.612] * [-772.557] (-776.430) (-771.380) (-778.311) -- 0:00:51
      163500 -- (-773.915) (-774.849) (-772.762) [-773.809] * (-772.026) (-773.680) [-771.476] (-774.682) -- 0:00:51
      164000 -- (-774.729) (-771.886) [-774.059] (-774.376) * [-772.334] (-771.955) (-773.797) (-775.688) -- 0:00:50
      164500 -- (-774.051) (-775.426) (-774.880) [-776.098] * (-773.901) (-772.219) [-772.297] (-772.987) -- 0:00:50
      165000 -- [-774.315] (-773.333) (-773.393) (-774.183) * [-773.243] (-772.874) (-778.531) (-772.903) -- 0:00:50

      Average standard deviation of split frequencies: 0.019210

      165500 -- [-777.720] (-772.757) (-772.328) (-774.794) * [-774.159] (-775.626) (-775.274) (-773.034) -- 0:00:55
      166000 -- (-774.978) (-774.280) (-775.544) [-772.099] * [-774.822] (-771.810) (-778.691) (-774.712) -- 0:00:55
      166500 -- (-773.716) (-771.904) (-774.318) [-773.334] * (-774.512) [-774.368] (-781.740) (-773.723) -- 0:00:55
      167000 -- (-773.328) [-773.438] (-772.473) (-773.482) * [-773.391] (-775.587) (-775.459) (-772.560) -- 0:00:54
      167500 -- (-774.834) [-773.377] (-775.545) (-772.112) * (-773.552) (-773.423) (-778.411) [-772.867] -- 0:00:54
      168000 -- (-775.786) [-772.276] (-773.710) (-772.233) * (-773.376) (-774.471) (-775.399) [-771.518] -- 0:00:54
      168500 -- (-776.260) (-772.847) [-774.083] (-772.828) * (-771.863) (-778.575) [-775.038] (-771.928) -- 0:00:54
      169000 -- (-774.326) [-774.015] (-774.762) (-774.097) * (-772.444) [-774.518] (-776.883) (-774.833) -- 0:00:54
      169500 -- (-775.325) [-773.617] (-778.992) (-777.895) * [-773.909] (-777.754) (-777.417) (-773.115) -- 0:00:53
      170000 -- (-776.897) [-772.307] (-774.819) (-777.256) * [-774.916] (-772.617) (-772.323) (-773.217) -- 0:00:53

      Average standard deviation of split frequencies: 0.018035

      170500 -- [-773.893] (-772.707) (-774.691) (-772.685) * [-772.685] (-774.518) (-772.146) (-777.231) -- 0:00:53
      171000 -- (-775.672) (-772.697) (-773.506) [-771.980] * [-773.044] (-773.685) (-773.515) (-775.173) -- 0:00:53
      171500 -- [-777.280] (-772.371) (-774.626) (-773.010) * (-773.432) [-772.196] (-775.396) (-774.531) -- 0:00:53
      172000 -- (-772.071) (-775.842) (-772.727) [-772.060] * (-772.137) [-771.654] (-774.159) (-777.055) -- 0:00:52
      172500 -- [-772.422] (-776.912) (-772.364) (-773.414) * (-777.713) [-773.060] (-772.221) (-774.288) -- 0:00:52
      173000 -- [-773.243] (-774.732) (-775.462) (-772.151) * (-773.541) [-774.476] (-777.697) (-773.911) -- 0:00:52
      173500 -- (-772.893) [-774.053] (-772.833) (-774.514) * (-771.589) [-775.302] (-778.531) (-773.713) -- 0:00:52
      174000 -- (-774.829) (-772.728) [-773.897] (-775.894) * (-772.263) [-772.999] (-771.967) (-774.405) -- 0:00:52
      174500 -- [-776.440] (-773.425) (-774.473) (-775.893) * (-773.053) (-771.997) [-774.131] (-772.346) -- 0:00:52
      175000 -- (-777.402) (-772.817) [-772.073] (-774.063) * (-774.467) [-772.792] (-775.424) (-774.315) -- 0:00:51

      Average standard deviation of split frequencies: 0.017489

      175500 -- (-771.788) [-775.913] (-777.079) (-777.730) * (-775.587) (-777.184) [-775.585] (-775.138) -- 0:00:51
      176000 -- (-771.566) (-774.821) (-772.797) [-772.827] * (-782.892) (-773.501) [-775.033] (-777.597) -- 0:00:51
      176500 -- (-771.567) (-773.697) (-772.555) [-771.959] * (-774.004) [-773.943] (-773.911) (-776.951) -- 0:00:51
      177000 -- (-774.198) (-773.506) [-776.228] (-773.697) * (-775.505) (-777.531) [-773.870] (-773.141) -- 0:00:51
      177500 -- (-774.459) (-774.744) (-772.467) [-772.703] * (-778.256) (-774.412) (-774.195) [-772.465] -- 0:00:50
      178000 -- (-777.224) [-774.747] (-772.643) (-774.476) * (-772.407) (-776.170) [-774.597] (-773.089) -- 0:00:50
      178500 -- (-776.945) (-774.017) (-774.627) [-773.744] * (-774.507) (-774.917) (-772.866) [-772.974] -- 0:00:50
      179000 -- (-776.152) [-773.631] (-775.189) (-774.338) * (-772.283) (-775.623) [-772.997] (-774.967) -- 0:00:50
      179500 -- (-772.637) (-774.465) [-773.434] (-771.990) * (-773.069) (-774.092) [-772.008] (-777.232) -- 0:00:50
      180000 -- (-772.990) (-773.810) (-773.211) [-773.867] * [-773.896] (-774.850) (-773.566) (-779.997) -- 0:00:50

      Average standard deviation of split frequencies: 0.015329

      180500 -- (-774.452) (-773.137) [-777.376] (-772.459) * (-774.116) (-775.790) [-771.539] (-774.735) -- 0:00:49
      181000 -- (-772.201) (-772.591) [-774.968] (-773.051) * (-773.268) (-774.645) (-773.351) [-774.212] -- 0:00:49
      181500 -- (-775.467) [-773.085] (-772.711) (-774.267) * (-774.752) [-773.044] (-779.142) (-776.693) -- 0:00:49
      182000 -- [-772.470] (-773.732) (-773.331) (-775.678) * [-772.936] (-772.954) (-775.319) (-771.901) -- 0:00:53
      182500 -- (-773.327) (-773.003) (-780.902) [-777.951] * (-772.724) [-771.564] (-773.309) (-773.380) -- 0:00:53
      183000 -- (-775.144) [-772.248] (-779.570) (-778.302) * (-772.008) (-775.172) [-774.563] (-774.595) -- 0:00:53
      183500 -- (-774.707) [-773.341] (-774.367) (-775.936) * (-771.330) (-773.807) (-773.229) [-773.500] -- 0:00:53
      184000 -- [-774.310] (-773.776) (-773.880) (-773.273) * [-772.240] (-774.815) (-774.591) (-773.050) -- 0:00:53
      184500 -- (-774.255) (-776.754) (-771.940) [-771.942] * (-774.852) (-773.841) (-775.805) [-773.842] -- 0:00:53
      185000 -- [-774.629] (-772.997) (-776.077) (-772.730) * (-775.120) (-774.478) [-775.663] (-773.493) -- 0:00:52

      Average standard deviation of split frequencies: 0.014610

      185500 -- (-773.834) [-772.933] (-779.341) (-774.179) * (-773.568) (-773.618) (-773.835) [-773.370] -- 0:00:52
      186000 -- (-773.322) (-773.396) (-773.800) [-773.439] * (-773.187) [-775.734] (-771.813) (-772.538) -- 0:00:52
      186500 -- (-776.036) (-773.804) [-771.821] (-775.091) * (-772.888) (-773.233) [-772.472] (-772.789) -- 0:00:52
      187000 -- (-773.038) [-773.820] (-771.521) (-775.522) * [-772.272] (-773.726) (-775.733) (-774.822) -- 0:00:52
      187500 -- (-772.702) (-775.606) [-773.523] (-773.885) * (-774.244) (-773.750) (-772.899) [-776.429] -- 0:00:52
      188000 -- (-772.987) (-777.350) [-774.544] (-774.569) * [-772.059] (-773.075) (-774.493) (-776.337) -- 0:00:51
      188500 -- (-774.578) (-772.275) (-774.148) [-774.936] * (-772.342) (-772.346) [-772.953] (-777.051) -- 0:00:51
      189000 -- [-776.999] (-772.854) (-774.036) (-772.376) * (-776.269) [-773.132] (-772.628) (-774.986) -- 0:00:51
      189500 -- [-774.693] (-772.315) (-775.490) (-772.447) * (-771.960) [-772.311] (-774.951) (-776.940) -- 0:00:51
      190000 -- (-775.296) (-773.626) [-773.049] (-774.297) * (-775.217) [-772.630] (-775.231) (-776.311) -- 0:00:51

      Average standard deviation of split frequencies: 0.014680

      190500 -- [-772.937] (-776.814) (-775.838) (-774.201) * (-774.890) [-774.086] (-774.203) (-772.623) -- 0:00:50
      191000 -- (-773.089) (-772.733) (-774.391) [-772.148] * (-780.224) (-773.910) [-775.310] (-774.714) -- 0:00:50
      191500 -- (-773.157) [-771.839] (-777.848) (-777.443) * (-774.748) (-775.018) [-773.418] (-774.931) -- 0:00:50
      192000 -- [-779.214] (-771.752) (-774.397) (-773.281) * (-775.791) (-774.317) (-774.296) [-776.527] -- 0:00:50
      192500 -- [-773.403] (-772.588) (-777.820) (-774.624) * (-775.020) (-774.838) [-773.301] (-772.919) -- 0:00:50
      193000 -- (-775.153) [-774.268] (-779.077) (-772.345) * [-775.692] (-773.813) (-773.186) (-783.659) -- 0:00:50
      193500 -- (-779.646) (-773.406) (-773.335) [-773.258] * (-773.281) [-771.409] (-774.877) (-775.145) -- 0:00:50
      194000 -- (-775.308) (-773.770) [-774.260] (-772.505) * (-772.839) (-772.086) (-774.860) [-772.799] -- 0:00:49
      194500 -- (-773.216) (-774.750) (-773.245) [-772.701] * (-773.260) (-771.608) (-773.924) [-773.068] -- 0:00:49
      195000 -- (-772.234) (-772.534) [-777.985] (-771.792) * (-772.328) (-774.958) [-771.999] (-774.087) -- 0:00:49

      Average standard deviation of split frequencies: 0.015483

      195500 -- [-772.657] (-771.906) (-775.888) (-775.440) * [-774.444] (-774.622) (-771.968) (-773.036) -- 0:00:49
      196000 -- (-774.625) [-772.136] (-772.913) (-777.226) * (-774.500) (-772.334) (-774.133) [-776.524] -- 0:00:49
      196500 -- (-772.619) [-773.606] (-771.396) (-777.811) * (-774.081) [-773.519] (-775.292) (-773.751) -- 0:00:49
      197000 -- (-773.878) (-774.563) (-773.445) [-771.849] * (-783.048) (-773.734) (-775.664) [-774.070] -- 0:00:52
      197500 -- (-774.485) (-774.480) (-773.441) [-771.715] * (-782.470) (-772.134) (-775.609) [-773.177] -- 0:00:52
      198000 -- [-772.973] (-772.204) (-772.540) (-772.956) * (-777.362) (-772.153) [-772.227] (-772.058) -- 0:00:52
      198500 -- (-779.159) [-774.073] (-773.330) (-774.262) * [-772.890] (-773.217) (-773.115) (-773.077) -- 0:00:52
      199000 -- (-774.669) (-772.102) [-774.635] (-773.643) * [-773.262] (-773.418) (-777.138) (-774.260) -- 0:00:52
      199500 -- (-773.010) [-771.610] (-774.038) (-775.974) * [-774.439] (-773.873) (-773.182) (-774.862) -- 0:00:52
      200000 -- (-772.832) [-772.995] (-772.670) (-775.296) * [-774.569] (-774.662) (-773.952) (-776.344) -- 0:00:51

      Average standard deviation of split frequencies: 0.013508

      200500 -- (-771.574) (-772.609) (-775.333) [-776.129] * [-774.070] (-772.333) (-778.977) (-772.753) -- 0:00:51
      201000 -- (-774.376) (-772.152) [-775.774] (-774.832) * (-774.370) (-773.549) (-772.953) [-773.658] -- 0:00:51
      201500 -- (-780.172) [-771.631] (-774.810) (-772.900) * (-773.475) (-773.390) (-775.686) [-774.106] -- 0:00:51
      202000 -- (-776.482) (-771.795) [-775.478] (-771.780) * (-773.009) (-773.663) [-772.571] (-778.725) -- 0:00:51
      202500 -- (-777.749) [-773.307] (-772.370) (-771.741) * (-773.462) [-772.084] (-773.008) (-773.890) -- 0:00:51
      203000 -- (-778.761) (-773.295) [-773.940] (-774.252) * [-772.840] (-772.065) (-772.106) (-774.551) -- 0:00:51
      203500 -- (-776.041) (-771.922) [-771.921] (-772.449) * (-773.605) [-772.152] (-775.484) (-778.428) -- 0:00:50
      204000 -- (-776.490) [-772.468] (-777.608) (-772.129) * [-772.752] (-771.775) (-774.234) (-776.606) -- 0:00:50
      204500 -- (-774.599) (-776.390) (-775.227) [-774.763] * (-775.279) (-774.990) [-774.136] (-773.716) -- 0:00:50
      205000 -- (-774.485) (-773.276) (-775.598) [-774.275] * (-772.308) (-773.283) [-775.951] (-772.493) -- 0:00:50

      Average standard deviation of split frequencies: 0.013158

      205500 -- (-773.516) (-772.935) [-774.309] (-771.828) * (-772.058) (-772.553) [-772.420] (-771.639) -- 0:00:50
      206000 -- [-773.526] (-774.286) (-775.069) (-773.958) * (-773.198) (-772.402) (-778.854) [-773.823] -- 0:00:50
      206500 -- (-774.600) (-773.266) [-775.835] (-779.125) * (-772.099) [-775.282] (-773.317) (-775.874) -- 0:00:49
      207000 -- (-774.244) (-776.326) (-779.480) [-775.777] * [-772.752] (-774.496) (-772.599) (-772.312) -- 0:00:49
      207500 -- (-774.040) (-774.033) (-774.476) [-776.902] * (-773.827) (-775.462) (-772.723) [-775.025] -- 0:00:49
      208000 -- (-773.140) [-775.060] (-775.824) (-776.180) * (-771.580) [-773.593] (-773.811) (-772.843) -- 0:00:49
      208500 -- (-775.798) [-774.824] (-773.211) (-772.344) * (-773.147) (-774.498) (-776.961) [-772.991] -- 0:00:49
      209000 -- (-777.108) (-773.901) [-772.357] (-777.719) * (-772.649) (-774.621) (-775.208) [-771.720] -- 0:00:49
      209500 -- (-778.251) (-773.443) [-773.222] (-775.463) * (-775.000) (-776.177) (-775.339) [-773.139] -- 0:00:49
      210000 -- (-772.766) (-774.911) (-774.946) [-776.303] * (-774.901) (-773.897) (-773.870) [-771.917] -- 0:00:48

      Average standard deviation of split frequencies: 0.013007

      210500 -- [-772.447] (-773.131) (-772.452) (-771.750) * (-780.055) (-774.134) (-774.108) [-773.926] -- 0:00:48
      211000 -- [-772.545] (-772.084) (-772.003) (-774.207) * (-773.608) (-773.698) [-772.729] (-777.270) -- 0:00:48
      211500 -- (-774.570) (-774.082) (-775.558) [-773.320] * (-771.944) (-773.144) [-773.658] (-776.859) -- 0:00:48
      212000 -- (-775.605) (-774.310) (-773.486) [-773.448] * (-775.915) [-776.163] (-777.287) (-775.278) -- 0:00:48
      212500 -- (-777.564) (-774.991) (-771.761) [-772.040] * (-777.093) (-773.254) [-774.628] (-774.530) -- 0:00:51
      213000 -- (-772.258) [-772.818] (-772.950) (-772.438) * (-775.150) [-772.931] (-775.194) (-779.077) -- 0:00:51
      213500 -- (-776.784) [-771.713] (-772.988) (-773.085) * (-776.522) [-772.665] (-772.629) (-772.968) -- 0:00:51
      214000 -- (-772.889) [-772.274] (-774.581) (-780.511) * [-776.418] (-772.274) (-776.419) (-773.511) -- 0:00:51
      214500 -- (-773.142) (-773.151) (-774.055) [-774.789] * (-773.094) (-777.677) [-775.903] (-775.007) -- 0:00:51
      215000 -- [-776.032] (-776.043) (-774.433) (-776.092) * [-773.946] (-776.352) (-773.643) (-772.634) -- 0:00:51

      Average standard deviation of split frequencies: 0.011731

      215500 -- (-772.476) (-782.354) (-773.723) [-779.532] * (-776.837) (-775.617) (-772.461) [-775.318] -- 0:00:50
      216000 -- [-772.617] (-775.321) (-775.405) (-772.023) * (-773.130) (-773.494) (-772.013) [-775.841] -- 0:00:50
      216500 -- (-772.175) [-773.458] (-775.213) (-772.838) * (-771.458) (-774.980) [-774.810] (-776.937) -- 0:00:50
      217000 -- (-773.730) [-772.192] (-773.492) (-772.691) * (-775.353) (-774.916) [-772.250] (-773.974) -- 0:00:50
      217500 -- (-776.523) [-772.782] (-773.857) (-773.229) * (-778.216) [-773.691] (-774.027) (-779.679) -- 0:00:50
      218000 -- [-774.874] (-774.749) (-776.110) (-775.726) * (-774.472) [-772.922] (-772.144) (-778.466) -- 0:00:50
      218500 -- (-773.601) (-776.817) [-774.657] (-773.862) * (-773.633) [-772.212] (-774.589) (-773.066) -- 0:00:50
      219000 -- [-777.660] (-776.749) (-774.580) (-773.994) * [-772.500] (-771.991) (-772.455) (-774.113) -- 0:00:49
      219500 -- (-773.786) [-773.165] (-772.764) (-774.949) * [-771.474] (-773.736) (-772.980) (-774.784) -- 0:00:49
      220000 -- (-774.859) [-773.804] (-774.059) (-773.949) * (-773.492) (-775.104) [-771.967] (-774.993) -- 0:00:49

      Average standard deviation of split frequencies: 0.011251

      220500 -- (-775.092) [-773.997] (-772.609) (-775.968) * (-772.443) (-773.468) (-774.753) [-773.013] -- 0:00:49
      221000 -- (-772.535) (-773.856) [-774.453] (-774.797) * (-773.275) [-774.953] (-773.890) (-772.237) -- 0:00:49
      221500 -- (-776.275) (-773.207) (-774.376) [-773.271] * (-772.453) (-774.648) (-772.929) [-779.345] -- 0:00:49
      222000 -- (-773.197) [-773.347] (-775.756) (-774.885) * (-772.489) (-772.191) [-774.069] (-771.892) -- 0:00:49
      222500 -- [-773.347] (-773.745) (-773.141) (-775.977) * (-773.463) (-772.098) [-776.178] (-772.670) -- 0:00:48
      223000 -- (-777.002) (-773.309) [-772.880] (-775.365) * (-772.332) (-772.235) [-771.818] (-771.635) -- 0:00:48
      223500 -- (-774.417) (-776.537) (-772.880) [-773.910] * (-773.930) [-772.588] (-771.773) (-775.825) -- 0:00:48
      224000 -- (-775.775) (-773.092) [-776.678] (-772.374) * (-773.881) (-772.903) [-771.805] (-774.051) -- 0:00:48
      224500 -- [-771.996] (-780.430) (-777.208) (-774.403) * (-772.088) (-775.207) [-772.972] (-774.040) -- 0:00:48
      225000 -- (-771.956) [-774.617] (-775.005) (-773.412) * (-772.635) (-774.969) (-773.418) [-773.975] -- 0:00:48

      Average standard deviation of split frequencies: 0.012761

      225500 -- [-773.415] (-775.162) (-773.135) (-776.526) * (-771.976) (-774.410) (-773.440) [-773.732] -- 0:00:48
      226000 -- (-774.216) (-773.008) [-772.267] (-774.765) * (-775.207) (-771.689) [-773.760] (-776.753) -- 0:00:47
      226500 -- (-776.539) [-776.118] (-774.327) (-773.081) * (-772.499) [-772.955] (-773.194) (-772.314) -- 0:00:47
      227000 -- (-778.554) (-772.486) [-773.234] (-773.780) * (-773.459) (-772.036) [-773.946] (-773.488) -- 0:00:47
      227500 -- (-778.250) (-775.925) (-772.538) [-773.186] * [-773.902] (-774.580) (-776.049) (-772.339) -- 0:00:47
      228000 -- [-773.703] (-772.224) (-772.791) (-776.743) * (-772.566) [-771.857] (-776.466) (-772.156) -- 0:00:47
      228500 -- (-773.591) (-774.307) [-772.390] (-778.716) * (-773.685) (-776.339) [-774.492] (-777.455) -- 0:00:47
      229000 -- (-773.879) (-773.183) [-772.555] (-776.401) * [-772.961] (-773.225) (-774.665) (-777.424) -- 0:00:50
      229500 -- [-774.722] (-773.438) (-774.853) (-775.958) * (-772.965) (-773.235) (-773.113) [-774.974] -- 0:00:50
      230000 -- (-774.208) (-775.073) (-772.069) [-776.876] * (-774.245) (-772.284) [-772.931] (-774.263) -- 0:00:50

      Average standard deviation of split frequencies: 0.012645

      230500 -- (-775.091) (-776.018) [-772.070] (-775.738) * (-772.580) (-771.990) [-773.580] (-774.264) -- 0:00:50
      231000 -- (-773.517) [-772.398] (-772.797) (-780.339) * [-772.357] (-771.991) (-773.885) (-775.148) -- 0:00:49
      231500 -- (-772.358) (-772.965) [-772.277] (-776.495) * (-775.205) [-773.741] (-774.494) (-774.300) -- 0:00:49
      232000 -- (-772.170) (-773.507) (-771.881) [-778.294] * (-776.126) [-775.049] (-773.578) (-779.916) -- 0:00:49
      232500 -- (-772.343) (-775.227) (-775.290) [-773.065] * (-772.118) (-773.946) [-774.232] (-781.026) -- 0:00:49
      233000 -- (-772.752) (-773.190) [-776.664] (-778.028) * (-775.534) [-772.529] (-772.418) (-774.313) -- 0:00:49
      233500 -- (-775.286) (-773.520) (-775.104) [-773.368] * (-774.164) (-773.617) [-773.645] (-772.409) -- 0:00:49
      234000 -- (-773.440) (-774.973) [-777.327] (-774.543) * (-774.368) (-775.028) (-772.133) [-772.423] -- 0:00:49
      234500 -- (-772.236) [-777.488] (-774.846) (-772.149) * [-774.251] (-774.665) (-773.064) (-775.483) -- 0:00:48
      235000 -- (-772.821) (-774.260) [-773.608] (-774.239) * (-773.560) (-774.934) [-773.140] (-773.064) -- 0:00:48

      Average standard deviation of split frequencies: 0.013716

      235500 -- (-773.728) (-772.898) [-772.170] (-775.141) * (-772.258) (-774.417) (-775.169) [-776.231] -- 0:00:48
      236000 -- [-772.855] (-774.005) (-774.597) (-772.524) * [-773.494] (-774.410) (-774.228) (-772.547) -- 0:00:48
      236500 -- (-777.024) (-772.500) (-778.489) [-773.088] * [-774.867] (-776.325) (-778.478) (-772.080) -- 0:00:48
      237000 -- (-772.653) (-774.374) (-775.453) [-774.542] * [-774.510] (-773.341) (-774.821) (-773.779) -- 0:00:48
      237500 -- (-776.554) (-774.003) (-774.996) [-775.974] * (-771.995) [-773.057] (-773.712) (-774.532) -- 0:00:48
      238000 -- (-773.245) (-774.271) (-774.074) [-774.222] * [-773.789] (-772.194) (-775.423) (-773.165) -- 0:00:48
      238500 -- (-772.921) (-773.163) (-773.102) [-774.824] * [-774.372] (-774.095) (-777.473) (-772.830) -- 0:00:47
      239000 -- [-774.096] (-773.124) (-772.787) (-772.848) * (-775.417) [-773.546] (-775.415) (-775.177) -- 0:00:47
      239500 -- (-776.161) (-773.962) [-772.536] (-773.241) * (-773.331) [-777.373] (-783.697) (-772.762) -- 0:00:47
      240000 -- [-775.580] (-771.965) (-772.480) (-775.069) * (-774.335) [-772.170] (-780.712) (-773.870) -- 0:00:47

      Average standard deviation of split frequencies: 0.013450

      240500 -- (-774.040) (-774.777) [-775.269] (-774.367) * [-772.625] (-773.047) (-776.558) (-773.776) -- 0:00:47
      241000 -- (-773.971) (-776.182) [-775.655] (-774.831) * (-774.145) (-772.556) (-775.926) [-775.322] -- 0:00:47
      241500 -- (-772.180) (-783.549) [-771.817] (-775.323) * (-773.683) [-772.522] (-773.960) (-771.691) -- 0:00:47
      242000 -- (-773.081) [-772.479] (-774.783) (-772.619) * (-775.685) [-773.838] (-775.028) (-773.437) -- 0:00:46
      242500 -- (-772.538) (-772.226) (-775.370) [-775.192] * (-773.093) (-775.863) [-771.373] (-773.541) -- 0:00:46
      243000 -- (-772.389) (-773.240) [-776.893] (-771.755) * (-772.130) [-773.424] (-771.512) (-773.505) -- 0:00:46
      243500 -- (-773.097) (-772.290) [-773.064] (-771.810) * (-776.079) (-772.791) [-771.914] (-773.610) -- 0:00:46
      244000 -- [-772.520] (-773.224) (-774.232) (-772.656) * [-773.238] (-773.303) (-774.234) (-775.951) -- 0:00:46
      244500 -- [-771.629] (-771.880) (-773.279) (-778.179) * (-776.010) [-773.050] (-776.531) (-777.377) -- 0:00:46
      245000 -- (-773.914) (-773.561) [-779.294] (-773.365) * [-772.585] (-772.330) (-773.965) (-775.903) -- 0:00:46

      Average standard deviation of split frequencies: 0.013893

      245500 -- (-777.198) (-772.891) [-772.405] (-775.136) * (-773.871) [-773.196] (-781.416) (-775.579) -- 0:00:49
      246000 -- (-777.836) [-771.988] (-772.605) (-773.600) * (-772.201) [-774.575] (-777.235) (-775.255) -- 0:00:49
      246500 -- [-775.498] (-772.087) (-774.497) (-773.666) * (-772.916) (-773.579) (-778.965) [-772.907] -- 0:00:48
      247000 -- [-776.453] (-774.294) (-774.046) (-772.248) * [-771.954] (-773.191) (-777.196) (-773.294) -- 0:00:48
      247500 -- (-776.601) [-773.167] (-773.621) (-773.328) * (-771.864) (-774.810) (-772.261) [-773.123] -- 0:00:48
      248000 -- (-780.473) (-772.344) (-774.472) [-773.442] * (-775.180) [-774.748] (-774.429) (-773.521) -- 0:00:48
      248500 -- (-778.880) (-771.434) [-773.139] (-773.583) * (-776.456) (-776.337) [-771.560] (-773.703) -- 0:00:48
      249000 -- (-773.234) [-775.797] (-775.572) (-775.573) * [-772.895] (-773.332) (-773.115) (-773.108) -- 0:00:48
      249500 -- [-774.952] (-772.097) (-773.100) (-776.508) * (-771.699) (-775.759) [-773.743] (-772.261) -- 0:00:48
      250000 -- (-782.049) (-772.051) (-772.538) [-773.776] * (-775.490) (-773.583) (-774.029) [-772.759] -- 0:00:48

      Average standard deviation of split frequencies: 0.013290

      250500 -- (-776.645) (-776.352) [-772.000] (-775.764) * (-774.859) (-778.433) [-774.247] (-775.569) -- 0:00:47
      251000 -- (-776.842) (-772.314) (-774.137) [-775.035] * [-775.082] (-773.567) (-774.252) (-774.277) -- 0:00:47
      251500 -- (-774.554) (-772.370) (-779.942) [-771.683] * (-772.192) (-775.367) [-775.223] (-774.932) -- 0:00:47
      252000 -- (-775.348) (-773.737) (-774.998) [-771.898] * (-771.890) (-773.225) (-774.964) [-774.205] -- 0:00:47
      252500 -- (-773.507) (-774.208) (-774.273) [-772.373] * (-773.069) [-772.901] (-772.257) (-776.332) -- 0:00:47
      253000 -- [-772.064] (-774.060) (-775.458) (-772.933) * [-772.147] (-773.777) (-772.354) (-773.915) -- 0:00:47
      253500 -- (-772.760) [-774.612] (-775.321) (-774.990) * (-778.520) [-773.507] (-773.468) (-777.631) -- 0:00:47
      254000 -- (-777.291) (-772.967) [-773.821] (-775.386) * (-777.571) [-773.291] (-776.564) (-774.580) -- 0:00:46
      254500 -- (-778.057) (-772.723) (-773.110) [-774.034] * (-775.205) [-771.819] (-773.903) (-776.915) -- 0:00:46
      255000 -- (-776.245) (-777.327) (-772.864) [-773.485] * [-773.462] (-771.645) (-775.973) (-777.802) -- 0:00:46

      Average standard deviation of split frequencies: 0.013749

      255500 -- (-774.200) (-774.846) [-775.296] (-773.413) * [-772.256] (-771.998) (-772.999) (-776.950) -- 0:00:46
      256000 -- (-773.770) (-777.666) (-772.668) [-772.849] * (-776.236) [-773.702] (-778.244) (-778.113) -- 0:00:46
      256500 -- (-773.243) [-776.156] (-773.843) (-772.976) * (-772.174) (-772.558) [-777.321] (-774.426) -- 0:00:46
      257000 -- (-773.175) (-773.843) (-773.813) [-772.255] * (-772.202) (-773.342) [-772.504] (-774.543) -- 0:00:46
      257500 -- (-771.562) [-777.019] (-772.357) (-773.565) * [-771.999] (-773.150) (-772.433) (-776.016) -- 0:00:46
      258000 -- (-772.358) (-777.791) (-773.310) [-771.979] * (-773.631) (-777.000) [-771.618] (-773.192) -- 0:00:46
      258500 -- [-776.230] (-772.607) (-773.047) (-772.558) * (-774.417) [-771.655] (-771.634) (-774.378) -- 0:00:45
      259000 -- (-777.054) (-772.421) [-771.484] (-771.691) * [-773.175] (-773.857) (-774.796) (-776.276) -- 0:00:45
      259500 -- (-773.680) (-774.911) (-774.961) [-775.007] * (-774.888) (-773.291) (-773.168) [-772.597] -- 0:00:45
      260000 -- (-775.050) [-774.329] (-775.823) (-774.000) * (-774.879) (-773.740) [-772.742] (-772.213) -- 0:00:45

      Average standard deviation of split frequencies: 0.013021

      260500 -- (-778.558) (-774.094) [-774.190] (-772.892) * (-774.731) (-774.115) (-776.132) [-772.542] -- 0:00:45
      261000 -- (-776.823) [-772.786] (-772.873) (-771.815) * (-776.635) (-772.800) [-772.589] (-772.452) -- 0:00:45
      261500 -- [-773.786] (-776.536) (-773.483) (-777.090) * (-773.151) [-772.129] (-776.302) (-786.530) -- 0:00:45
      262000 -- (-773.150) (-775.554) (-775.946) [-774.909] * (-774.256) [-772.182] (-773.517) (-776.677) -- 0:00:47
      262500 -- (-774.428) [-773.943] (-774.843) (-773.617) * (-774.227) (-774.538) [-775.154] (-773.113) -- 0:00:47
      263000 -- (-773.745) (-776.485) (-776.740) [-774.054] * [-773.418] (-773.658) (-772.198) (-775.018) -- 0:00:47
      263500 -- (-773.230) [-777.428] (-779.048) (-775.670) * (-777.452) (-772.782) (-774.382) [-773.595] -- 0:00:47
      264000 -- (-778.531) [-774.497] (-774.838) (-773.644) * (-772.517) (-775.510) [-777.131] (-774.515) -- 0:00:47
      264500 -- [-776.084] (-775.239) (-774.787) (-771.756) * (-774.151) (-773.948) [-779.863] (-772.311) -- 0:00:47
      265000 -- (-776.374) [-776.091] (-780.077) (-773.136) * (-773.237) (-773.758) [-773.734] (-772.317) -- 0:00:47

      Average standard deviation of split frequencies: 0.013291

      265500 -- (-778.708) [-773.671] (-778.683) (-773.410) * (-773.243) (-771.945) (-773.918) [-777.676] -- 0:00:47
      266000 -- (-773.186) (-773.483) (-774.080) [-772.691] * (-771.760) (-773.396) [-772.129] (-775.091) -- 0:00:46
      266500 -- [-773.346] (-774.155) (-773.105) (-773.230) * (-773.180) (-777.405) [-772.648] (-780.107) -- 0:00:46
      267000 -- (-773.119) [-771.831] (-773.580) (-772.772) * [-774.686] (-772.215) (-771.696) (-773.355) -- 0:00:46
      267500 -- (-774.259) [-773.939] (-771.870) (-775.299) * (-772.821) [-773.218] (-772.969) (-772.216) -- 0:00:46
      268000 -- (-773.995) [-773.144] (-774.101) (-773.604) * [-772.228] (-774.286) (-774.826) (-771.611) -- 0:00:46
      268500 -- (-775.731) [-772.356] (-774.071) (-773.972) * (-774.113) [-772.184] (-776.483) (-772.595) -- 0:00:46
      269000 -- (-772.934) [-773.420] (-774.185) (-772.724) * [-772.859] (-771.736) (-775.059) (-774.720) -- 0:00:46
      269500 -- (-771.820) [-772.596] (-774.203) (-775.060) * (-780.261) (-771.776) (-773.549) [-775.136] -- 0:00:46
      270000 -- (-774.294) [-773.323] (-776.235) (-777.247) * (-780.032) [-772.564] (-773.247) (-775.266) -- 0:00:45

      Average standard deviation of split frequencies: 0.012909

      270500 -- (-773.454) (-774.101) (-777.806) [-773.765] * (-774.548) (-771.791) [-773.804] (-772.749) -- 0:00:45
      271000 -- (-772.472) (-773.144) [-777.392] (-773.296) * (-773.394) (-772.300) [-773.309] (-773.679) -- 0:00:45
      271500 -- (-774.017) (-774.622) (-774.732) [-774.640] * [-773.715] (-771.568) (-773.377) (-774.764) -- 0:00:45
      272000 -- (-774.377) (-774.360) (-776.865) [-772.747] * (-779.172) (-772.111) [-772.370] (-774.803) -- 0:00:45
      272500 -- (-773.401) (-774.297) (-773.474) [-772.812] * (-777.411) [-772.827] (-771.752) (-774.506) -- 0:00:45
      273000 -- [-777.301] (-773.154) (-775.162) (-773.095) * (-773.272) (-774.070) [-773.348] (-772.186) -- 0:00:45
      273500 -- (-774.024) (-774.955) [-776.610] (-775.326) * (-774.062) [-772.081] (-772.703) (-774.999) -- 0:00:45
      274000 -- (-774.310) (-772.903) [-771.730] (-775.498) * (-772.115) (-772.238) (-774.483) [-775.389] -- 0:00:45
      274500 -- (-772.211) [-772.055] (-778.531) (-774.056) * (-773.352) (-771.850) (-772.082) [-774.917] -- 0:00:44
      275000 -- (-775.376) [-773.588] (-773.342) (-773.510) * (-773.331) (-774.018) (-774.311) [-774.035] -- 0:00:44

      Average standard deviation of split frequencies: 0.012917

      275500 -- (-774.255) (-773.714) (-777.710) [-772.622] * (-774.587) (-776.345) (-777.940) [-775.463] -- 0:00:44
      276000 -- (-775.568) (-776.496) [-773.088] (-774.149) * (-773.433) (-775.334) (-772.460) [-772.263] -- 0:00:44
      276500 -- [-774.662] (-775.502) (-774.062) (-775.264) * (-774.220) (-775.471) [-771.985] (-775.021) -- 0:00:44
      277000 -- [-773.080] (-774.773) (-775.928) (-774.416) * (-774.701) (-775.630) (-774.692) [-774.274] -- 0:00:44
      277500 -- (-775.481) (-773.575) [-775.483] (-772.786) * (-772.985) (-779.757) (-775.979) [-775.147] -- 0:00:44
      278000 -- (-773.543) (-774.673) [-774.212] (-773.570) * [-772.768] (-772.274) (-772.148) (-775.044) -- 0:00:44
      278500 -- [-774.130] (-772.891) (-772.594) (-776.170) * (-775.287) [-773.086] (-780.531) (-775.550) -- 0:00:44
      279000 -- (-774.456) (-775.021) (-772.648) [-772.977] * (-772.005) [-772.809] (-773.812) (-772.562) -- 0:00:46
      279500 -- (-773.507) (-774.961) [-777.031] (-774.488) * [-776.956] (-773.735) (-775.666) (-776.725) -- 0:00:46
      280000 -- (-772.921) (-773.552) (-773.619) [-775.205] * [-773.572] (-774.982) (-773.177) (-773.985) -- 0:00:46

      Average standard deviation of split frequencies: 0.012282

      280500 -- (-773.158) [-775.593] (-772.198) (-773.302) * (-775.706) (-774.045) [-772.028] (-774.106) -- 0:00:46
      281000 -- (-771.571) (-776.171) [-773.333] (-775.766) * [-771.941] (-773.725) (-773.587) (-774.105) -- 0:00:46
      281500 -- [-773.687] (-776.664) (-774.618) (-775.563) * (-774.492) [-774.614] (-773.326) (-772.188) -- 0:00:45
      282000 -- (-774.884) (-776.035) (-774.018) [-774.871] * (-773.860) [-777.952] (-773.900) (-773.658) -- 0:00:45
      282500 -- (-773.434) [-773.423] (-773.566) (-772.361) * (-774.438) (-772.595) [-774.608] (-772.851) -- 0:00:45
      283000 -- (-773.666) (-772.190) [-776.549] (-775.996) * (-771.754) (-771.761) [-775.728] (-773.930) -- 0:00:45
      283500 -- (-771.620) [-772.264] (-772.449) (-773.460) * (-772.655) (-771.802) [-772.481] (-775.073) -- 0:00:45
      284000 -- (-775.011) [-774.701] (-774.791) (-778.292) * (-773.381) [-774.431] (-774.340) (-773.449) -- 0:00:45
      284500 -- (-773.735) (-777.745) (-772.099) [-772.183] * (-774.440) [-772.696] (-772.040) (-773.397) -- 0:00:45
      285000 -- (-772.644) [-772.057] (-774.740) (-774.275) * (-774.166) (-771.851) (-773.432) [-774.228] -- 0:00:45

      Average standard deviation of split frequencies: 0.011080

      285500 -- (-772.101) [-772.106] (-771.825) (-773.066) * (-774.000) (-772.103) (-775.256) [-773.483] -- 0:00:45
      286000 -- (-772.531) [-776.407] (-772.165) (-773.853) * [-774.110] (-771.430) (-772.410) (-773.005) -- 0:00:44
      286500 -- (-771.953) [-777.138] (-774.592) (-773.215) * [-775.065] (-773.512) (-771.826) (-773.149) -- 0:00:44
      287000 -- (-775.127) (-774.469) [-773.668] (-781.902) * (-772.358) [-772.748] (-777.894) (-775.319) -- 0:00:44
      287500 -- (-777.547) (-775.004) [-773.643] (-773.972) * (-776.279) (-773.199) (-776.835) [-774.134] -- 0:00:44
      288000 -- (-772.150) [-772.528] (-772.025) (-774.721) * (-774.302) [-773.163] (-776.872) (-772.582) -- 0:00:44
      288500 -- (-773.785) (-773.510) [-772.026] (-774.580) * (-775.212) [-776.447] (-772.086) (-774.297) -- 0:00:44
      289000 -- [-773.315] (-776.137) (-773.513) (-775.499) * (-773.261) (-775.463) (-773.024) [-773.094] -- 0:00:44
      289500 -- (-773.398) [-775.087] (-773.365) (-777.151) * [-772.989] (-775.155) (-772.107) (-773.025) -- 0:00:44
      290000 -- (-772.268) (-774.438) (-776.468) [-775.606] * [-772.448] (-774.715) (-773.718) (-771.805) -- 0:00:44

      Average standard deviation of split frequencies: 0.011623

      290500 -- (-772.276) (-778.386) (-774.352) [-773.690] * (-772.708) (-773.000) [-774.065] (-771.749) -- 0:00:43
      291000 -- (-772.212) (-772.105) [-773.314] (-773.957) * [-772.646] (-773.971) (-773.680) (-775.103) -- 0:00:43
      291500 -- (-773.859) (-773.768) (-773.311) [-773.800] * (-772.792) (-772.358) (-772.854) [-772.252] -- 0:00:43
      292000 -- (-773.431) [-772.263] (-773.800) (-772.129) * [-774.884] (-775.971) (-773.626) (-772.423) -- 0:00:43
      292500 -- (-773.417) (-773.332) (-776.035) [-772.505] * [-773.272] (-774.486) (-775.179) (-774.619) -- 0:00:43
      293000 -- [-772.182] (-772.876) (-772.422) (-774.472) * [-774.910] (-772.730) (-773.409) (-776.504) -- 0:00:43
      293500 -- (-772.078) (-773.629) (-771.922) [-773.292] * (-772.309) [-776.040] (-772.889) (-772.860) -- 0:00:43
      294000 -- (-773.440) (-772.974) (-775.225) [-772.176] * (-772.513) (-772.576) (-774.058) [-772.324] -- 0:00:43
      294500 -- [-774.906] (-772.192) (-772.810) (-772.781) * [-775.015] (-773.076) (-773.240) (-776.059) -- 0:00:43
      295000 -- [-774.269] (-772.739) (-772.861) (-772.057) * (-775.374) (-773.409) (-771.352) [-773.816] -- 0:00:43

      Average standard deviation of split frequencies: 0.013115

      295500 -- (-773.022) (-772.224) [-771.649] (-771.768) * (-775.021) (-773.182) [-774.778] (-774.268) -- 0:00:45
      296000 -- (-773.775) [-774.224] (-771.621) (-772.494) * (-776.932) (-772.538) [-773.930] (-773.028) -- 0:00:45
      296500 -- (-774.933) [-774.445] (-774.068) (-774.560) * (-777.584) (-777.610) [-772.232] (-772.068) -- 0:00:45
      297000 -- (-778.731) (-774.234) [-773.038] (-773.099) * (-774.630) [-777.182] (-774.968) (-774.107) -- 0:00:44
      297500 -- (-772.748) (-779.108) (-773.282) [-773.290] * [-772.080] (-776.508) (-774.176) (-776.305) -- 0:00:44
      298000 -- (-775.760) [-772.799] (-773.225) (-773.366) * [-772.238] (-777.819) (-775.108) (-773.379) -- 0:00:44
      298500 -- (-774.051) (-772.348) (-774.046) [-776.111] * (-773.415) (-774.382) [-776.306] (-773.258) -- 0:00:44
      299000 -- (-774.395) [-772.784] (-775.276) (-773.883) * (-772.165) [-773.983] (-775.452) (-772.026) -- 0:00:44
      299500 -- (-775.770) (-773.340) [-775.368] (-774.780) * (-772.612) (-775.280) (-774.820) [-771.975] -- 0:00:44
      300000 -- [-778.917] (-771.548) (-773.475) (-774.355) * [-775.853] (-776.836) (-773.780) (-774.972) -- 0:00:44

      Average standard deviation of split frequencies: 0.012445

      300500 -- (-772.428) (-771.836) [-772.700] (-774.973) * (-777.497) [-776.206] (-773.821) (-774.314) -- 0:00:44
      301000 -- [-771.621] (-772.994) (-774.310) (-775.017) * [-774.862] (-772.341) (-772.560) (-774.922) -- 0:00:44
      301500 -- (-774.036) (-774.362) (-773.065) [-772.555] * [-774.294] (-774.817) (-777.261) (-775.322) -- 0:00:44
      302000 -- (-774.576) (-772.701) (-774.117) [-771.964] * (-776.539) [-772.379] (-774.523) (-771.580) -- 0:00:43
      302500 -- (-772.552) (-772.302) (-773.683) [-771.682] * [-774.731] (-774.108) (-775.135) (-772.802) -- 0:00:43
      303000 -- (-774.672) [-772.024] (-774.378) (-772.214) * (-774.603) (-772.162) (-772.933) [-775.186] -- 0:00:43
      303500 -- [-771.869] (-772.933) (-775.175) (-772.906) * (-774.445) (-772.456) (-775.493) [-771.532] -- 0:00:43
      304000 -- (-772.986) (-774.294) [-772.648] (-774.623) * (-776.140) [-773.082] (-774.491) (-774.455) -- 0:00:43
      304500 -- (-773.071) (-774.911) [-772.524] (-776.730) * [-773.728] (-776.029) (-771.869) (-773.138) -- 0:00:43
      305000 -- [-772.703] (-773.227) (-777.805) (-782.720) * (-778.517) (-772.881) (-774.358) [-772.472] -- 0:00:43

      Average standard deviation of split frequencies: 0.011843

      305500 -- (-776.839) (-773.568) [-771.951] (-774.505) * (-775.078) (-772.690) (-773.311) [-772.714] -- 0:00:43
      306000 -- (-775.520) (-772.821) [-773.692] (-775.073) * (-776.796) (-775.277) [-773.927] (-775.724) -- 0:00:43
      306500 -- [-775.458] (-774.130) (-772.600) (-772.249) * [-771.858] (-772.681) (-772.814) (-771.801) -- 0:00:42
      307000 -- (-772.808) (-773.369) (-772.748) [-772.225] * (-772.821) (-772.580) [-773.490] (-773.497) -- 0:00:42
      307500 -- (-773.233) [-779.498] (-773.303) (-773.126) * (-773.464) (-776.958) (-772.919) [-773.511] -- 0:00:42
      308000 -- [-773.569] (-774.749) (-773.899) (-775.189) * [-772.732] (-781.281) (-772.497) (-773.526) -- 0:00:42
      308500 -- (-774.707) (-774.522) [-774.020] (-774.073) * (-775.395) (-774.926) (-772.038) [-772.406] -- 0:00:42
      309000 -- [-774.895] (-774.753) (-775.569) (-773.552) * (-773.615) (-774.697) [-773.043] (-773.598) -- 0:00:42
      309500 -- (-774.275) (-773.070) [-772.509] (-776.940) * [-772.692] (-773.316) (-776.581) (-775.719) -- 0:00:42
      310000 -- [-772.468] (-775.088) (-771.698) (-773.292) * [-773.382] (-774.871) (-774.898) (-772.714) -- 0:00:42

      Average standard deviation of split frequencies: 0.012050

      310500 -- (-772.674) (-773.936) [-773.234] (-771.861) * [-771.999] (-774.934) (-774.837) (-776.561) -- 0:00:42
      311000 -- [-774.188] (-776.784) (-772.823) (-774.622) * [-774.776] (-773.186) (-773.274) (-772.253) -- 0:00:42
      311500 -- (-775.381) (-772.005) (-772.190) [-775.687] * (-772.673) [-775.953] (-774.325) (-772.562) -- 0:00:41
      312000 -- (-772.684) [-773.120] (-774.048) (-772.452) * (-772.733) (-777.179) (-772.892) [-773.055] -- 0:00:41
      312500 -- (-773.958) (-776.594) [-776.958] (-772.419) * [-773.021] (-775.912) (-771.771) (-776.229) -- 0:00:44
      313000 -- (-773.835) (-775.204) (-773.662) [-773.218] * (-773.727) [-775.909] (-777.252) (-774.340) -- 0:00:43
      313500 -- (-773.274) (-773.491) (-775.335) [-773.055] * (-774.110) (-775.063) (-772.580) [-772.317] -- 0:00:43
      314000 -- (-772.480) (-773.531) [-774.416] (-772.083) * (-774.071) [-773.429] (-772.332) (-772.976) -- 0:00:43
      314500 -- (-776.820) [-772.266] (-776.389) (-771.944) * (-772.816) (-772.335) (-772.270) [-773.353] -- 0:00:43
      315000 -- (-776.746) [-773.872] (-776.538) (-773.236) * (-771.611) (-772.560) [-773.216] (-774.904) -- 0:00:43

      Average standard deviation of split frequencies: 0.012461

      315500 -- [-774.749] (-773.363) (-773.838) (-775.397) * [-774.225] (-775.904) (-773.178) (-774.853) -- 0:00:43
      316000 -- (-772.604) (-773.440) [-773.003] (-773.643) * (-772.788) (-772.558) [-775.048] (-776.072) -- 0:00:43
      316500 -- [-773.452] (-774.577) (-772.189) (-775.452) * (-773.144) (-776.784) (-773.805) [-776.342] -- 0:00:43
      317000 -- (-773.490) [-774.035] (-771.878) (-776.134) * (-773.595) (-775.905) (-773.459) [-773.516] -- 0:00:43
      317500 -- (-774.505) (-777.032) [-772.619] (-774.887) * (-776.412) [-773.565] (-773.334) (-772.431) -- 0:00:42
      318000 -- [-771.939] (-773.669) (-772.519) (-773.469) * (-775.654) (-773.314) [-775.349] (-775.688) -- 0:00:42
      318500 -- (-773.757) (-772.754) [-773.463] (-775.091) * (-780.880) (-773.850) [-772.478] (-778.657) -- 0:00:42
      319000 -- [-774.845] (-778.235) (-781.722) (-772.563) * [-772.877] (-777.018) (-772.363) (-782.137) -- 0:00:42
      319500 -- [-774.177] (-775.998) (-776.387) (-772.104) * [-772.683] (-776.083) (-777.247) (-775.797) -- 0:00:42
      320000 -- (-773.346) [-771.689] (-776.703) (-776.423) * (-772.364) (-777.616) (-775.370) [-774.793] -- 0:00:42

      Average standard deviation of split frequencies: 0.013317

      320500 -- (-774.633) (-774.385) [-777.834] (-772.931) * [-771.665] (-775.219) (-775.994) (-775.228) -- 0:00:42
      321000 -- (-773.493) (-777.009) (-777.008) [-773.949] * (-774.349) (-773.141) [-778.703] (-774.419) -- 0:00:42
      321500 -- (-772.967) [-773.733] (-773.440) (-778.094) * (-776.135) (-771.990) [-781.599] (-772.682) -- 0:00:42
      322000 -- (-772.682) (-774.797) (-772.494) [-773.533] * (-773.981) (-775.037) (-774.590) [-773.530] -- 0:00:42
      322500 -- (-777.402) (-771.838) [-774.415] (-772.533) * [-772.383] (-774.379) (-772.428) (-773.210) -- 0:00:42
      323000 -- (-772.446) (-775.162) (-774.476) [-774.481] * [-772.750] (-773.712) (-772.043) (-772.910) -- 0:00:41
      323500 -- [-772.327] (-772.449) (-774.112) (-773.020) * [-774.637] (-773.992) (-771.743) (-772.680) -- 0:00:41
      324000 -- (-771.928) (-773.651) (-776.865) [-773.127] * (-772.479) [-772.242] (-774.416) (-772.598) -- 0:00:41
      324500 -- (-772.922) (-774.365) [-771.593] (-774.105) * (-773.697) [-772.260] (-772.506) (-774.568) -- 0:00:41
      325000 -- [-772.597] (-774.653) (-774.451) (-777.656) * [-771.390] (-772.733) (-775.896) (-775.341) -- 0:00:41

      Average standard deviation of split frequencies: 0.012504

      325500 -- (-772.588) (-772.853) [-772.569] (-773.398) * (-773.654) (-776.880) [-773.035] (-774.681) -- 0:00:41
      326000 -- [-772.667] (-771.464) (-772.363) (-773.968) * (-772.394) [-772.640] (-775.612) (-776.557) -- 0:00:41
      326500 -- [-773.719] (-771.967) (-776.137) (-772.445) * (-772.582) [-771.631] (-773.070) (-771.587) -- 0:00:41
      327000 -- (-774.939) (-773.104) (-778.802) [-775.731] * (-772.928) (-773.226) [-772.432] (-773.788) -- 0:00:41
      327500 -- (-776.918) (-773.750) [-774.119] (-775.724) * (-773.344) [-776.674] (-774.134) (-775.147) -- 0:00:41
      328000 -- [-772.675] (-775.805) (-771.506) (-776.399) * (-773.986) (-776.015) (-775.242) [-774.653] -- 0:00:40
      328500 -- (-774.339) (-773.396) [-775.193] (-775.448) * (-776.153) (-775.657) (-775.807) [-771.663] -- 0:00:40
      329000 -- (-772.403) (-773.627) [-774.995] (-775.166) * [-773.983] (-774.126) (-776.040) (-776.575) -- 0:00:42
      329500 -- (-771.552) (-773.366) (-775.317) [-773.830] * (-774.280) [-775.504] (-774.222) (-773.700) -- 0:00:42
      330000 -- [-772.695] (-775.531) (-775.504) (-776.892) * (-774.491) (-775.444) (-775.392) [-774.256] -- 0:00:42

      Average standard deviation of split frequencies: 0.012593

      330500 -- [-775.509] (-774.969) (-774.269) (-775.854) * (-774.751) [-773.136] (-772.824) (-772.705) -- 0:00:42
      331000 -- (-775.782) (-772.001) [-773.703] (-774.810) * [-774.029] (-773.076) (-772.768) (-774.721) -- 0:00:42
      331500 -- (-772.846) (-772.032) [-772.296] (-774.230) * [-772.797] (-773.064) (-773.293) (-775.645) -- 0:00:42
      332000 -- (-773.553) (-777.539) [-771.705] (-774.220) * (-775.026) (-772.215) (-775.697) [-774.053] -- 0:00:42
      332500 -- (-773.144) (-775.743) [-775.117] (-773.743) * [-775.975] (-771.709) (-773.015) (-773.274) -- 0:00:42
      333000 -- (-778.847) (-775.813) [-774.595] (-773.229) * (-773.967) (-772.995) [-774.357] (-774.091) -- 0:00:42
      333500 -- [-772.919] (-774.222) (-774.636) (-773.207) * (-773.590) [-773.373] (-772.960) (-772.037) -- 0:00:41
      334000 -- [-772.869] (-773.411) (-771.908) (-773.089) * [-772.128] (-773.677) (-777.951) (-774.982) -- 0:00:41
      334500 -- (-772.839) [-773.643] (-772.251) (-772.725) * [-771.864] (-774.662) (-775.070) (-779.041) -- 0:00:41
      335000 -- [-774.853] (-776.606) (-772.357) (-772.490) * (-774.257) (-773.291) [-775.243] (-772.428) -- 0:00:41

      Average standard deviation of split frequencies: 0.012276

      335500 -- (-775.192) [-772.788] (-774.018) (-771.535) * (-773.409) (-772.047) (-772.462) [-775.024] -- 0:00:41
      336000 -- [-774.353] (-775.319) (-775.087) (-771.850) * (-782.873) (-779.509) (-775.384) [-777.104] -- 0:00:41
      336500 -- (-774.702) [-775.773] (-772.917) (-773.387) * (-776.320) (-773.384) (-775.335) [-774.470] -- 0:00:41
      337000 -- (-772.853) [-776.856] (-775.249) (-772.248) * [-775.645] (-776.018) (-776.300) (-772.360) -- 0:00:41
      337500 -- [-772.959] (-775.983) (-776.278) (-771.851) * (-774.804) (-775.837) [-775.435] (-772.589) -- 0:00:41
      338000 -- (-771.620) [-773.612] (-775.735) (-773.380) * [-772.177] (-772.153) (-773.018) (-773.569) -- 0:00:41
      338500 -- [-775.387] (-773.141) (-773.028) (-772.372) * (-774.640) (-779.570) (-776.044) [-774.587] -- 0:00:41
      339000 -- [-774.419] (-772.674) (-777.352) (-773.385) * (-775.176) (-772.359) (-774.740) [-774.460] -- 0:00:40
      339500 -- (-773.448) (-772.585) (-772.545) [-773.793] * (-772.280) [-773.039] (-772.972) (-772.878) -- 0:00:40
      340000 -- (-772.859) [-772.485] (-773.417) (-773.299) * (-772.280) [-774.151] (-776.451) (-774.352) -- 0:00:40

      Average standard deviation of split frequencies: 0.011676

      340500 -- (-772.313) (-772.941) (-772.146) [-773.504] * (-774.356) [-773.659] (-773.513) (-773.298) -- 0:00:40
      341000 -- (-777.004) [-773.282] (-772.869) (-774.262) * (-773.589) (-773.320) [-773.351] (-772.224) -- 0:00:40
      341500 -- (-776.234) [-777.284] (-774.819) (-775.757) * (-774.711) (-773.075) [-772.780] (-773.892) -- 0:00:40
      342000 -- (-774.434) [-775.159] (-775.165) (-772.513) * (-774.469) (-772.406) [-772.680] (-776.547) -- 0:00:40
      342500 -- [-772.747] (-774.853) (-772.926) (-773.478) * (-773.415) [-775.752] (-775.209) (-771.496) -- 0:00:40
      343000 -- (-775.944) (-776.102) (-771.869) [-774.128] * (-777.524) [-775.970] (-772.345) (-772.423) -- 0:00:40
      343500 -- (-777.029) (-775.030) [-772.414] (-773.113) * (-776.459) (-773.984) (-771.777) [-771.906] -- 0:00:40
      344000 -- (-773.986) [-774.916] (-772.851) (-775.649) * (-774.860) (-771.895) (-772.876) [-775.235] -- 0:00:40
      344500 -- [-772.414] (-776.334) (-773.441) (-775.851) * [-777.109] (-773.489) (-773.887) (-773.126) -- 0:00:39
      345000 -- (-773.201) [-773.886] (-772.611) (-775.412) * (-773.534) (-772.565) [-774.562] (-772.928) -- 0:00:39

      Average standard deviation of split frequencies: 0.011701

      345500 -- (-773.805) (-776.067) (-774.547) [-772.538] * (-773.093) [-772.791] (-777.238) (-778.379) -- 0:00:41
      346000 -- [-773.387] (-773.419) (-774.922) (-773.044) * (-773.658) (-771.767) [-771.954] (-775.468) -- 0:00:41
      346500 -- [-772.330] (-772.535) (-771.770) (-773.828) * (-771.918) [-771.366] (-771.994) (-774.051) -- 0:00:41
      347000 -- [-775.067] (-774.347) (-772.996) (-772.303) * (-773.483) [-772.923] (-776.183) (-773.189) -- 0:00:41
      347500 -- (-773.413) (-780.103) [-775.290] (-773.348) * (-776.949) (-773.746) [-773.339] (-773.644) -- 0:00:41
      348000 -- (-773.219) (-773.520) [-772.902] (-773.381) * (-774.840) [-773.345] (-773.496) (-775.876) -- 0:00:41
      348500 -- (-773.411) [-774.507] (-776.782) (-774.200) * (-777.579) (-774.835) [-771.728] (-773.597) -- 0:00:41
      349000 -- (-774.813) (-772.763) (-776.526) [-771.844] * (-778.203) (-774.504) [-772.015] (-776.568) -- 0:00:41
      349500 -- [-774.768] (-772.948) (-772.627) (-774.526) * [-773.293] (-773.045) (-775.852) (-774.075) -- 0:00:40
      350000 -- (-777.477) (-773.088) (-775.203) [-777.019] * (-777.522) (-774.683) [-773.524] (-775.096) -- 0:00:40

      Average standard deviation of split frequencies: 0.010517

      350500 -- (-775.297) [-772.031] (-773.519) (-773.204) * [-775.729] (-775.573) (-773.966) (-775.154) -- 0:00:40
      351000 -- (-774.156) (-773.789) (-783.951) [-774.004] * (-773.299) (-776.618) [-773.008] (-773.041) -- 0:00:40
      351500 -- (-774.096) (-773.135) (-779.500) [-771.983] * [-776.808] (-773.271) (-775.112) (-774.729) -- 0:00:40
      352000 -- (-773.483) [-772.576] (-772.818) (-773.817) * (-775.159) (-774.239) [-777.091] (-777.405) -- 0:00:40
      352500 -- (-772.907) (-774.032) (-773.036) [-774.362] * [-775.940] (-772.363) (-772.474) (-772.253) -- 0:00:40
      353000 -- (-773.454) (-774.292) (-775.218) [-773.735] * (-774.894) (-772.517) (-772.567) [-772.594] -- 0:00:40
      353500 -- (-774.998) [-772.992] (-773.240) (-772.818) * [-772.144] (-775.813) (-773.219) (-771.719) -- 0:00:40
      354000 -- (-778.608) (-772.356) [-772.995] (-777.507) * (-774.387) [-774.647] (-772.812) (-774.057) -- 0:00:40
      354500 -- (-777.325) (-774.653) [-771.363] (-773.755) * (-775.828) (-772.969) [-772.601] (-771.769) -- 0:00:40
      355000 -- (-778.041) [-779.030] (-773.307) (-776.343) * (-776.498) (-774.009) [-772.567] (-772.098) -- 0:00:39

      Average standard deviation of split frequencies: 0.010671

      355500 -- (-772.935) (-774.124) [-776.464] (-776.996) * (-780.940) [-773.987] (-772.146) (-772.247) -- 0:00:39
      356000 -- (-772.838) (-774.374) [-778.143] (-777.460) * (-775.167) (-775.107) (-772.638) [-772.343] -- 0:00:39
      356500 -- (-774.409) (-775.790) (-774.152) [-774.911] * [-776.054] (-777.155) (-773.488) (-775.674) -- 0:00:39
      357000 -- [-774.214] (-775.821) (-772.797) (-777.142) * [-773.237] (-778.180) (-772.803) (-774.465) -- 0:00:39
      357500 -- (-773.783) (-777.992) [-772.576] (-773.426) * (-776.587) (-773.108) (-774.633) [-774.768] -- 0:00:39
      358000 -- (-775.742) (-776.088) (-775.839) [-773.296] * [-776.339] (-773.479) (-772.103) (-773.250) -- 0:00:39
      358500 -- (-774.477) (-775.831) [-772.846] (-772.319) * (-774.224) (-772.878) [-773.687] (-772.769) -- 0:00:39
      359000 -- (-772.732) (-773.212) [-771.674] (-774.267) * (-771.966) [-771.614] (-773.686) (-772.123) -- 0:00:39
      359500 -- (-777.425) (-772.416) (-772.275) [-771.831] * (-772.714) [-771.793] (-772.757) (-772.802) -- 0:00:39
      360000 -- (-775.789) [-774.225] (-773.098) (-772.895) * (-778.717) [-772.298] (-774.460) (-773.075) -- 0:00:39

      Average standard deviation of split frequencies: 0.010764

      360500 -- (-774.370) (-771.679) [-773.556] (-773.488) * (-779.230) (-773.442) [-773.655] (-774.620) -- 0:00:39
      361000 -- (-773.585) (-771.684) (-772.163) [-772.320] * (-773.367) (-772.197) (-775.281) [-772.919] -- 0:00:38
      361500 -- (-777.070) (-773.327) (-774.336) [-772.926] * (-772.749) (-773.137) [-775.104] (-773.980) -- 0:00:38
      362000 -- [-776.039] (-775.864) (-771.922) (-774.735) * (-776.143) (-773.018) [-774.009] (-772.900) -- 0:00:38
      362500 -- (-780.677) (-773.567) [-772.945] (-774.973) * [-772.273] (-776.105) (-773.273) (-772.335) -- 0:00:40
      363000 -- [-773.713] (-772.884) (-772.773) (-772.727) * [-772.593] (-773.812) (-772.612) (-773.743) -- 0:00:40
      363500 -- (-773.711) (-774.439) (-772.217) [-773.736] * (-772.418) (-774.026) [-771.747] (-774.494) -- 0:00:40
      364000 -- (-775.844) (-776.048) [-774.751] (-774.000) * (-776.103) (-777.325) (-771.775) [-776.803] -- 0:00:40
      364500 -- (-773.279) (-775.739) [-772.867] (-775.012) * (-773.465) (-777.338) (-774.859) [-772.422] -- 0:00:40
      365000 -- [-772.344] (-772.648) (-773.534) (-774.952) * (-772.530) (-774.291) (-776.808) [-776.207] -- 0:00:40

      Average standard deviation of split frequencies: 0.010683

      365500 -- (-772.179) (-775.842) (-774.817) [-773.033] * (-771.758) [-773.649] (-772.875) (-774.425) -- 0:00:39
      366000 -- [-773.794] (-777.645) (-773.350) (-773.890) * [-772.714] (-773.120) (-773.022) (-772.618) -- 0:00:39
      366500 -- (-772.541) (-777.688) (-773.519) [-774.050] * (-776.011) (-775.309) (-772.374) [-774.041] -- 0:00:39
      367000 -- (-772.156) (-771.864) [-772.554] (-774.542) * (-777.099) (-775.794) (-775.334) [-772.205] -- 0:00:39
      367500 -- (-775.357) [-772.560] (-771.308) (-776.095) * (-771.769) (-776.099) [-776.601] (-772.221) -- 0:00:39
      368000 -- (-775.945) (-772.914) [-774.592] (-775.568) * (-772.718) (-775.921) [-774.051] (-774.850) -- 0:00:39
      368500 -- (-775.702) [-771.884] (-772.633) (-780.954) * (-776.871) [-772.884] (-778.149) (-773.901) -- 0:00:39
      369000 -- (-771.829) [-775.086] (-772.004) (-774.610) * (-777.425) [-772.450] (-776.551) (-773.079) -- 0:00:39
      369500 -- [-772.830] (-772.318) (-772.326) (-775.979) * (-773.605) (-773.152) [-778.991] (-775.746) -- 0:00:39
      370000 -- (-772.966) [-772.816] (-773.884) (-773.732) * [-776.411] (-774.644) (-776.584) (-776.123) -- 0:00:39

      Average standard deviation of split frequencies: 0.010399

      370500 -- (-772.897) (-773.125) (-775.505) [-774.681] * [-774.674] (-774.644) (-771.776) (-774.475) -- 0:00:39
      371000 -- (-772.473) [-774.919] (-773.700) (-771.775) * (-772.827) (-772.397) (-773.243) [-771.872] -- 0:00:38
      371500 -- (-774.470) (-776.068) (-773.551) [-771.488] * (-772.147) (-774.360) [-771.998] (-773.698) -- 0:00:38
      372000 -- [-774.013] (-778.995) (-775.304) (-771.452) * [-777.006] (-777.239) (-773.324) (-775.575) -- 0:00:38
      372500 -- [-771.730] (-774.659) (-774.464) (-776.784) * (-775.879) (-773.169) [-776.087] (-775.429) -- 0:00:38
      373000 -- (-772.562) [-774.010] (-773.516) (-778.828) * (-773.776) (-774.840) [-774.470] (-773.296) -- 0:00:38
      373500 -- [-773.122] (-773.366) (-772.631) (-779.748) * (-773.453) [-775.343] (-773.703) (-773.825) -- 0:00:38
      374000 -- (-772.050) (-780.272) [-772.924] (-776.065) * (-774.170) (-774.372) [-773.474] (-773.530) -- 0:00:38
      374500 -- [-774.360] (-772.273) (-772.267) (-772.500) * (-773.896) (-773.399) (-775.841) [-772.554] -- 0:00:38
      375000 -- (-773.821) [-773.412] (-774.231) (-777.113) * [-772.162] (-772.073) (-774.014) (-773.006) -- 0:00:38

      Average standard deviation of split frequencies: 0.009587

      375500 -- [-775.584] (-772.396) (-773.259) (-778.465) * (-772.965) [-774.116] (-773.176) (-772.030) -- 0:00:38
      376000 -- (-775.358) [-772.074] (-771.810) (-772.962) * (-772.031) (-774.671) [-773.923] (-774.626) -- 0:00:38
      376500 -- (-780.362) [-776.481] (-773.535) (-775.364) * (-772.628) [-774.172] (-777.633) (-772.360) -- 0:00:38
      377000 -- (-771.829) (-777.571) (-771.757) [-773.922] * (-775.500) (-773.681) (-776.022) [-773.606] -- 0:00:38
      377500 -- (-773.170) [-773.149] (-774.930) (-772.272) * (-775.025) (-774.660) (-772.319) [-771.480] -- 0:00:37
      378000 -- (-773.709) (-775.084) (-773.904) [-772.389] * (-774.049) (-775.112) [-771.822] (-773.862) -- 0:00:37
      378500 -- (-776.759) [-773.330] (-773.265) (-771.974) * (-773.562) [-773.048] (-773.888) (-772.607) -- 0:00:37
      379000 -- [-774.688] (-771.705) (-775.349) (-771.739) * (-774.206) (-774.322) (-775.949) [-773.877] -- 0:00:39
      379500 -- [-774.938] (-774.175) (-776.894) (-773.989) * (-772.549) (-773.054) [-775.030] (-777.627) -- 0:00:39
      380000 -- [-773.836] (-774.032) (-777.063) (-776.055) * (-772.837) (-777.700) (-774.584) [-772.596] -- 0:00:39

      Average standard deviation of split frequencies: 0.009834

      380500 -- [-772.143] (-775.878) (-778.442) (-774.988) * (-774.611) (-771.772) (-775.726) [-772.961] -- 0:00:39
      381000 -- (-771.812) [-774.665] (-774.067) (-771.863) * (-778.999) (-772.115) [-772.003] (-774.724) -- 0:00:38
      381500 -- (-771.536) (-771.616) [-776.305] (-772.991) * [-773.601] (-773.139) (-774.568) (-773.895) -- 0:00:38
      382000 -- (-773.668) [-772.817] (-777.810) (-772.049) * (-774.248) [-773.521] (-772.085) (-775.500) -- 0:00:38
      382500 -- (-772.993) [-774.181] (-776.431) (-777.603) * [-772.979] (-779.789) (-772.943) (-773.873) -- 0:00:38
      383000 -- (-773.128) (-774.189) [-773.134] (-777.851) * (-773.782) [-774.347] (-774.578) (-774.472) -- 0:00:38
      383500 -- (-773.271) (-773.432) [-773.391] (-775.834) * [-771.675] (-777.291) (-774.188) (-778.241) -- 0:00:38
      384000 -- (-776.378) [-773.390] (-771.837) (-776.094) * (-772.047) (-772.811) [-774.072] (-771.679) -- 0:00:38
      384500 -- (-781.019) (-775.968) (-772.337) [-775.827] * (-773.342) (-773.195) (-774.738) [-775.366] -- 0:00:38
      385000 -- [-772.608] (-776.318) (-771.799) (-775.543) * (-774.682) (-774.670) [-773.898] (-773.877) -- 0:00:38

      Average standard deviation of split frequencies: 0.009914

      385500 -- [-772.282] (-775.981) (-775.127) (-773.675) * (-776.684) [-773.480] (-774.322) (-779.361) -- 0:00:38
      386000 -- [-772.083] (-776.041) (-774.103) (-772.093) * (-775.398) (-772.583) (-774.829) [-772.646] -- 0:00:38
      386500 -- (-773.610) (-779.603) [-774.902] (-771.781) * [-773.160] (-773.003) (-774.641) (-772.564) -- 0:00:38
      387000 -- [-773.479] (-772.378) (-778.013) (-774.709) * (-772.668) [-772.218] (-772.516) (-780.753) -- 0:00:38
      387500 -- (-772.153) (-772.965) [-773.318] (-775.665) * (-772.824) (-773.939) (-777.768) [-772.306] -- 0:00:37
      388000 -- (-771.873) (-774.086) [-772.252] (-775.724) * (-774.131) [-772.593] (-772.779) (-773.506) -- 0:00:37
      388500 -- [-773.327] (-772.318) (-773.614) (-773.209) * (-771.844) [-773.444] (-772.784) (-773.771) -- 0:00:37
      389000 -- (-774.400) (-773.149) (-774.415) [-774.868] * (-773.806) (-774.984) [-773.227] (-773.625) -- 0:00:37
      389500 -- [-775.362] (-773.177) (-772.290) (-773.620) * [-774.199] (-772.911) (-774.221) (-775.890) -- 0:00:37
      390000 -- (-774.170) [-772.358] (-771.851) (-773.140) * [-774.908] (-773.814) (-775.969) (-773.731) -- 0:00:37

      Average standard deviation of split frequencies: 0.009795

      390500 -- (-774.349) [-773.867] (-772.083) (-772.924) * (-772.590) [-778.353] (-773.242) (-775.205) -- 0:00:37
      391000 -- (-773.843) (-773.766) [-772.619] (-775.134) * (-773.321) (-773.218) [-774.277] (-772.505) -- 0:00:37
      391500 -- (-774.721) (-778.442) [-771.594] (-774.624) * [-773.196] (-776.289) (-772.634) (-772.265) -- 0:00:37
      392000 -- [-775.021] (-775.050) (-771.596) (-773.123) * (-776.248) (-774.529) [-773.547] (-773.765) -- 0:00:37
      392500 -- (-775.557) [-773.411] (-777.259) (-772.701) * (-772.612) (-773.734) (-773.603) [-772.629] -- 0:00:37
      393000 -- [-771.996] (-774.008) (-772.434) (-777.273) * (-772.237) (-773.516) [-772.628] (-772.130) -- 0:00:37
      393500 -- (-779.391) (-775.254) [-773.444] (-775.119) * [-773.591] (-773.258) (-772.411) (-774.343) -- 0:00:36
      394000 -- (-772.729) [-772.939] (-774.078) (-773.416) * (-775.412) (-773.116) (-773.774) [-776.857] -- 0:00:36
      394500 -- (-772.749) (-773.383) [-773.260] (-774.400) * (-776.018) (-776.464) (-775.179) [-776.934] -- 0:00:36
      395000 -- (-773.986) (-773.116) [-773.917] (-774.006) * (-773.218) [-775.891] (-773.873) (-776.932) -- 0:00:36

      Average standard deviation of split frequencies: 0.010644

      395500 -- (-772.956) [-772.862] (-771.842) (-775.431) * (-771.862) (-772.811) (-774.907) [-775.000] -- 0:00:38
      396000 -- [-777.605] (-773.994) (-777.342) (-772.806) * (-773.212) [-775.698] (-775.712) (-778.850) -- 0:00:38
      396500 -- [-773.386] (-774.654) (-775.598) (-778.610) * (-772.467) [-776.538] (-775.388) (-780.479) -- 0:00:38
      397000 -- (-772.327) [-773.437] (-774.879) (-778.985) * (-773.909) [-772.148] (-771.666) (-772.883) -- 0:00:37
      397500 -- (-772.854) (-773.109) [-772.202] (-774.210) * (-772.053) (-771.654) [-773.974] (-774.428) -- 0:00:37
      398000 -- (-774.413) (-777.328) (-774.358) [-776.922] * (-772.677) (-773.595) [-773.512] (-775.450) -- 0:00:37
      398500 -- [-774.695] (-775.973) (-774.371) (-781.222) * (-777.326) (-775.381) [-773.844] (-774.922) -- 0:00:37
      399000 -- (-774.428) (-772.757) (-774.941) [-776.212] * [-772.539] (-774.226) (-773.864) (-775.441) -- 0:00:37
      399500 -- (-774.020) [-772.515] (-778.393) (-780.740) * [-771.856] (-772.636) (-776.824) (-774.484) -- 0:00:37
      400000 -- [-773.033] (-772.412) (-775.745) (-779.162) * (-772.924) (-774.015) (-774.058) [-773.678] -- 0:00:37

      Average standard deviation of split frequencies: 0.011143

      400500 -- [-775.560] (-774.021) (-776.129) (-775.543) * [-773.054] (-772.421) (-772.823) (-778.267) -- 0:00:37
      401000 -- (-774.699) [-773.443] (-773.518) (-776.450) * (-772.954) (-773.080) (-774.283) [-771.686] -- 0:00:37
      401500 -- (-773.764) (-773.636) [-772.396] (-775.173) * [-774.180] (-772.682) (-772.935) (-771.453) -- 0:00:37
      402000 -- (-774.543) (-772.694) (-772.555) [-774.458] * [-771.902] (-772.857) (-776.020) (-777.445) -- 0:00:37
      402500 -- (-774.433) (-772.391) [-773.098] (-772.836) * (-771.830) (-772.322) [-772.086] (-775.344) -- 0:00:37
      403000 -- (-775.299) [-772.695] (-772.590) (-773.332) * [-771.403] (-772.323) (-775.425) (-772.148) -- 0:00:37
      403500 -- (-775.354) (-772.559) [-774.531] (-772.223) * (-773.317) (-774.300) [-773.300] (-773.590) -- 0:00:36
      404000 -- (-776.687) [-773.782] (-777.095) (-773.579) * (-773.980) (-775.620) (-772.827) [-776.657] -- 0:00:36
      404500 -- (-774.711) [-773.743] (-772.761) (-775.416) * (-771.973) (-773.148) [-773.743] (-778.801) -- 0:00:36
      405000 -- (-772.974) (-775.069) (-775.191) [-774.075] * (-773.427) (-772.237) [-772.451] (-777.658) -- 0:00:36

      Average standard deviation of split frequencies: 0.010791

      405500 -- (-774.663) (-777.734) [-772.953] (-772.817) * (-772.574) (-772.671) (-773.905) [-773.607] -- 0:00:36
      406000 -- (-774.820) [-773.825] (-773.619) (-774.491) * (-772.280) (-774.074) [-772.574] (-772.636) -- 0:00:36
      406500 -- [-774.174] (-775.335) (-771.819) (-776.917) * (-772.024) (-772.592) [-772.312] (-774.416) -- 0:00:36
      407000 -- (-775.387) (-774.274) (-772.527) [-774.998] * (-771.992) (-774.684) (-772.399) [-777.400] -- 0:00:36
      407500 -- (-772.894) (-774.862) [-776.585] (-774.328) * [-775.164] (-774.625) (-773.750) (-773.416) -- 0:00:36
      408000 -- (-773.697) (-773.880) [-773.395] (-773.624) * (-781.879) [-774.028] (-774.174) (-772.378) -- 0:00:36
      408500 -- (-774.466) [-773.928] (-777.310) (-774.569) * (-777.428) (-774.810) (-777.655) [-772.760] -- 0:00:36
      409000 -- (-772.464) (-771.787) [-774.885] (-774.137) * (-772.308) (-773.307) [-772.573] (-775.151) -- 0:00:36
      409500 -- (-778.113) [-772.408] (-774.502) (-774.428) * [-773.105] (-772.615) (-773.162) (-774.387) -- 0:00:36
      410000 -- (-774.115) [-772.283] (-773.564) (-773.717) * (-774.691) [-773.427] (-777.028) (-771.931) -- 0:00:35

      Average standard deviation of split frequencies: 0.009656

      410500 -- [-778.327] (-771.983) (-777.477) (-773.394) * (-778.312) (-775.294) (-774.074) [-771.832] -- 0:00:35
      411000 -- (-781.582) [-773.095] (-777.404) (-775.844) * [-772.978] (-774.664) (-776.609) (-775.231) -- 0:00:35
      411500 -- (-777.684) [-772.578] (-775.417) (-773.550) * [-773.821] (-774.801) (-774.049) (-772.609) -- 0:00:35
      412000 -- [-775.821] (-772.933) (-776.178) (-774.631) * (-776.865) (-774.127) (-775.100) [-772.497] -- 0:00:35
      412500 -- (-777.450) [-772.547] (-773.799) (-773.238) * (-774.495) (-774.271) [-773.169] (-776.804) -- 0:00:37
      413000 -- (-776.186) [-773.793] (-772.376) (-778.452) * (-774.425) (-774.383) [-772.840] (-775.613) -- 0:00:36
      413500 -- [-772.836] (-776.560) (-773.685) (-773.323) * (-772.956) (-772.458) (-773.073) [-773.137] -- 0:00:36
      414000 -- (-773.418) [-775.109] (-772.401) (-773.147) * (-774.801) [-773.795] (-773.457) (-772.725) -- 0:00:36
      414500 -- [-774.821] (-772.179) (-772.997) (-774.934) * (-772.171) [-773.231] (-771.663) (-773.464) -- 0:00:36
      415000 -- (-777.522) (-780.605) [-776.640] (-773.484) * [-771.931] (-778.305) (-771.663) (-778.069) -- 0:00:36

      Average standard deviation of split frequencies: 0.008799

      415500 -- (-777.277) (-782.812) (-771.862) [-772.675] * (-772.963) (-772.860) [-772.589] (-772.593) -- 0:00:36
      416000 -- (-776.234) (-773.676) (-772.465) [-772.238] * (-772.597) (-773.095) (-777.023) [-774.286] -- 0:00:36
      416500 -- (-772.950) (-779.829) [-774.943] (-772.299) * (-773.084) (-774.061) (-775.044) [-772.863] -- 0:00:36
      417000 -- [-774.138] (-771.871) (-775.028) (-774.862) * [-772.712] (-775.296) (-774.246) (-772.243) -- 0:00:36
      417500 -- (-772.900) (-772.147) (-773.253) [-772.568] * (-772.974) (-779.236) [-775.913] (-773.133) -- 0:00:36
      418000 -- (-771.741) (-772.803) [-774.672] (-772.633) * (-773.290) [-771.933] (-773.836) (-773.457) -- 0:00:36
      418500 -- (-772.763) (-772.889) [-776.169] (-772.770) * [-773.040] (-773.373) (-773.213) (-775.807) -- 0:00:36
      419000 -- (-773.135) [-776.613] (-774.596) (-773.859) * (-774.164) (-776.742) [-773.256] (-778.532) -- 0:00:36
      419500 -- (-772.855) [-773.542] (-774.345) (-774.094) * (-774.302) (-778.222) [-773.398] (-775.615) -- 0:00:35
      420000 -- [-774.913] (-774.013) (-774.833) (-772.584) * [-772.833] (-774.695) (-775.538) (-774.829) -- 0:00:35

      Average standard deviation of split frequencies: 0.008833

      420500 -- (-774.958) (-774.335) [-773.422] (-774.856) * (-771.739) (-773.895) [-774.533] (-777.054) -- 0:00:35
      421000 -- [-774.361] (-775.673) (-778.492) (-773.789) * (-771.583) (-773.165) (-772.125) [-772.845] -- 0:00:35
      421500 -- (-774.566) [-771.632] (-780.682) (-774.917) * [-776.863] (-771.868) (-772.329) (-777.334) -- 0:00:35
      422000 -- (-772.903) (-773.771) [-775.532] (-776.462) * (-772.787) (-772.503) (-772.336) [-776.664] -- 0:00:35
      422500 -- (-774.235) (-772.879) (-776.036) [-773.519] * [-771.772] (-771.617) (-774.170) (-772.740) -- 0:00:35
      423000 -- (-771.640) [-772.171] (-775.711) (-773.806) * (-776.221) [-772.242] (-773.248) (-772.548) -- 0:00:35
      423500 -- (-772.911) (-774.073) (-772.278) [-772.421] * (-776.700) [-771.886] (-778.994) (-772.050) -- 0:00:35
      424000 -- (-773.271) (-775.865) (-772.537) [-771.847] * (-772.310) (-772.250) [-772.056] (-773.221) -- 0:00:35
      424500 -- (-774.468) (-773.394) [-779.015] (-773.640) * (-775.748) (-774.747) [-773.011] (-772.811) -- 0:00:35
      425000 -- (-773.671) (-771.854) (-776.032) [-777.221] * [-772.546] (-774.490) (-772.341) (-776.837) -- 0:00:35

      Average standard deviation of split frequencies: 0.007876

      425500 -- (-774.685) [-771.751] (-777.631) (-778.677) * (-775.262) (-776.870) [-772.430] (-773.071) -- 0:00:35
      426000 -- (-773.435) (-775.183) [-776.417] (-773.746) * (-772.142) (-773.477) (-774.988) [-772.964] -- 0:00:35
      426500 -- (-772.958) (-774.645) (-775.681) [-773.429] * (-773.031) [-772.627] (-772.916) (-773.752) -- 0:00:34
      427000 -- (-772.608) (-773.772) [-774.162] (-774.706) * (-774.596) [-773.477] (-775.467) (-775.283) -- 0:00:34
      427500 -- (-774.658) (-776.006) (-773.588) [-772.346] * [-772.260] (-776.337) (-777.028) (-776.681) -- 0:00:34
      428000 -- [-774.497] (-771.980) (-775.572) (-776.479) * (-775.031) (-773.447) (-771.533) [-776.429] -- 0:00:34
      428500 -- (-774.456) (-772.181) (-777.292) [-779.104] * (-774.920) (-774.003) [-771.603] (-775.869) -- 0:00:34
      429000 -- [-773.373] (-773.381) (-772.464) (-773.471) * (-774.505) [-774.000] (-772.380) (-774.963) -- 0:00:35
      429500 -- (-773.100) (-773.008) [-772.000] (-773.091) * (-775.700) (-775.771) [-772.467] (-773.960) -- 0:00:35
      430000 -- [-771.888] (-772.862) (-772.346) (-773.830) * [-776.576] (-776.332) (-776.294) (-773.575) -- 0:00:35

      Average standard deviation of split frequencies: 0.007662

      430500 -- [-771.823] (-773.689) (-774.131) (-774.785) * (-778.020) (-773.218) [-774.980] (-774.624) -- 0:00:35
      431000 -- (-774.752) (-772.916) (-772.395) [-772.155] * (-773.602) [-772.167] (-771.967) (-779.100) -- 0:00:35
      431500 -- (-776.970) (-773.807) [-772.839] (-774.580) * (-775.767) [-772.573] (-772.689) (-774.552) -- 0:00:35
      432000 -- [-771.565] (-773.438) (-771.722) (-774.381) * [-774.451] (-772.549) (-775.269) (-775.730) -- 0:00:35
      432500 -- (-773.177) [-772.385] (-772.251) (-774.237) * (-775.084) [-771.682] (-774.369) (-778.825) -- 0:00:35
      433000 -- (-773.942) (-771.911) (-777.281) [-772.496] * (-775.208) (-771.577) [-776.932] (-774.268) -- 0:00:35
      433500 -- (-773.809) (-776.453) [-773.446] (-772.064) * (-772.627) (-771.669) (-776.938) [-772.787] -- 0:00:35
      434000 -- [-772.466] (-772.443) (-773.036) (-772.226) * (-771.983) [-773.078] (-775.169) (-775.046) -- 0:00:35
      434500 -- [-771.855] (-776.834) (-772.951) (-772.684) * [-776.696] (-774.728) (-774.901) (-774.629) -- 0:00:35
      435000 -- (-772.037) [-773.395] (-774.583) (-774.039) * [-772.412] (-775.635) (-774.859) (-774.500) -- 0:00:35

      Average standard deviation of split frequencies: 0.007886

      435500 -- (-774.263) (-772.650) (-777.174) [-772.006] * (-774.810) (-774.104) (-773.489) [-774.754] -- 0:00:34
      436000 -- (-774.561) (-772.004) [-772.721] (-775.567) * (-773.457) [-774.720] (-774.207) (-773.603) -- 0:00:34
      436500 -- (-772.204) (-775.223) [-773.169] (-772.559) * (-773.190) [-773.183] (-771.800) (-772.701) -- 0:00:34
      437000 -- (-773.143) (-775.921) (-773.740) [-773.104] * (-775.877) (-771.925) [-771.629] (-774.322) -- 0:00:34
      437500 -- (-773.265) (-775.897) [-773.501] (-775.167) * [-774.919] (-773.048) (-772.596) (-772.573) -- 0:00:34
      438000 -- [-777.406] (-773.868) (-773.833) (-776.653) * (-774.374) (-773.738) [-774.133] (-772.317) -- 0:00:34
      438500 -- (-776.853) (-773.401) [-772.701] (-778.056) * (-775.231) (-774.939) (-776.785) [-778.154] -- 0:00:34
      439000 -- (-772.994) [-775.640] (-775.867) (-777.369) * (-772.308) (-775.569) [-773.016] (-773.971) -- 0:00:34
      439500 -- (-772.423) [-775.313] (-773.932) (-773.637) * (-772.691) (-772.937) [-774.221] (-772.925) -- 0:00:34
      440000 -- [-775.413] (-773.664) (-774.392) (-775.436) * [-772.257] (-771.715) (-776.037) (-773.693) -- 0:00:34

      Average standard deviation of split frequencies: 0.008432

      440500 -- (-773.298) [-772.339] (-776.212) (-773.250) * (-772.882) [-772.453] (-774.216) (-771.580) -- 0:00:34
      441000 -- (-772.591) (-775.874) (-776.041) [-774.535] * (-773.742) (-772.520) (-776.612) [-772.039] -- 0:00:34
      441500 -- (-773.710) (-773.488) (-772.528) [-773.811] * [-774.102] (-775.296) (-775.700) (-773.256) -- 0:00:34
      442000 -- [-773.586] (-774.085) (-771.832) (-774.797) * (-775.007) (-773.636) (-774.292) [-772.163] -- 0:00:34
      442500 -- (-772.918) (-772.957) [-773.467] (-775.173) * (-773.322) (-771.490) [-773.050] (-773.053) -- 0:00:34
      443000 -- (-771.906) (-774.442) (-772.804) [-774.752] * (-772.869) (-773.735) [-777.963] (-772.482) -- 0:00:33
      443500 -- (-773.361) [-774.827] (-775.131) (-773.023) * (-772.829) (-774.183) (-774.470) [-772.970] -- 0:00:33
      444000 -- (-775.655) (-771.756) [-773.438] (-771.507) * [-772.911] (-774.967) (-771.906) (-775.778) -- 0:00:33
      444500 -- (-774.571) [-772.066] (-773.752) (-772.511) * (-774.987) [-774.421] (-778.445) (-773.187) -- 0:00:33
      445000 -- (-774.212) (-773.426) [-775.848] (-772.776) * [-772.407] (-772.566) (-772.939) (-772.453) -- 0:00:33

      Average standard deviation of split frequencies: 0.008331

      445500 -- (-774.792) (-774.437) [-773.214] (-773.886) * (-773.920) (-774.891) (-772.548) [-772.294] -- 0:00:33
      446000 -- (-775.045) [-776.647] (-776.052) (-774.527) * (-777.944) (-777.400) (-773.494) [-778.921] -- 0:00:34
      446500 -- (-779.760) [-773.173] (-775.038) (-778.356) * (-773.002) (-777.216) [-772.023] (-773.185) -- 0:00:34
      447000 -- (-773.838) (-774.212) (-773.158) [-779.954] * [-773.358] (-774.377) (-778.203) (-775.054) -- 0:00:34
      447500 -- (-774.305) [-773.786] (-771.693) (-780.561) * (-771.873) (-772.359) (-772.474) [-773.625] -- 0:00:34
      448000 -- (-773.282) (-776.705) [-772.655] (-777.020) * (-772.736) [-771.899] (-774.380) (-773.479) -- 0:00:34
      448500 -- (-775.346) (-777.836) (-777.035) [-773.806] * [-773.455] (-773.602) (-775.279) (-775.035) -- 0:00:34
      449000 -- (-772.767) (-772.883) (-775.666) [-776.293] * (-773.301) [-774.409] (-773.568) (-773.088) -- 0:00:34
      449500 -- [-775.331] (-772.927) (-773.572) (-773.147) * (-774.292) [-774.658] (-773.710) (-772.885) -- 0:00:34
      450000 -- (-774.664) (-772.811) (-775.579) [-773.119] * (-776.118) (-775.602) (-773.263) [-774.999] -- 0:00:34

      Average standard deviation of split frequencies: 0.008307

      450500 -- (-772.119) (-774.598) (-776.363) [-774.460] * [-772.893] (-775.758) (-772.113) (-771.730) -- 0:00:34
      451000 -- (-772.816) (-773.113) [-772.755] (-775.520) * (-772.441) [-773.601] (-772.566) (-775.862) -- 0:00:34
      451500 -- (-776.523) (-776.231) (-774.960) [-775.874] * (-772.287) (-776.143) (-772.915) [-773.528] -- 0:00:34
      452000 -- (-776.095) (-773.261) (-772.582) [-772.606] * [-772.535] (-775.904) (-773.514) (-778.012) -- 0:00:33
      452500 -- (-776.083) [-772.377] (-772.701) (-771.873) * (-773.284) [-775.665] (-772.653) (-774.216) -- 0:00:33
      453000 -- (-773.231) [-774.806] (-776.149) (-772.988) * (-773.525) (-772.492) [-776.076] (-774.104) -- 0:00:33
      453500 -- (-776.240) [-773.789] (-777.062) (-772.010) * (-772.853) (-772.238) (-776.278) [-772.440] -- 0:00:33
      454000 -- (-772.634) [-773.313] (-774.908) (-778.064) * (-771.654) (-773.194) [-773.486] (-773.664) -- 0:00:33
      454500 -- [-772.856] (-774.341) (-772.445) (-778.024) * (-773.209) (-772.785) (-772.646) [-779.245] -- 0:00:33
      455000 -- (-774.944) (-776.391) (-774.781) [-775.340] * (-772.187) (-775.401) (-772.688) [-775.618] -- 0:00:33

      Average standard deviation of split frequencies: 0.007601

      455500 -- (-779.963) (-775.399) (-773.189) [-772.666] * (-772.534) (-775.188) (-773.616) [-774.751] -- 0:00:33
      456000 -- [-773.358] (-776.454) (-772.766) (-772.970) * [-773.517] (-773.602) (-773.497) (-773.208) -- 0:00:33
      456500 -- (-774.263) (-772.659) (-772.830) [-773.195] * [-772.855] (-774.086) (-771.536) (-774.196) -- 0:00:33
      457000 -- [-773.197] (-772.467) (-773.869) (-771.752) * (-774.702) [-774.057] (-771.805) (-773.686) -- 0:00:33
      457500 -- (-774.646) [-773.855] (-774.380) (-774.752) * [-777.388] (-771.754) (-772.504) (-771.520) -- 0:00:33
      458000 -- (-774.370) (-774.527) [-774.301] (-774.939) * [-773.771] (-775.685) (-771.879) (-773.151) -- 0:00:33
      458500 -- [-773.929] (-776.132) (-773.367) (-774.694) * (-772.131) (-773.684) (-773.165) [-773.344] -- 0:00:33
      459000 -- (-774.883) [-773.609] (-774.053) (-774.007) * [-773.086] (-773.204) (-774.614) (-772.347) -- 0:00:33
      459500 -- (-774.338) (-772.574) (-775.937) [-773.124] * (-772.817) (-773.847) (-777.998) [-771.983] -- 0:00:32
      460000 -- (-773.994) (-775.176) (-774.781) [-774.279] * [-772.635] (-772.034) (-778.740) (-773.512) -- 0:00:32

      Average standard deviation of split frequencies: 0.007355

      460500 -- (-774.918) [-778.167] (-775.944) (-774.429) * (-775.195) (-774.372) [-774.637] (-774.864) -- 0:00:32
      461000 -- (-774.797) (-785.235) [-776.013] (-774.265) * (-775.331) (-773.297) [-774.693] (-778.746) -- 0:00:32
      461500 -- (-774.457) (-774.708) (-773.977) [-775.605] * (-772.350) (-775.132) [-773.103] (-775.116) -- 0:00:32
      462000 -- (-774.911) (-772.243) (-772.477) [-774.847] * (-772.262) (-774.610) [-774.261] (-773.689) -- 0:00:32
      462500 -- [-771.959] (-772.123) (-774.330) (-776.086) * (-772.387) (-775.652) (-779.877) [-772.056] -- 0:00:33
      463000 -- (-774.139) [-774.305] (-775.195) (-776.158) * [-772.320] (-771.420) (-774.348) (-773.289) -- 0:00:33
      463500 -- (-775.668) (-772.784) (-776.822) [-773.963] * (-772.720) (-772.705) (-775.375) [-772.871] -- 0:00:33
      464000 -- (-772.894) [-774.115] (-774.081) (-773.529) * (-773.302) (-774.185) (-774.815) [-772.366] -- 0:00:33
      464500 -- (-771.662) (-774.808) [-772.636] (-773.968) * (-783.860) (-773.229) [-772.426] (-771.515) -- 0:00:33
      465000 -- (-773.101) (-773.613) [-773.848] (-772.741) * (-774.795) (-773.230) (-774.719) [-776.219] -- 0:00:33

      Average standard deviation of split frequencies: 0.007587

      465500 -- (-773.101) (-774.392) (-774.992) [-771.927] * (-772.511) (-773.187) (-773.028) [-772.925] -- 0:00:33
      466000 -- (-772.319) (-775.304) [-776.033] (-771.920) * (-772.760) (-775.904) (-775.430) [-772.934] -- 0:00:33
      466500 -- [-774.200] (-775.276) (-776.228) (-772.488) * (-773.113) (-774.498) (-772.147) [-772.874] -- 0:00:33
      467000 -- [-772.340] (-779.259) (-776.950) (-774.406) * [-772.305] (-778.376) (-771.696) (-773.086) -- 0:00:33
      467500 -- (-771.688) [-774.562] (-772.322) (-772.187) * (-772.780) (-773.300) [-772.021] (-775.690) -- 0:00:33
      468000 -- (-773.315) (-772.860) [-774.212] (-775.864) * (-772.549) (-777.682) [-772.266] (-773.887) -- 0:00:32
      468500 -- [-772.288] (-773.344) (-773.129) (-774.608) * (-772.513) (-774.770) [-773.346] (-778.429) -- 0:00:32
      469000 -- (-772.153) (-773.777) [-772.372] (-772.872) * (-774.599) (-773.504) (-773.891) [-773.659] -- 0:00:32
      469500 -- [-773.790] (-774.499) (-773.849) (-774.243) * [-775.456] (-773.107) (-771.803) (-776.738) -- 0:00:32
      470000 -- (-774.080) [-774.790] (-776.008) (-778.908) * (-772.396) [-773.021] (-772.700) (-772.422) -- 0:00:32

      Average standard deviation of split frequencies: 0.006477

      470500 -- (-774.145) [-775.508] (-775.680) (-782.027) * (-775.663) (-771.528) [-772.733] (-772.436) -- 0:00:32
      471000 -- (-771.940) [-772.340] (-772.093) (-776.544) * [-773.043] (-772.868) (-774.154) (-771.570) -- 0:00:32
      471500 -- (-772.327) [-773.276] (-773.272) (-773.145) * [-774.295] (-777.539) (-773.979) (-772.307) -- 0:00:32
      472000 -- (-771.854) [-772.890] (-772.229) (-773.210) * (-773.917) (-772.747) (-774.430) [-778.264] -- 0:00:32
      472500 -- (-771.383) (-775.444) [-772.543] (-773.195) * (-776.460) (-772.437) (-777.762) [-774.680] -- 0:00:32
      473000 -- (-774.417) [-774.102] (-776.186) (-773.151) * (-773.061) (-771.944) (-774.570) [-773.540] -- 0:00:32
      473500 -- (-774.850) (-772.654) (-774.038) [-773.921] * (-773.055) (-772.047) [-774.713] (-776.385) -- 0:00:32
      474000 -- [-774.083] (-775.731) (-774.437) (-774.863) * (-773.912) (-774.525) [-771.951] (-773.394) -- 0:00:32
      474500 -- (-772.349) [-772.286] (-774.634) (-775.368) * (-773.430) (-774.793) (-774.572) [-776.572] -- 0:00:32
      475000 -- (-772.119) (-775.007) [-773.303] (-773.211) * [-773.951] (-775.288) (-773.162) (-777.092) -- 0:00:32

      Average standard deviation of split frequencies: 0.006470

      475500 -- (-773.266) (-772.681) (-774.628) [-775.186] * (-775.437) [-775.154] (-773.683) (-777.402) -- 0:00:31
      476000 -- [-773.846] (-775.898) (-775.837) (-775.110) * [-775.806] (-772.089) (-774.154) (-776.084) -- 0:00:31
      476500 -- (-773.073) (-774.899) (-778.834) [-772.972] * (-773.045) (-772.078) [-772.735] (-779.047) -- 0:00:31
      477000 -- (-773.009) (-772.636) (-771.562) [-772.566] * (-773.407) [-772.867] (-773.898) (-776.306) -- 0:00:31
      477500 -- [-772.598] (-773.656) (-773.375) (-774.083) * [-773.544] (-771.517) (-774.154) (-774.104) -- 0:00:31
      478000 -- (-777.732) (-774.409) [-772.762] (-774.050) * (-775.342) (-771.642) [-772.548] (-774.859) -- 0:00:31
      478500 -- (-773.761) [-772.446] (-771.466) (-775.318) * [-775.239] (-773.892) (-772.743) (-773.032) -- 0:00:31
      479000 -- (-774.511) (-775.159) (-773.576) [-773.521] * (-773.602) [-775.241] (-775.757) (-773.523) -- 0:00:31
      479500 -- [-773.446] (-773.947) (-771.815) (-774.310) * (-774.123) [-774.060] (-773.451) (-773.044) -- 0:00:32
      480000 -- (-774.078) [-781.259] (-771.782) (-773.467) * [-773.677] (-773.404) (-774.089) (-774.919) -- 0:00:32

      Average standard deviation of split frequencies: 0.006342

      480500 -- (-774.645) (-781.430) [-775.119] (-772.505) * (-773.300) (-772.361) (-774.057) [-774.333] -- 0:00:32
      481000 -- [-773.818] (-779.186) (-775.642) (-773.307) * (-774.791) [-773.363] (-773.407) (-773.633) -- 0:00:32
      481500 -- [-773.290] (-772.265) (-777.057) (-772.564) * (-774.638) [-772.285] (-772.432) (-773.336) -- 0:00:32
      482000 -- (-773.955) [-772.716] (-776.659) (-773.770) * (-773.496) (-778.667) (-775.031) [-774.074] -- 0:00:32
      482500 -- (-773.567) [-773.605] (-775.116) (-778.810) * (-773.591) (-777.152) (-772.906) [-774.751] -- 0:00:32
      483000 -- (-772.849) (-775.592) (-774.848) [-773.524] * (-775.842) (-778.812) [-773.990] (-773.984) -- 0:00:32
      483500 -- [-773.089] (-772.484) (-773.664) (-775.081) * (-784.735) (-776.971) (-772.999) [-772.906] -- 0:00:32
      484000 -- (-773.274) (-772.857) [-772.859] (-773.090) * (-777.538) (-773.733) [-773.904] (-772.543) -- 0:00:31
      484500 -- (-772.769) [-773.575] (-774.451) (-777.979) * [-773.626] (-775.544) (-773.203) (-772.870) -- 0:00:31
      485000 -- (-771.737) (-772.300) (-778.353) [-772.809] * [-771.933] (-776.320) (-776.009) (-771.496) -- 0:00:31

      Average standard deviation of split frequencies: 0.006487

      485500 -- [-773.028] (-772.578) (-779.980) (-772.280) * [-780.196] (-780.418) (-772.001) (-779.456) -- 0:00:31
      486000 -- [-774.307] (-772.120) (-776.189) (-772.692) * (-772.270) (-775.571) (-772.622) [-773.941] -- 0:00:31
      486500 -- [-775.104] (-779.096) (-773.194) (-773.694) * (-773.216) (-775.740) (-777.773) [-774.822] -- 0:00:31
      487000 -- (-774.591) (-776.103) [-773.988] (-772.582) * (-772.065) (-773.002) [-772.380] (-775.146) -- 0:00:31
      487500 -- [-771.668] (-774.268) (-774.698) (-771.965) * [-774.194] (-774.598) (-774.582) (-777.955) -- 0:00:31
      488000 -- (-773.136) [-773.916] (-785.499) (-771.627) * (-775.966) (-774.609) [-774.964] (-779.170) -- 0:00:31
      488500 -- (-772.164) (-774.682) (-777.544) [-773.149] * [-774.131] (-774.372) (-775.812) (-776.270) -- 0:00:31
      489000 -- (-773.117) (-774.860) (-777.891) [-774.504] * (-772.715) (-772.336) (-779.010) [-774.681] -- 0:00:31
      489500 -- (-771.809) [-773.047] (-773.390) (-772.430) * (-774.457) (-772.766) (-773.981) [-772.861] -- 0:00:31
      490000 -- [-773.090] (-779.276) (-773.676) (-773.649) * (-775.080) [-774.156] (-773.389) (-774.221) -- 0:00:31

      Average standard deviation of split frequencies: 0.007926

      490500 -- (-772.567) (-774.159) (-774.892) [-774.207] * (-774.644) (-773.529) [-776.069] (-773.485) -- 0:00:31
      491000 -- (-773.302) (-772.231) (-773.091) [-776.895] * (-774.151) (-772.355) [-773.265] (-773.394) -- 0:00:31
      491500 -- (-771.884) (-773.652) (-775.149) [-772.828] * [-774.657] (-772.741) (-774.352) (-775.485) -- 0:00:31
      492000 -- (-773.797) [-773.329] (-774.825) (-777.269) * [-774.377] (-772.715) (-776.608) (-772.554) -- 0:00:30
      492500 -- [-771.909] (-774.489) (-772.929) (-777.433) * (-772.540) (-772.412) [-771.719] (-772.367) -- 0:00:30
      493000 -- (-771.958) (-772.706) [-772.747] (-772.045) * (-774.266) (-771.885) [-772.899] (-773.162) -- 0:00:30
      493500 -- [-771.935] (-771.702) (-773.927) (-772.779) * [-772.762] (-771.954) (-773.160) (-773.042) -- 0:00:30
      494000 -- [-771.729] (-774.997) (-776.371) (-772.192) * (-772.589) [-772.404] (-771.919) (-773.480) -- 0:00:30
      494500 -- (-772.945) (-771.899) (-773.432) [-772.455] * [-773.198] (-771.706) (-772.689) (-773.134) -- 0:00:30
      495000 -- (-776.435) (-772.956) [-775.783] (-773.515) * (-774.068) (-771.546) (-773.662) [-771.734] -- 0:00:30

      Average standard deviation of split frequencies: 0.007350

      495500 -- (-777.850) (-773.469) (-774.871) [-774.036] * (-773.395) [-773.223] (-773.647) (-774.109) -- 0:00:30
      496000 -- (-773.203) (-771.992) (-772.434) [-774.789] * (-776.505) (-772.626) (-772.982) [-773.427] -- 0:00:31
      496500 -- [-775.392] (-772.171) (-774.892) (-776.514) * (-776.602) (-773.466) (-773.304) [-773.619] -- 0:00:31
      497000 -- (-776.294) (-773.882) (-773.147) [-772.930] * (-776.290) [-772.331] (-774.813) (-772.247) -- 0:00:31
      497500 -- (-775.699) (-774.310) [-773.416] (-771.967) * [-773.511] (-775.746) (-774.401) (-773.320) -- 0:00:31
      498000 -- (-776.434) (-774.017) [-774.305] (-775.497) * (-773.081) (-771.835) (-775.706) [-778.997] -- 0:00:31
      498500 -- (-775.136) [-778.519] (-774.674) (-776.068) * (-775.004) (-772.270) [-771.684] (-773.086) -- 0:00:31
      499000 -- (-774.186) (-779.013) (-774.083) [-774.226] * (-776.213) (-772.252) (-773.036) [-771.935] -- 0:00:31
      499500 -- [-773.554] (-790.338) (-773.510) (-773.107) * (-776.589) (-773.600) (-776.473) [-772.399] -- 0:00:31
      500000 -- (-774.445) [-772.254] (-772.070) (-775.905) * (-773.849) [-773.697] (-773.858) (-772.016) -- 0:00:31

      Average standard deviation of split frequencies: 0.007846

      500500 -- [-771.570] (-775.171) (-772.251) (-773.921) * [-773.398] (-773.727) (-775.333) (-775.904) -- 0:00:30
      501000 -- [-774.158] (-775.343) (-773.972) (-775.081) * (-774.861) (-775.224) (-773.340) [-773.384] -- 0:00:30
      501500 -- (-781.542) (-772.100) [-773.862] (-772.087) * (-773.370) (-779.158) (-773.901) [-777.634] -- 0:00:30
      502000 -- (-772.522) (-772.027) (-774.602) [-774.045] * [-773.313] (-774.307) (-776.629) (-775.604) -- 0:00:30
      502500 -- (-773.216) (-773.998) (-772.136) [-772.196] * (-774.077) (-773.732) (-777.835) [-772.421] -- 0:00:30
      503000 -- (-772.090) (-772.555) (-772.383) [-771.704] * (-777.563) (-772.827) (-776.763) [-775.145] -- 0:00:30
      503500 -- (-773.224) (-777.516) [-773.318] (-772.813) * (-772.780) (-773.547) [-771.958] (-771.884) -- 0:00:30
      504000 -- [-773.093] (-773.625) (-774.700) (-773.235) * (-774.085) (-776.817) (-777.457) [-771.944] -- 0:00:30
      504500 -- (-774.605) [-774.006] (-772.757) (-772.207) * (-774.488) (-774.571) [-775.568] (-774.621) -- 0:00:30
      505000 -- (-774.109) (-774.589) (-772.808) [-772.836] * (-775.382) (-773.667) [-772.289] (-772.226) -- 0:00:30

      Average standard deviation of split frequencies: 0.008268

      505500 -- [-773.564] (-775.391) (-777.298) (-772.630) * (-773.605) [-772.130] (-772.145) (-774.506) -- 0:00:30
      506000 -- (-773.229) [-773.365] (-771.683) (-771.802) * [-775.323] (-773.156) (-775.043) (-774.302) -- 0:00:30
      506500 -- (-777.882) (-771.765) [-772.359] (-771.606) * [-774.009] (-774.386) (-773.459) (-773.327) -- 0:00:30
      507000 -- [-776.387] (-771.829) (-775.110) (-772.427) * (-775.361) (-774.384) (-776.051) [-773.331] -- 0:00:30
      507500 -- (-773.452) [-773.007] (-773.199) (-773.192) * (-773.320) (-771.741) [-772.614] (-773.174) -- 0:00:30
      508000 -- [-773.271] (-774.829) (-773.037) (-773.461) * (-772.831) (-772.860) (-772.956) [-773.658] -- 0:00:30
      508500 -- (-773.842) [-774.471] (-773.870) (-773.724) * (-772.962) (-773.290) [-773.540] (-775.056) -- 0:00:29
      509000 -- (-780.440) [-773.002] (-776.067) (-777.267) * (-774.630) (-773.293) [-773.182] (-777.550) -- 0:00:29
      509500 -- (-778.755) (-772.996) [-772.794] (-773.887) * [-773.403] (-771.908) (-772.956) (-779.271) -- 0:00:29
      510000 -- [-775.095] (-773.095) (-772.210) (-773.477) * (-772.264) (-772.421) (-772.585) [-773.312] -- 0:00:29

      Average standard deviation of split frequencies: 0.008654

      510500 -- [-773.748] (-773.493) (-771.810) (-773.072) * (-772.901) [-774.991] (-773.570) (-773.654) -- 0:00:29
      511000 -- (-773.556) [-772.247] (-777.547) (-774.337) * (-772.774) (-775.852) (-775.001) [-774.152] -- 0:00:29
      511500 -- [-779.239] (-773.219) (-773.994) (-776.419) * (-773.468) (-773.166) (-772.923) [-776.114] -- 0:00:29
      512000 -- (-775.977) (-776.402) [-774.768] (-774.196) * (-772.838) (-774.753) [-773.234] (-775.776) -- 0:00:29
      512500 -- (-772.971) (-774.395) (-773.324) [-774.405] * [-773.696] (-776.830) (-776.326) (-771.792) -- 0:00:29
      513000 -- (-772.045) (-772.670) (-774.699) [-772.433] * [-777.034] (-774.334) (-779.206) (-771.689) -- 0:00:30
      513500 -- (-773.704) [-772.170] (-772.561) (-774.299) * (-775.663) [-773.927] (-772.688) (-771.964) -- 0:00:30
      514000 -- (-773.155) [-773.027] (-774.837) (-775.138) * (-773.062) (-774.153) (-774.498) [-772.557] -- 0:00:30
      514500 -- (-772.217) [-775.119] (-772.842) (-775.689) * (-773.027) [-773.648] (-773.664) (-776.531) -- 0:00:30
      515000 -- (-776.529) [-774.586] (-772.935) (-774.613) * (-773.055) [-772.996] (-773.796) (-775.692) -- 0:00:30

      Average standard deviation of split frequencies: 0.008831

      515500 -- (-772.198) (-777.075) [-773.617] (-775.358) * [-772.011] (-773.947) (-774.722) (-774.710) -- 0:00:30
      516000 -- [-774.080] (-773.363) (-772.675) (-772.721) * (-772.297) [-776.001] (-773.807) (-773.659) -- 0:00:30
      516500 -- (-775.963) [-771.938] (-774.585) (-772.337) * (-774.435) (-773.725) (-774.344) [-772.741] -- 0:00:29
      517000 -- (-772.843) (-772.771) [-777.270] (-773.461) * (-774.607) [-774.818] (-772.494) (-771.943) -- 0:00:29
      517500 -- (-775.025) (-773.176) [-778.439] (-772.825) * (-771.509) [-772.948] (-776.360) (-773.519) -- 0:00:29
      518000 -- [-774.737] (-772.574) (-775.387) (-776.868) * (-772.168) (-784.584) (-773.326) [-772.662] -- 0:00:29
      518500 -- (-771.603) (-775.165) [-772.754] (-773.595) * (-771.881) (-778.312) (-777.072) [-773.063] -- 0:00:29
      519000 -- [-774.176] (-772.045) (-773.108) (-772.216) * (-776.273) (-773.043) [-772.778] (-772.379) -- 0:00:29
      519500 -- [-773.933] (-772.049) (-774.063) (-772.388) * (-776.048) [-772.958] (-772.384) (-773.316) -- 0:00:29
      520000 -- [-774.750] (-777.325) (-773.203) (-773.693) * [-777.166] (-777.622) (-773.380) (-776.047) -- 0:00:29

      Average standard deviation of split frequencies: 0.008631

      520500 -- (-774.701) (-775.072) [-772.134] (-775.943) * [-772.352] (-774.597) (-771.910) (-773.060) -- 0:00:29
      521000 -- (-778.336) (-772.233) (-774.426) [-774.611] * (-772.462) (-776.058) [-772.099] (-773.466) -- 0:00:29
      521500 -- (-775.539) [-776.397] (-772.879) (-773.168) * [-773.768] (-773.229) (-771.880) (-773.449) -- 0:00:29
      522000 -- (-771.607) [-772.205] (-773.608) (-772.835) * (-776.345) (-772.932) (-775.940) [-776.793] -- 0:00:29
      522500 -- [-775.599] (-772.849) (-775.174) (-772.670) * [-776.422] (-773.228) (-772.885) (-776.424) -- 0:00:29
      523000 -- (-776.914) (-773.496) [-772.414] (-774.155) * (-778.893) (-775.473) (-772.955) [-773.770] -- 0:00:29
      523500 -- (-776.270) (-775.678) (-772.111) [-771.974] * (-773.634) (-773.503) [-773.128] (-773.019) -- 0:00:29
      524000 -- (-772.482) (-772.941) (-772.724) [-772.472] * (-772.654) (-774.757) (-772.737) [-775.504] -- 0:00:29
      524500 -- (-774.618) [-775.860] (-771.821) (-773.403) * (-773.750) [-774.544] (-772.616) (-774.397) -- 0:00:29
      525000 -- (-775.465) (-775.221) [-774.525] (-773.529) * (-773.767) (-775.114) (-772.123) [-776.172] -- 0:00:28

      Average standard deviation of split frequencies: 0.008663

      525500 -- (-774.387) (-772.919) (-774.650) [-775.050] * (-776.492) [-776.144] (-772.028) (-773.476) -- 0:00:28
      526000 -- [-772.084] (-773.298) (-774.253) (-775.190) * [-772.745] (-771.935) (-772.564) (-771.897) -- 0:00:28
      526500 -- (-772.698) [-773.776] (-775.434) (-778.218) * (-773.856) (-774.946) (-771.974) [-772.348] -- 0:00:28
      527000 -- [-773.791] (-773.427) (-775.726) (-775.767) * (-773.575) (-775.165) [-773.543] (-772.034) -- 0:00:28
      527500 -- (-775.284) [-773.028] (-775.608) (-774.391) * (-776.592) (-774.696) (-772.063) [-776.116] -- 0:00:28
      528000 -- (-774.572) (-774.236) (-772.983) [-772.948] * [-773.768] (-773.657) (-771.738) (-774.550) -- 0:00:28
      528500 -- (-774.047) [-772.500] (-774.374) (-772.047) * (-771.771) (-772.840) (-772.517) [-773.289] -- 0:00:28
      529000 -- (-772.971) [-772.288] (-771.874) (-775.336) * [-771.665] (-772.789) (-773.564) (-774.905) -- 0:00:28
      529500 -- [-773.380] (-771.854) (-774.150) (-772.211) * [-771.343] (-774.301) (-774.596) (-775.920) -- 0:00:29
      530000 -- (-774.115) (-773.154) (-775.904) [-772.317] * [-771.614] (-776.460) (-779.829) (-776.657) -- 0:00:29

      Average standard deviation of split frequencies: 0.008173

      530500 -- [-776.293] (-772.229) (-775.589) (-771.953) * (-777.847) [-776.002] (-773.517) (-773.000) -- 0:00:29
      531000 -- (-775.613) (-773.579) [-772.721] (-774.724) * (-773.119) [-772.857] (-773.757) (-774.689) -- 0:00:29
      531500 -- (-773.483) [-775.915] (-773.824) (-778.776) * (-774.026) (-772.878) (-773.873) [-772.851] -- 0:00:29
      532000 -- (-780.414) [-772.520] (-772.218) (-776.726) * [-773.605] (-776.443) (-775.129) (-780.348) -- 0:00:29
      532500 -- (-774.968) (-776.019) [-775.636] (-774.392) * (-774.077) [-772.478] (-771.890) (-773.546) -- 0:00:28
      533000 -- (-773.829) (-773.083) (-778.370) [-772.658] * (-774.769) [-772.108] (-773.973) (-776.139) -- 0:00:28
      533500 -- (-773.745) [-774.003] (-774.659) (-773.550) * (-774.339) (-776.636) (-774.631) [-775.651] -- 0:00:28
      534000 -- (-776.223) (-775.630) (-774.460) [-773.542] * (-778.145) (-772.445) (-773.014) [-773.845] -- 0:00:28
      534500 -- [-771.455] (-772.618) (-775.697) (-773.939) * (-775.695) (-774.929) (-775.848) [-774.481] -- 0:00:28
      535000 -- (-773.853) (-771.555) (-774.460) [-774.461] * (-776.922) (-775.553) (-774.607) [-773.358] -- 0:00:28

      Average standard deviation of split frequencies: 0.008502

      535500 -- (-773.883) (-772.530) [-773.574] (-776.105) * (-776.857) [-772.610] (-774.172) (-775.041) -- 0:00:28
      536000 -- [-771.900] (-776.145) (-773.782) (-772.504) * (-772.632) (-773.218) [-772.036] (-777.383) -- 0:00:28
      536500 -- (-771.723) (-773.427) [-774.519] (-773.999) * (-772.597) (-773.803) [-772.243] (-780.088) -- 0:00:28
      537000 -- (-772.061) (-774.533) (-773.523) [-777.595] * (-777.688) (-774.052) (-775.045) [-779.600] -- 0:00:28
      537500 -- (-772.610) (-774.729) (-774.909) [-772.264] * [-773.206] (-774.788) (-771.643) (-774.027) -- 0:00:28
      538000 -- [-773.644] (-773.753) (-774.661) (-772.130) * (-774.299) [-775.766] (-771.668) (-776.778) -- 0:00:28
      538500 -- (-776.651) [-771.960] (-772.561) (-773.290) * [-773.563] (-775.067) (-774.699) (-776.678) -- 0:00:28
      539000 -- (-779.375) (-777.240) (-772.984) [-774.716] * [-776.120] (-772.380) (-774.947) (-773.845) -- 0:00:28
      539500 -- (-773.848) (-777.288) [-773.625] (-777.405) * (-772.950) (-772.540) [-774.983] (-777.130) -- 0:00:28
      540000 -- (-773.011) (-777.178) (-774.307) [-777.281] * (-773.873) [-776.106] (-774.754) (-776.708) -- 0:00:28

      Average standard deviation of split frequencies: 0.008370

      540500 -- (-776.133) [-772.957] (-771.943) (-774.177) * (-774.558) (-774.791) [-773.403] (-772.142) -- 0:00:28
      541000 -- [-774.158] (-772.472) (-775.008) (-775.895) * [-774.106] (-775.636) (-773.057) (-772.550) -- 0:00:27
      541500 -- (-773.195) (-772.185) (-775.714) [-774.211] * (-775.069) (-776.364) (-774.502) [-775.446] -- 0:00:27
      542000 -- [-772.563] (-774.396) (-772.188) (-771.877) * (-774.207) (-774.461) [-773.227] (-773.035) -- 0:00:27
      542500 -- (-772.177) [-772.892] (-773.630) (-773.466) * (-772.596) [-772.129] (-772.884) (-772.163) -- 0:00:27
      543000 -- (-775.170) [-773.783] (-774.777) (-775.084) * [-773.162] (-773.850) (-772.611) (-773.491) -- 0:00:27
      543500 -- [-772.765] (-775.046) (-774.610) (-773.787) * (-773.342) (-774.162) (-775.744) [-774.994] -- 0:00:27
      544000 -- [-774.661] (-773.647) (-774.707) (-774.388) * (-772.520) (-771.715) [-772.271] (-774.460) -- 0:00:27
      544500 -- (-776.203) [-773.112] (-772.579) (-771.938) * (-773.738) [-773.689] (-772.814) (-777.480) -- 0:00:27
      545000 -- [-773.878] (-774.771) (-774.737) (-773.330) * (-775.057) (-773.211) [-772.814] (-775.549) -- 0:00:27

      Average standard deviation of split frequencies: 0.007655

      545500 -- (-775.206) [-771.943] (-775.467) (-772.646) * (-775.083) (-773.417) [-771.865] (-772.566) -- 0:00:27
      546000 -- (-772.155) (-771.585) [-772.915] (-772.644) * (-774.675) (-772.429) [-772.736] (-773.716) -- 0:00:28
      546500 -- [-772.871] (-772.623) (-772.356) (-772.153) * [-776.379] (-774.633) (-772.632) (-774.699) -- 0:00:28
      547000 -- [-771.747] (-777.784) (-772.214) (-773.462) * (-774.052) [-773.254] (-777.446) (-775.861) -- 0:00:28
      547500 -- (-772.020) (-774.507) [-772.997] (-776.741) * (-773.404) (-773.329) (-775.022) [-773.322] -- 0:00:28
      548000 -- (-772.089) (-773.460) (-773.899) [-778.762] * [-775.680] (-773.462) (-775.501) (-773.567) -- 0:00:28
      548500 -- (-772.787) (-773.058) (-772.526) [-776.363] * (-776.539) (-780.155) (-773.749) [-774.701] -- 0:00:27
      549000 -- (-772.975) (-772.344) (-774.491) [-773.980] * [-773.311] (-779.318) (-772.817) (-775.597) -- 0:00:27
      549500 -- (-773.111) [-772.344] (-772.557) (-772.453) * [-771.453] (-775.541) (-773.012) (-777.813) -- 0:00:27
      550000 -- (-771.895) (-774.963) (-772.437) [-773.188] * (-776.565) (-780.046) [-772.523] (-777.306) -- 0:00:27

      Average standard deviation of split frequencies: 0.008161

      550500 -- (-777.560) (-774.080) [-774.103] (-774.386) * (-773.878) (-776.798) [-772.558] (-772.374) -- 0:00:27
      551000 -- (-776.282) [-772.196] (-774.522) (-774.729) * (-772.295) (-774.420) (-773.114) [-773.259] -- 0:00:27
      551500 -- (-774.696) [-773.787] (-771.818) (-774.354) * (-774.568) [-775.308] (-772.687) (-778.195) -- 0:00:27
      552000 -- (-777.739) (-777.069) [-774.795] (-773.293) * (-777.235) (-774.088) (-772.337) [-774.423] -- 0:00:27
      552500 -- (-775.013) (-771.662) (-775.135) [-772.660] * [-773.582] (-771.711) (-773.576) (-771.411) -- 0:00:27
      553000 -- (-777.506) (-777.123) (-774.739) [-772.946] * (-773.277) [-772.331] (-776.480) (-772.160) -- 0:00:27
      553500 -- (-775.767) (-772.688) (-774.956) [-772.113] * (-773.138) [-772.701] (-773.704) (-772.845) -- 0:00:27
      554000 -- (-776.001) (-773.249) [-773.934] (-777.090) * (-773.647) (-773.924) (-772.290) [-775.392] -- 0:00:27
      554500 -- (-773.907) [-773.585] (-775.362) (-773.200) * (-772.820) (-776.866) (-772.924) [-776.247] -- 0:00:27
      555000 -- (-773.172) (-779.654) (-772.689) [-774.586] * (-772.222) (-775.367) (-775.224) [-776.746] -- 0:00:27

      Average standard deviation of split frequencies: 0.008931

      555500 -- [-776.539] (-772.854) (-775.227) (-772.521) * (-773.142) [-774.744] (-773.646) (-773.317) -- 0:00:27
      556000 -- (-774.670) (-776.017) (-776.902) [-773.511] * [-772.361] (-774.658) (-772.004) (-772.707) -- 0:00:27
      556500 -- [-774.465] (-773.919) (-774.462) (-776.242) * (-772.579) [-772.392] (-774.289) (-772.804) -- 0:00:27
      557000 -- [-772.876] (-773.179) (-774.801) (-778.068) * (-772.877) (-773.350) [-772.858] (-772.336) -- 0:00:27
      557500 -- [-773.715] (-777.457) (-775.509) (-773.850) * (-773.345) (-771.579) (-774.597) [-775.066] -- 0:00:26
      558000 -- (-774.966) (-772.713) (-773.998) [-778.270] * (-774.468) (-771.809) (-773.417) [-772.906] -- 0:00:26
      558500 -- (-771.635) (-774.906) (-773.599) [-773.170] * (-775.642) (-771.884) [-772.488] (-776.088) -- 0:00:26
      559000 -- (-772.604) [-774.141] (-774.684) (-772.562) * (-775.294) (-773.245) [-774.082] (-776.619) -- 0:00:26
      559500 -- (-772.657) (-773.318) (-775.244) [-771.472] * [-773.770] (-771.395) (-773.462) (-773.868) -- 0:00:26
      560000 -- (-771.623) (-774.362) (-776.311) [-773.186] * [-775.547] (-771.963) (-773.994) (-775.753) -- 0:00:26

      Average standard deviation of split frequencies: 0.008968

      560500 -- [-773.753] (-775.032) (-775.559) (-772.805) * (-777.313) (-775.943) [-773.537] (-775.473) -- 0:00:26
      561000 -- (-774.295) [-772.624] (-774.687) (-778.098) * [-771.787] (-773.110) (-771.948) (-772.978) -- 0:00:26
      561500 -- (-775.754) (-772.959) (-774.507) [-780.655] * (-774.386) (-772.876) (-773.234) [-774.636] -- 0:00:26
      562000 -- (-774.960) (-773.149) [-772.904] (-777.266) * (-774.570) (-773.457) [-777.541] (-775.832) -- 0:00:26
      562500 -- [-774.364] (-772.608) (-771.824) (-775.437) * (-776.136) [-775.750] (-773.545) (-773.146) -- 0:00:27
      563000 -- (-774.405) [-776.187] (-773.159) (-774.014) * (-773.737) (-773.508) [-772.803] (-777.719) -- 0:00:27
      563500 -- [-774.755] (-780.676) (-773.159) (-775.907) * [-772.117] (-772.502) (-773.849) (-773.269) -- 0:00:27
      564000 -- [-773.469] (-773.414) (-771.560) (-775.575) * (-775.061) (-772.674) [-774.028] (-778.156) -- 0:00:27
      564500 -- (-773.964) [-773.570] (-778.923) (-773.912) * (-772.206) (-772.516) [-773.643] (-774.517) -- 0:00:27
      565000 -- [-773.664] (-772.288) (-776.028) (-775.009) * (-774.556) (-773.186) [-773.680] (-772.919) -- 0:00:26

      Average standard deviation of split frequencies: 0.008495

      565500 -- (-777.296) (-773.352) (-771.843) [-773.867] * (-773.822) (-771.942) [-773.069] (-771.953) -- 0:00:26
      566000 -- (-772.689) (-774.276) [-773.574] (-777.133) * (-773.827) [-772.869] (-775.333) (-772.154) -- 0:00:26
      566500 -- [-774.752] (-775.524) (-772.561) (-775.602) * [-771.758] (-778.266) (-774.044) (-775.451) -- 0:00:26
      567000 -- [-775.269] (-774.242) (-773.554) (-773.133) * (-771.438) [-772.513] (-776.999) (-774.274) -- 0:00:26
      567500 -- (-772.749) (-778.785) (-774.664) [-773.075] * (-777.130) [-771.906] (-777.164) (-772.850) -- 0:00:26
      568000 -- [-775.520] (-774.499) (-772.385) (-772.344) * (-775.345) (-772.344) (-776.177) [-772.232] -- 0:00:26
      568500 -- [-775.264] (-775.226) (-778.707) (-774.939) * (-772.642) (-778.856) (-777.649) [-772.195] -- 0:00:26
      569000 -- [-772.045] (-772.971) (-772.743) (-775.388) * (-774.100) (-776.077) [-775.655] (-771.926) -- 0:00:26
      569500 -- [-776.983] (-772.839) (-774.597) (-775.361) * (-773.441) [-774.014] (-776.774) (-771.920) -- 0:00:26
      570000 -- (-772.441) [-772.382] (-774.454) (-778.673) * [-774.267] (-777.191) (-773.849) (-776.048) -- 0:00:26

      Average standard deviation of split frequencies: 0.008977

      570500 -- (-774.031) (-775.487) (-772.508) [-774.176] * (-776.036) [-774.502] (-773.208) (-775.453) -- 0:00:26
      571000 -- (-773.701) (-776.283) (-772.364) [-774.069] * (-778.752) (-772.854) (-773.763) [-771.947] -- 0:00:26
      571500 -- [-772.563] (-774.870) (-772.851) (-773.411) * (-776.611) (-775.359) [-773.781] (-772.107) -- 0:00:26
      572000 -- (-771.977) (-771.655) [-773.289] (-783.238) * (-775.692) [-775.614] (-772.973) (-772.938) -- 0:00:26
      572500 -- [-775.770] (-771.659) (-773.424) (-772.885) * [-774.254] (-774.927) (-773.343) (-774.152) -- 0:00:26
      573000 -- (-773.346) (-771.660) [-773.593] (-772.166) * (-771.400) (-772.486) [-772.202] (-773.219) -- 0:00:26
      573500 -- (-773.858) [-771.660] (-774.792) (-773.973) * [-772.860] (-773.483) (-772.337) (-774.591) -- 0:00:26
      574000 -- [-773.104] (-772.407) (-773.615) (-774.003) * (-774.938) (-776.208) [-772.191] (-774.364) -- 0:00:25
      574500 -- [-772.831] (-773.735) (-776.684) (-777.343) * (-774.174) [-772.426] (-772.223) (-773.155) -- 0:00:25
      575000 -- (-772.573) (-777.768) (-772.240) [-774.893] * [-775.532] (-772.817) (-771.593) (-771.793) -- 0:00:25

      Average standard deviation of split frequencies: 0.009330

      575500 -- (-773.261) (-773.467) (-775.226) [-772.434] * [-774.241] (-773.264) (-775.107) (-773.127) -- 0:00:25
      576000 -- (-772.810) (-773.397) (-773.356) [-773.983] * [-774.990] (-775.780) (-778.634) (-772.214) -- 0:00:25
      576500 -- (-776.627) (-772.342) (-772.196) [-773.316] * [-773.162] (-773.444) (-772.035) (-776.817) -- 0:00:25
      577000 -- (-777.816) [-773.258] (-772.861) (-775.591) * (-774.550) [-773.156] (-772.033) (-777.946) -- 0:00:25
      577500 -- (-773.697) (-773.827) [-772.914] (-772.690) * [-774.695] (-774.085) (-771.869) (-775.402) -- 0:00:25
      578000 -- [-775.454] (-774.538) (-772.569) (-772.746) * (-771.625) (-774.453) (-774.615) [-776.080] -- 0:00:25
      578500 -- [-773.524] (-776.944) (-777.305) (-774.314) * [-772.400] (-772.539) (-775.138) (-775.103) -- 0:00:25
      579000 -- (-776.240) (-773.656) (-774.607) [-771.977] * (-772.633) (-772.829) (-776.700) [-774.420] -- 0:00:26
      579500 -- [-774.515] (-772.888) (-772.773) (-775.449) * (-773.383) (-773.485) (-772.813) [-775.999] -- 0:00:26
      580000 -- [-773.862] (-773.285) (-771.814) (-771.673) * (-772.453) (-771.571) (-772.627) [-772.461] -- 0:00:26

      Average standard deviation of split frequencies: 0.009580

      580500 -- (-772.716) (-772.725) (-771.558) [-771.535] * (-771.900) (-774.506) [-771.686] (-772.720) -- 0:00:26
      581000 -- (-773.716) (-772.133) [-772.594] (-773.432) * (-771.650) [-773.238] (-771.788) (-773.715) -- 0:00:25
      581500 -- (-772.267) [-776.118] (-773.077) (-773.093) * (-773.056) (-772.085) [-773.470] (-778.286) -- 0:00:25
      582000 -- (-773.005) (-772.603) [-772.742] (-773.249) * (-773.159) (-772.433) [-776.866] (-772.556) -- 0:00:25
      582500 -- (-771.872) [-772.346] (-772.777) (-775.426) * (-772.467) [-773.690] (-771.834) (-774.671) -- 0:00:25
      583000 -- [-772.938] (-772.671) (-776.722) (-772.840) * (-772.244) (-772.032) (-772.207) [-772.178] -- 0:00:25
      583500 -- (-772.322) (-773.278) (-772.407) [-771.729] * (-775.568) (-775.273) (-776.451) [-773.352] -- 0:00:25
      584000 -- (-773.853) (-773.195) (-772.277) [-771.751] * (-773.255) [-771.840] (-778.020) (-774.815) -- 0:00:25
      584500 -- (-772.750) (-772.404) [-772.903] (-772.918) * (-772.012) [-775.246] (-772.054) (-773.855) -- 0:00:25
      585000 -- (-772.409) (-774.146) [-774.518] (-773.643) * (-772.012) [-773.585] (-772.808) (-773.790) -- 0:00:25

      Average standard deviation of split frequencies: 0.009653

      585500 -- [-776.544] (-772.589) (-772.332) (-772.804) * (-777.867) (-772.993) (-771.887) [-773.164] -- 0:00:25
      586000 -- (-774.131) (-773.662) (-772.156) [-776.323] * (-775.617) (-775.188) (-773.829) [-774.869] -- 0:00:25
      586500 -- (-775.002) (-774.153) (-776.049) [-776.076] * (-771.426) [-772.183] (-775.324) (-776.080) -- 0:00:25
      587000 -- [-772.884] (-773.996) (-772.426) (-776.333) * [-774.960] (-776.021) (-774.005) (-774.046) -- 0:00:25
      587500 -- (-773.136) [-773.569] (-772.825) (-776.648) * (-772.589) [-780.738] (-772.432) (-773.987) -- 0:00:25
      588000 -- [-773.879] (-771.898) (-774.723) (-773.129) * (-773.558) (-776.271) (-775.828) [-773.478] -- 0:00:25
      588500 -- (-773.209) (-772.029) [-772.970] (-772.919) * (-777.489) (-777.374) (-776.320) [-775.942] -- 0:00:25
      589000 -- [-778.496] (-774.246) (-778.056) (-772.465) * (-774.809) (-776.020) [-773.512] (-772.252) -- 0:00:25
      589500 -- [-776.841] (-778.293) (-773.782) (-772.420) * (-775.960) [-773.205] (-773.965) (-772.158) -- 0:00:25
      590000 -- (-774.191) [-776.186] (-772.081) (-774.306) * (-774.123) [-773.240] (-773.899) (-775.170) -- 0:00:25

      Average standard deviation of split frequencies: 0.010109

      590500 -- (-773.236) (-773.244) [-772.387] (-774.979) * (-775.882) [-780.281] (-773.380) (-775.058) -- 0:00:24
      591000 -- [-771.864] (-773.230) (-772.887) (-773.098) * (-771.621) (-778.007) [-772.119] (-772.947) -- 0:00:24
      591500 -- (-774.519) (-772.650) (-774.481) [-773.032] * (-772.694) [-775.446] (-772.203) (-773.710) -- 0:00:24
      592000 -- [-773.589] (-773.701) (-776.513) (-773.031) * [-772.470] (-774.227) (-773.544) (-775.558) -- 0:00:24
      592500 -- (-774.403) (-773.588) [-771.636] (-775.903) * [-772.282] (-772.224) (-774.278) (-773.256) -- 0:00:24
      593000 -- [-773.488] (-773.723) (-772.335) (-774.466) * (-773.517) [-773.604] (-772.285) (-774.269) -- 0:00:24
      593500 -- (-773.909) (-772.254) [-773.721] (-774.049) * [-771.654] (-773.018) (-778.848) (-775.157) -- 0:00:24
      594000 -- (-773.332) (-776.411) [-773.103] (-773.760) * [-773.105] (-773.830) (-777.948) (-774.435) -- 0:00:24
      594500 -- [-772.466] (-772.372) (-772.615) (-772.266) * (-775.039) (-776.432) (-779.260) [-772.796] -- 0:00:24
      595000 -- (-776.386) (-773.708) (-775.903) [-771.911] * [-772.280] (-776.581) (-772.478) (-776.939) -- 0:00:24

      Average standard deviation of split frequencies: 0.009650

      595500 -- [-774.703] (-774.334) (-782.241) (-772.659) * [-772.044] (-772.540) (-772.396) (-774.540) -- 0:00:24
      596000 -- [-772.742] (-774.577) (-772.909) (-773.107) * [-773.470] (-775.269) (-772.137) (-773.300) -- 0:00:25
      596500 -- (-773.671) (-773.878) (-771.872) [-772.392] * (-774.809) (-774.917) [-773.452] (-776.297) -- 0:00:25
      597000 -- [-775.400] (-776.994) (-772.924) (-773.882) * (-775.035) (-772.402) [-772.076] (-775.628) -- 0:00:24
      597500 -- [-774.515] (-772.939) (-775.220) (-772.407) * (-772.835) (-773.210) [-771.947] (-775.502) -- 0:00:24
      598000 -- [-772.324] (-771.929) (-773.940) (-773.279) * [-774.441] (-771.958) (-775.425) (-773.163) -- 0:00:24
      598500 -- (-771.720) (-773.368) [-774.223] (-774.374) * (-778.081) [-776.457] (-772.213) (-772.692) -- 0:00:24
      599000 -- [-771.485] (-772.323) (-773.512) (-776.526) * (-773.379) (-775.543) (-772.303) [-774.762] -- 0:00:24
      599500 -- [-771.544] (-772.643) (-776.938) (-772.627) * (-776.358) [-777.324] (-775.264) (-776.406) -- 0:00:24
      600000 -- [-772.786] (-773.998) (-773.216) (-775.305) * [-773.048] (-773.332) (-775.537) (-776.113) -- 0:00:24

      Average standard deviation of split frequencies: 0.009614

      600500 -- (-771.518) (-773.957) (-773.406) [-775.326] * (-773.260) (-773.878) (-773.228) [-774.676] -- 0:00:24
      601000 -- (-774.628) [-773.235] (-773.419) (-774.118) * (-772.414) (-773.376) [-773.307] (-773.663) -- 0:00:24
      601500 -- [-774.426] (-775.971) (-774.647) (-772.620) * (-773.036) (-777.037) [-772.827] (-776.897) -- 0:00:24
      602000 -- (-775.109) (-775.757) (-775.575) [-772.005] * [-773.228] (-774.818) (-774.384) (-771.748) -- 0:00:24
      602500 -- (-777.699) (-773.540) (-776.743) [-772.887] * (-771.614) (-774.271) [-773.944] (-772.468) -- 0:00:24
      603000 -- [-776.304] (-771.998) (-775.715) (-775.781) * (-772.034) [-772.551] (-772.501) (-774.011) -- 0:00:24
      603500 -- (-775.481) [-773.312] (-777.065) (-773.604) * (-774.334) (-773.831) (-773.931) [-772.509] -- 0:00:24
      604000 -- (-775.215) (-776.598) (-776.708) [-773.780] * (-772.322) (-772.730) [-774.015] (-775.505) -- 0:00:24
      604500 -- (-776.345) [-772.677] (-772.351) (-774.382) * (-773.863) [-776.123] (-773.238) (-773.979) -- 0:00:24
      605000 -- [-771.608] (-775.008) (-772.749) (-775.868) * (-772.831) (-778.408) (-774.230) [-773.521] -- 0:00:24

      Average standard deviation of split frequencies: 0.009127

      605500 -- (-772.710) (-773.144) (-772.722) [-772.239] * (-774.742) [-778.615] (-773.826) (-771.752) -- 0:00:24
      606000 -- (-774.384) (-774.086) (-773.463) [-773.525] * [-773.230] (-776.635) (-773.771) (-772.899) -- 0:00:24
      606500 -- (-777.349) (-774.599) [-774.224] (-773.820) * [-773.601] (-774.755) (-772.436) (-772.714) -- 0:00:24
      607000 -- [-773.643] (-774.078) (-773.052) (-775.058) * (-772.509) (-773.838) [-774.663] (-772.113) -- 0:00:23
      607500 -- (-773.204) [-772.558] (-773.690) (-772.610) * (-772.212) (-772.017) (-773.360) [-776.686] -- 0:00:23
      608000 -- (-772.256) (-772.607) [-772.633] (-775.984) * (-772.957) (-772.652) (-773.324) [-772.180] -- 0:00:23
      608500 -- (-776.060) [-774.682] (-775.186) (-771.654) * (-775.482) (-774.974) (-772.243) [-771.499] -- 0:00:23
      609000 -- (-774.538) (-774.159) [-774.810] (-771.575) * [-775.739] (-774.775) (-772.329) (-773.526) -- 0:00:23
      609500 -- (-773.280) (-773.283) (-774.542) [-771.570] * (-771.888) (-774.639) [-773.501] (-772.489) -- 0:00:23
      610000 -- (-777.569) [-772.943] (-772.177) (-775.093) * (-772.343) (-773.830) (-772.233) [-774.268] -- 0:00:23

      Average standard deviation of split frequencies: 0.009058

      610500 -- (-773.290) [-774.194] (-774.386) (-778.368) * [-772.945] (-778.956) (-774.091) (-773.770) -- 0:00:23
      611000 -- (-774.172) (-775.368) (-775.102) [-774.646] * (-774.480) (-775.595) (-774.881) [-771.840] -- 0:00:23
      611500 -- (-774.964) [-772.353] (-773.170) (-774.052) * (-773.203) (-776.634) [-772.922] (-774.873) -- 0:00:23
      612000 -- (-777.837) [-771.791] (-775.303) (-775.233) * (-775.468) (-774.961) [-772.542] (-777.465) -- 0:00:23
      612500 -- [-776.506] (-772.463) (-779.198) (-776.367) * (-781.156) (-774.964) [-773.047] (-774.357) -- 0:00:24
      613000 -- (-775.231) (-771.890) (-772.019) [-776.258] * (-778.916) (-774.608) [-771.871] (-774.138) -- 0:00:23
      613500 -- (-777.705) (-771.636) [-772.938] (-774.013) * (-778.764) (-772.094) (-771.426) [-771.658] -- 0:00:23
      614000 -- (-772.379) [-771.522] (-776.431) (-773.625) * (-775.233) (-777.201) (-772.774) [-773.177] -- 0:00:23
      614500 -- (-775.281) (-772.900) [-773.335] (-772.447) * (-772.616) (-774.873) (-772.613) [-775.629] -- 0:00:23
      615000 -- (-774.267) (-775.857) [-775.503] (-774.574) * (-776.613) (-773.978) [-774.048] (-772.893) -- 0:00:23

      Average standard deviation of split frequencies: 0.009132

      615500 -- (-774.908) (-774.209) [-773.515] (-777.419) * (-774.975) (-774.281) [-780.071] (-774.960) -- 0:00:23
      616000 -- (-775.627) [-775.384] (-772.159) (-772.879) * [-773.230] (-773.497) (-778.254) (-779.703) -- 0:00:23
      616500 -- (-774.532) [-773.381] (-772.699) (-774.691) * (-773.210) (-772.463) [-776.086] (-774.286) -- 0:00:23
      617000 -- [-776.680] (-773.734) (-775.451) (-772.903) * [-772.729] (-771.665) (-773.099) (-773.084) -- 0:00:23
      617500 -- (-774.679) [-771.863] (-771.664) (-772.277) * (-772.028) (-772.342) [-773.094] (-774.571) -- 0:00:23
      618000 -- (-776.916) [-771.550] (-773.700) (-772.468) * (-774.430) (-774.238) (-771.906) [-772.009] -- 0:00:23
      618500 -- (-772.210) (-772.524) (-775.853) [-774.184] * (-772.734) (-775.990) [-772.735] (-771.964) -- 0:00:23
      619000 -- (-771.704) (-774.231) (-773.069) [-773.756] * (-772.581) [-775.202] (-772.965) (-774.735) -- 0:00:23
      619500 -- [-772.439] (-780.402) (-774.895) (-774.986) * (-773.148) (-776.537) [-773.783] (-774.901) -- 0:00:23
      620000 -- (-773.135) (-780.920) [-774.083] (-773.796) * (-773.025) (-775.475) (-777.823) [-772.667] -- 0:00:23

      Average standard deviation of split frequencies: 0.010127

      620500 -- (-773.133) (-773.146) [-773.786] (-778.006) * [-771.582] (-772.845) (-775.635) (-771.977) -- 0:00:23
      621000 -- (-773.108) (-772.077) [-775.032] (-773.745) * (-772.268) (-778.817) (-775.506) [-772.275] -- 0:00:23
      621500 -- (-772.126) (-772.801) [-775.450] (-773.480) * (-774.455) (-771.851) (-775.560) [-772.041] -- 0:00:23
      622000 -- (-772.686) (-775.253) [-772.239] (-773.212) * (-775.300) (-772.936) [-775.598] (-775.719) -- 0:00:23
      622500 -- (-779.287) [-775.296] (-775.504) (-772.960) * (-774.698) (-773.908) [-772.578] (-778.383) -- 0:00:23
      623000 -- (-780.239) [-773.709] (-771.510) (-772.036) * (-775.225) (-773.577) (-777.218) [-772.985] -- 0:00:22
      623500 -- (-780.197) [-775.372] (-771.717) (-772.842) * (-776.598) [-774.304] (-773.210) (-773.004) -- 0:00:22
      624000 -- [-774.317] (-773.242) (-776.267) (-776.878) * (-777.403) (-772.525) (-773.174) [-773.154] -- 0:00:22
      624500 -- (-776.187) [-774.083] (-775.233) (-776.903) * [-773.050] (-778.736) (-773.183) (-771.450) -- 0:00:22
      625000 -- (-774.336) (-774.096) [-773.294] (-773.419) * (-776.881) (-773.083) (-772.289) [-772.686] -- 0:00:22

      Average standard deviation of split frequencies: 0.010025

      625500 -- [-773.930] (-773.035) (-772.259) (-774.929) * (-771.926) [-779.333] (-771.636) (-774.353) -- 0:00:22
      626000 -- (-776.816) (-775.125) [-772.557] (-777.764) * (-773.419) [-774.797] (-772.108) (-772.746) -- 0:00:22
      626500 -- (-773.564) (-775.246) (-772.453) [-772.315] * (-772.089) (-774.850) (-774.013) [-772.950] -- 0:00:22
      627000 -- (-774.945) (-773.387) (-773.152) [-772.313] * (-771.809) (-778.230) [-776.336] (-775.516) -- 0:00:22
      627500 -- [-773.813] (-775.432) (-776.458) (-775.220) * (-772.143) (-773.437) [-773.944] (-772.712) -- 0:00:22
      628000 -- (-772.633) (-774.567) (-773.112) [-774.228] * (-774.907) (-774.912) [-774.275] (-773.994) -- 0:00:22
      628500 -- [-774.501] (-773.893) (-776.704) (-778.033) * [-772.022] (-775.881) (-773.957) (-780.250) -- 0:00:22
      629000 -- (-778.716) (-772.488) [-774.602] (-773.447) * [-772.810] (-772.830) (-774.389) (-773.965) -- 0:00:23
      629500 -- (-773.280) (-780.234) (-775.158) [-772.303] * [-772.599] (-772.353) (-773.183) (-776.737) -- 0:00:22
      630000 -- (-774.810) (-776.619) [-774.557] (-773.609) * (-776.592) [-772.940] (-772.593) (-775.612) -- 0:00:22

      Average standard deviation of split frequencies: 0.009904

      630500 -- (-772.169) [-775.476] (-775.172) (-773.629) * (-774.151) (-773.309) [-772.060] (-774.629) -- 0:00:22
      631000 -- (-774.647) (-774.531) (-776.213) [-773.391] * (-773.313) [-773.425] (-773.581) (-772.870) -- 0:00:22
      631500 -- (-775.912) (-775.421) [-772.345] (-773.896) * [-773.978] (-773.953) (-773.934) (-773.167) -- 0:00:22
      632000 -- (-776.430) (-775.527) (-772.070) [-778.743] * (-774.612) (-773.721) [-772.801] (-773.643) -- 0:00:22
      632500 -- (-771.886) (-776.559) (-771.923) [-774.594] * [-772.966] (-775.436) (-774.416) (-774.724) -- 0:00:22
      633000 -- [-771.865] (-774.483) (-775.318) (-774.003) * (-773.791) (-774.593) [-772.686] (-773.841) -- 0:00:22
      633500 -- [-772.466] (-776.722) (-772.397) (-773.175) * [-775.357] (-773.814) (-772.438) (-778.235) -- 0:00:22
      634000 -- (-773.537) (-774.219) [-772.261] (-773.586) * (-771.598) [-771.651] (-772.398) (-776.473) -- 0:00:22
      634500 -- [-774.955] (-773.937) (-771.610) (-778.086) * (-772.900) (-772.465) (-772.085) [-778.189] -- 0:00:22
      635000 -- (-774.315) [-774.177] (-775.916) (-777.331) * [-772.180] (-772.820) (-771.905) (-772.637) -- 0:00:22

      Average standard deviation of split frequencies: 0.009080

      635500 -- [-773.539] (-776.012) (-774.166) (-774.842) * (-772.964) [-772.480] (-771.977) (-772.159) -- 0:00:22
      636000 -- (-773.718) (-774.057) (-775.435) [-772.185] * (-773.976) (-776.270) [-772.207] (-772.076) -- 0:00:22
      636500 -- (-774.744) [-773.882] (-773.892) (-774.528) * (-772.799) (-773.896) (-773.510) [-773.337] -- 0:00:22
      637000 -- (-772.592) (-774.337) (-772.253) [-774.034] * (-771.826) [-772.658] (-778.003) (-772.762) -- 0:00:22
      637500 -- (-771.845) (-771.401) (-774.378) [-776.997] * (-772.663) (-772.310) (-780.799) [-773.899] -- 0:00:22
      638000 -- [-773.788] (-772.075) (-775.030) (-774.984) * (-773.104) [-774.105] (-772.042) (-775.771) -- 0:00:22
      638500 -- (-775.815) [-774.337] (-772.806) (-774.645) * (-773.913) (-773.238) [-773.188] (-774.145) -- 0:00:22
      639000 -- [-773.747] (-776.964) (-772.291) (-774.971) * (-772.486) (-771.511) (-772.385) [-774.333] -- 0:00:22
      639500 -- (-773.692) (-773.774) (-774.609) [-772.071] * (-772.377) (-775.385) (-772.792) [-772.163] -- 0:00:21
      640000 -- [-773.096] (-772.895) (-773.543) (-774.093) * (-772.671) (-773.683) [-772.115] (-772.689) -- 0:00:21

      Average standard deviation of split frequencies: 0.008784

      640500 -- (-773.505) (-774.844) (-774.079) [-772.656] * (-774.981) (-776.826) (-778.865) [-774.150] -- 0:00:21
      641000 -- (-773.115) (-771.919) [-771.937] (-772.739) * [-773.667] (-773.734) (-777.823) (-774.851) -- 0:00:21
      641500 -- (-773.087) (-774.254) [-771.930] (-774.422) * [-774.360] (-776.535) (-775.924) (-772.647) -- 0:00:21
      642000 -- (-774.819) [-775.975] (-772.873) (-774.682) * (-776.009) (-774.027) [-774.035] (-771.678) -- 0:00:21
      642500 -- (-775.681) (-774.362) [-774.736] (-776.596) * [-774.673] (-774.557) (-773.955) (-771.346) -- 0:00:21
      643000 -- (-773.028) (-772.858) (-775.377) [-772.916] * (-771.432) (-773.441) (-775.754) [-771.845] -- 0:00:21
      643500 -- [-775.567] (-773.369) (-772.805) (-774.869) * (-771.428) [-773.328] (-783.018) (-772.816) -- 0:00:21
      644000 -- (-777.444) (-774.063) (-775.508) [-772.137] * [-772.852] (-772.605) (-780.188) (-774.254) -- 0:00:21
      644500 -- (-771.832) (-773.396) [-773.172] (-778.602) * (-774.335) (-771.432) (-783.433) [-772.575] -- 0:00:21
      645000 -- [-775.894] (-776.084) (-772.261) (-774.897) * (-773.303) (-772.721) (-772.345) [-772.670] -- 0:00:21

      Average standard deviation of split frequencies: 0.008711

      645500 -- (-774.014) [-773.573] (-774.366) (-773.161) * (-772.175) (-772.616) [-772.648] (-776.778) -- 0:00:21
      646000 -- (-773.062) (-777.455) (-771.775) [-772.736] * [-772.992] (-771.918) (-773.206) (-773.535) -- 0:00:21
      646500 -- (-771.541) [-780.149] (-774.390) (-773.015) * (-775.281) [-772.290] (-772.624) (-773.264) -- 0:00:21
      647000 -- (-775.398) (-776.069) (-773.633) [-775.553] * [-772.402] (-773.132) (-774.269) (-772.098) -- 0:00:21
      647500 -- (-773.381) [-772.766] (-773.756) (-772.997) * [-773.422] (-774.077) (-773.102) (-772.940) -- 0:00:21
      648000 -- (-774.672) [-771.968] (-773.496) (-772.839) * (-774.400) (-774.524) [-773.008] (-772.761) -- 0:00:21
      648500 -- (-773.646) (-774.186) [-774.028] (-773.494) * (-775.328) [-772.622] (-773.363) (-771.965) -- 0:00:21
      649000 -- (-774.482) (-774.323) [-773.469] (-772.657) * (-773.426) (-774.349) [-772.557] (-773.783) -- 0:00:21
      649500 -- (-773.198) [-772.071] (-772.360) (-778.580) * (-773.562) [-773.101] (-771.928) (-780.560) -- 0:00:21
      650000 -- (-774.175) (-775.800) [-775.170] (-775.493) * (-772.923) (-773.176) [-775.497] (-773.580) -- 0:00:21

      Average standard deviation of split frequencies: 0.009192

      650500 -- (-774.345) (-774.872) (-777.779) [-775.229] * (-773.954) (-774.870) [-772.647] (-776.024) -- 0:00:21
      651000 -- (-773.139) [-772.603] (-773.560) (-775.161) * [-773.393] (-772.712) (-774.985) (-780.020) -- 0:00:21
      651500 -- (-773.405) (-775.722) (-774.384) [-775.139] * (-773.388) (-773.748) [-774.156] (-772.244) -- 0:00:21
      652000 -- (-774.264) [-774.830] (-778.038) (-774.005) * [-778.340] (-778.513) (-776.747) (-772.036) -- 0:00:21
      652500 -- [-773.258] (-779.899) (-775.707) (-774.014) * [-773.257] (-776.274) (-772.562) (-774.168) -- 0:00:21
      653000 -- [-774.034] (-774.932) (-777.356) (-773.118) * [-776.539] (-773.119) (-773.077) (-776.793) -- 0:00:21
      653500 -- (-773.386) (-771.332) (-775.469) [-771.838] * [-774.401] (-773.425) (-771.776) (-775.365) -- 0:00:21
      654000 -- [-776.538] (-772.127) (-774.707) (-772.461) * (-774.725) (-775.542) [-773.393] (-773.967) -- 0:00:21
      654500 -- (-775.345) [-778.742] (-775.116) (-779.072) * [-771.985] (-775.625) (-774.201) (-773.993) -- 0:00:21
      655000 -- (-773.196) [-773.683] (-772.367) (-773.102) * (-772.739) (-772.173) [-772.805] (-773.013) -- 0:00:21

      Average standard deviation of split frequencies: 0.009432

      655500 -- (-773.178) (-774.384) [-773.247] (-773.699) * [-773.311] (-774.333) (-772.397) (-774.405) -- 0:00:21
      656000 -- (-773.630) (-775.358) [-773.037] (-775.533) * (-774.676) [-773.853] (-775.283) (-774.853) -- 0:00:20
      656500 -- (-778.872) (-773.113) (-774.795) [-772.306] * (-774.797) (-775.501) (-772.963) [-774.712] -- 0:00:20
      657000 -- (-773.045) (-775.467) [-774.550] (-772.411) * (-773.968) [-772.240] (-774.604) (-772.600) -- 0:00:20
      657500 -- (-779.291) [-773.768] (-774.471) (-773.271) * [-771.609] (-774.432) (-774.209) (-774.027) -- 0:00:20
      658000 -- [-776.316] (-772.634) (-775.600) (-772.646) * (-771.617) [-776.783] (-776.740) (-773.098) -- 0:00:20
      658500 -- [-772.566] (-773.097) (-772.192) (-772.780) * (-771.625) (-778.441) [-781.356] (-776.710) -- 0:00:20
      659000 -- (-771.926) (-772.123) [-775.711] (-773.662) * (-773.606) (-780.780) (-776.528) [-772.428] -- 0:00:20
      659500 -- (-771.303) (-772.266) [-773.677] (-773.993) * [-773.811] (-775.114) (-774.370) (-772.417) -- 0:00:20
      660000 -- [-771.611] (-772.348) (-781.546) (-773.938) * [-773.884] (-775.417) (-776.455) (-774.584) -- 0:00:20

      Average standard deviation of split frequencies: 0.009894

      660500 -- (-773.588) (-771.887) [-777.492] (-773.452) * [-772.537] (-773.281) (-775.451) (-774.478) -- 0:00:20
      661000 -- (-773.918) [-775.019] (-779.251) (-774.921) * [-773.388] (-775.319) (-777.358) (-772.677) -- 0:00:20
      661500 -- (-772.077) [-774.838] (-773.996) (-773.985) * (-772.986) (-772.450) [-776.938] (-772.994) -- 0:00:20
      662000 -- (-772.340) [-772.924] (-776.285) (-774.082) * [-771.590] (-772.077) (-772.703) (-774.143) -- 0:00:20
      662500 -- (-777.790) (-772.792) [-778.118] (-774.427) * (-772.222) (-778.570) [-773.479] (-775.139) -- 0:00:20
      663000 -- (-771.718) [-772.020] (-772.137) (-772.591) * [-772.179] (-776.716) (-775.549) (-774.391) -- 0:00:20
      663500 -- [-772.613] (-772.839) (-771.697) (-772.780) * (-772.523) (-774.550) (-774.211) [-776.949] -- 0:00:20
      664000 -- (-774.793) [-773.141] (-772.021) (-774.925) * [-772.266] (-773.287) (-776.171) (-774.967) -- 0:00:20
      664500 -- (-775.047) (-771.770) (-775.406) [-775.467] * [-773.570] (-774.605) (-772.236) (-772.830) -- 0:00:20
      665000 -- (-775.377) [-773.071] (-774.214) (-775.123) * (-772.751) (-773.130) [-772.247] (-771.968) -- 0:00:20

      Average standard deviation of split frequencies: 0.010287

      665500 -- (-773.618) (-775.076) (-775.571) [-772.708] * (-771.617) (-773.308) (-772.877) [-774.409] -- 0:00:20
      666000 -- [-772.176] (-774.090) (-775.687) (-775.832) * [-779.679] (-773.635) (-776.673) (-772.609) -- 0:00:20
      666500 -- (-776.882) (-774.335) (-773.516) [-774.021] * (-773.654) (-776.659) (-776.597) [-773.283] -- 0:00:20
      667000 -- [-774.017] (-773.958) (-777.043) (-775.105) * (-773.376) [-780.645] (-775.110) (-771.764) -- 0:00:20
      667500 -- (-773.497) (-777.810) (-777.020) [-772.867] * (-775.268) [-775.287] (-774.861) (-773.674) -- 0:00:20
      668000 -- (-772.068) (-773.857) [-771.937] (-772.749) * [-773.693] (-773.039) (-771.559) (-773.825) -- 0:00:20
      668500 -- (-771.824) (-771.756) [-773.982] (-774.191) * (-776.658) [-772.904] (-773.880) (-773.804) -- 0:00:20
      669000 -- (-774.399) (-773.523) [-774.082] (-778.955) * (-771.811) (-772.919) [-773.229] (-773.095) -- 0:00:20
      669500 -- (-772.789) (-772.432) (-773.811) [-773.267] * (-775.900) (-771.992) [-773.973] (-774.221) -- 0:00:20
      670000 -- (-775.654) [-775.454] (-773.329) (-773.843) * (-774.095) [-773.076] (-773.384) (-775.243) -- 0:00:20

      Average standard deviation of split frequencies: 0.010309

      670500 -- (-772.638) (-772.510) [-775.515] (-772.859) * (-776.277) (-771.936) (-775.316) [-776.853] -- 0:00:20
      671000 -- (-773.536) (-773.235) [-772.694] (-772.318) * (-776.208) [-771.634] (-772.321) (-774.412) -- 0:00:20
      671500 -- (-777.131) (-773.824) (-772.509) [-774.186] * [-772.242] (-772.209) (-772.668) (-776.420) -- 0:00:20
      672000 -- (-774.110) [-771.647] (-774.312) (-774.817) * (-772.350) (-773.474) [-772.375] (-775.583) -- 0:00:20
      672500 -- (-772.101) [-776.171] (-774.076) (-774.684) * [-772.118] (-773.955) (-777.443) (-772.838) -- 0:00:19
      673000 -- [-773.140] (-774.536) (-774.338) (-775.093) * (-772.432) (-773.506) (-773.239) [-773.199] -- 0:00:19
      673500 -- (-772.164) (-777.779) (-773.668) [-773.531] * (-772.547) [-772.968] (-773.743) (-772.891) -- 0:00:19
      674000 -- (-771.970) (-774.653) (-774.693) [-778.701] * [-775.614] (-772.359) (-774.797) (-776.071) -- 0:00:19
      674500 -- (-774.999) (-772.398) (-773.501) [-773.054] * (-780.934) (-771.998) [-773.882] (-774.007) -- 0:00:19
      675000 -- (-773.215) (-774.340) (-775.835) [-775.169] * [-774.070] (-773.249) (-772.766) (-774.878) -- 0:00:19

      Average standard deviation of split frequencies: 0.010242

      675500 -- [-772.547] (-775.379) (-774.868) (-771.588) * (-774.707) (-772.779) [-772.967] (-777.059) -- 0:00:19
      676000 -- [-773.166] (-779.964) (-773.121) (-776.891) * [-773.121] (-771.915) (-774.880) (-775.388) -- 0:00:19
      676500 -- (-776.476) (-779.263) [-772.979] (-773.918) * (-771.767) [-772.509] (-775.876) (-772.996) -- 0:00:19
      677000 -- (-772.889) [-773.158] (-773.834) (-776.420) * (-773.105) [-772.146] (-773.414) (-772.867) -- 0:00:19
      677500 -- (-772.705) (-775.892) [-776.943] (-772.260) * (-776.011) (-772.005) (-772.352) [-772.950] -- 0:00:19
      678000 -- (-777.223) (-774.205) [-773.156] (-774.029) * (-772.337) [-773.459] (-776.205) (-771.524) -- 0:00:19
      678500 -- (-774.138) (-774.287) [-774.013] (-775.279) * [-775.798] (-776.698) (-775.234) (-774.941) -- 0:00:19
      679000 -- [-772.564] (-775.004) (-773.895) (-773.769) * (-775.490) [-776.165] (-777.346) (-775.557) -- 0:00:19
      679500 -- (-773.062) (-774.326) (-773.411) [-773.602] * [-773.179] (-775.001) (-776.561) (-774.860) -- 0:00:19
      680000 -- (-773.762) (-776.920) (-772.611) [-772.504] * (-774.262) [-774.746] (-774.840) (-771.735) -- 0:00:19

      Average standard deviation of split frequencies: 0.009826

      680500 -- (-772.422) (-774.143) [-772.709] (-772.881) * (-777.694) (-774.032) (-774.746) [-772.701] -- 0:00:19
      681000 -- [-775.385] (-774.887) (-775.584) (-775.724) * (-772.688) (-772.405) [-772.649] (-773.168) -- 0:00:19
      681500 -- [-773.715] (-774.239) (-777.400) (-774.294) * [-772.281] (-773.888) (-772.612) (-773.291) -- 0:00:19
      682000 -- [-776.685] (-772.790) (-773.740) (-773.632) * (-772.630) [-775.031] (-772.909) (-774.335) -- 0:00:19
      682500 -- (-774.476) [-772.731] (-776.305) (-776.538) * (-773.088) [-774.082] (-773.166) (-772.637) -- 0:00:19
      683000 -- [-774.616] (-773.366) (-776.610) (-774.206) * [-774.394] (-772.124) (-777.606) (-772.196) -- 0:00:19
      683500 -- [-774.514] (-775.055) (-774.852) (-773.981) * (-775.269) [-775.776] (-773.414) (-773.509) -- 0:00:19
      684000 -- [-774.236] (-776.600) (-774.190) (-778.281) * (-772.987) [-771.348] (-773.544) (-777.944) -- 0:00:19
      684500 -- (-773.984) [-775.490] (-772.571) (-775.248) * (-773.757) (-776.138) (-772.099) [-774.651] -- 0:00:19
      685000 -- (-778.219) [-773.860] (-775.091) (-775.143) * (-773.444) (-773.102) (-772.080) [-772.609] -- 0:00:19

      Average standard deviation of split frequencies: 0.009792

      685500 -- (-775.553) [-774.964] (-776.655) (-774.383) * (-775.138) (-771.880) [-774.979] (-775.274) -- 0:00:19
      686000 -- (-776.079) (-776.693) [-771.982] (-775.411) * (-779.347) (-773.958) (-775.698) [-773.080] -- 0:00:19
      686500 -- (-778.477) (-772.045) [-772.587] (-774.390) * (-775.091) (-773.904) (-774.853) [-772.639] -- 0:00:19
      687000 -- (-771.697) (-772.091) [-771.864] (-774.059) * (-773.588) (-774.816) (-775.632) [-773.527] -- 0:00:19
      687500 -- (-774.810) (-772.375) [-773.431] (-774.646) * (-773.067) [-777.119] (-773.517) (-772.005) -- 0:00:19
      688000 -- (-773.823) [-772.969] (-776.969) (-776.658) * [-771.950] (-775.897) (-778.724) (-774.115) -- 0:00:19
      688500 -- [-773.561] (-773.031) (-777.768) (-776.746) * (-776.303) [-772.872] (-773.847) (-774.530) -- 0:00:19
      689000 -- (-774.545) [-771.647] (-777.277) (-777.946) * [-771.772] (-777.665) (-774.152) (-775.678) -- 0:00:18
      689500 -- (-773.903) (-774.610) (-774.427) [-774.533] * (-775.274) (-777.080) (-774.618) [-775.595] -- 0:00:18
      690000 -- (-773.667) [-773.799] (-772.228) (-772.920) * (-773.940) (-773.489) [-773.342] (-774.607) -- 0:00:18

      Average standard deviation of split frequencies: 0.009769

      690500 -- (-772.409) [-775.459] (-773.589) (-773.589) * (-774.710) (-771.561) (-775.300) [-774.304] -- 0:00:18
      691000 -- (-776.651) [-774.222] (-773.218) (-773.774) * (-772.583) (-772.850) (-772.195) [-776.182] -- 0:00:18
      691500 -- (-773.090) (-777.823) [-771.883] (-772.375) * [-772.211] (-773.265) (-773.398) (-776.870) -- 0:00:18
      692000 -- (-773.441) (-775.138) [-772.746] (-773.918) * (-773.515) (-774.275) (-772.322) [-771.922] -- 0:00:18
      692500 -- (-780.807) (-774.494) (-775.102) [-772.988] * [-772.364] (-774.957) (-774.468) (-773.492) -- 0:00:18
      693000 -- (-774.530) (-773.527) [-772.636] (-773.384) * (-775.890) (-779.200) (-774.889) [-775.178] -- 0:00:18
      693500 -- [-774.807] (-773.161) (-772.589) (-772.091) * (-778.616) (-777.260) [-774.961] (-776.359) -- 0:00:18
      694000 -- [-774.280] (-773.253) (-773.095) (-772.937) * [-774.745] (-775.418) (-772.876) (-774.701) -- 0:00:18
      694500 -- (-773.078) (-776.965) [-772.852] (-774.775) * (-772.892) (-774.867) [-772.819] (-772.696) -- 0:00:18
      695000 -- [-777.189] (-772.104) (-776.071) (-771.877) * [-774.376] (-776.060) (-773.404) (-773.030) -- 0:00:18

      Average standard deviation of split frequencies: 0.009271

      695500 -- [-772.882] (-772.239) (-778.160) (-772.754) * (-777.212) [-774.879] (-771.865) (-771.709) -- 0:00:18
      696000 -- (-776.047) (-774.782) [-775.444] (-773.605) * [-774.853] (-774.416) (-775.459) (-773.036) -- 0:00:18
      696500 -- (-771.844) (-772.657) [-776.139] (-772.249) * (-776.500) (-776.029) (-771.810) [-774.290] -- 0:00:18
      697000 -- (-774.966) [-773.211] (-775.091) (-774.025) * (-775.234) (-773.225) [-775.811] (-773.463) -- 0:00:18
      697500 -- (-775.225) (-773.540) (-775.308) [-773.746] * (-775.003) [-774.754] (-774.190) (-772.625) -- 0:00:18
      698000 -- (-774.662) (-776.077) [-776.783] (-773.011) * (-773.988) [-775.382] (-771.766) (-771.810) -- 0:00:18
      698500 -- (-779.332) (-777.144) (-774.741) [-772.499] * [-772.033] (-773.733) (-772.273) (-774.076) -- 0:00:18
      699000 -- (-773.047) [-774.393] (-773.813) (-782.551) * (-772.155) [-775.730] (-773.593) (-775.857) -- 0:00:18
      699500 -- (-774.960) (-772.941) (-778.833) [-778.615] * (-772.395) (-773.356) [-775.650] (-775.370) -- 0:00:18
      700000 -- [-773.454] (-773.011) (-773.945) (-772.292) * (-772.048) (-774.602) [-773.222] (-772.165) -- 0:00:18

      Average standard deviation of split frequencies: 0.009195

      700500 -- (-776.238) (-776.110) (-773.331) [-772.751] * (-775.044) (-772.511) (-772.811) [-773.693] -- 0:00:18
      701000 -- [-772.640] (-776.402) (-776.879) (-772.817) * [-772.213] (-772.419) (-772.950) (-773.058) -- 0:00:18
      701500 -- [-774.090] (-777.111) (-775.653) (-773.901) * (-774.948) [-772.515] (-773.188) (-772.104) -- 0:00:18
      702000 -- (-773.876) (-772.439) (-773.003) [-773.020] * (-774.340) [-772.277] (-773.004) (-774.355) -- 0:00:18
      702500 -- (-772.443) [-774.673] (-775.288) (-774.424) * [-774.528] (-773.838) (-773.492) (-772.677) -- 0:00:18
      703000 -- (-772.579) (-772.815) (-775.769) [-773.130] * (-773.183) (-772.943) [-773.316] (-773.359) -- 0:00:18
      703500 -- [-772.632] (-776.838) (-776.695) (-776.855) * (-773.868) [-774.562] (-773.604) (-774.185) -- 0:00:18
      704000 -- [-773.291] (-774.722) (-773.409) (-775.892) * (-774.811) (-775.149) [-773.110] (-774.363) -- 0:00:18
      704500 -- (-773.181) (-775.840) [-774.252] (-774.468) * (-777.486) (-772.751) (-775.420) [-772.358] -- 0:00:18
      705000 -- (-773.874) [-773.394] (-773.428) (-771.848) * (-773.292) (-774.830) (-771.580) [-771.708] -- 0:00:17

      Average standard deviation of split frequencies: 0.008764

      705500 -- [-774.158] (-777.230) (-775.447) (-772.747) * (-773.840) [-773.950] (-772.157) (-773.859) -- 0:00:17
      706000 -- (-774.094) (-778.672) [-774.354] (-775.385) * (-771.844) [-776.396] (-773.139) (-773.356) -- 0:00:17
      706500 -- [-772.200] (-777.889) (-774.571) (-775.404) * (-772.719) [-772.059] (-772.889) (-781.785) -- 0:00:17
      707000 -- (-773.256) [-773.583] (-773.627) (-772.151) * (-771.769) (-772.670) [-774.153] (-776.985) -- 0:00:17
      707500 -- (-771.873) [-773.133] (-774.588) (-772.720) * (-774.436) (-772.392) (-775.913) [-774.548] -- 0:00:17
      708000 -- (-772.571) [-774.290] (-774.620) (-773.589) * [-774.505] (-773.863) (-773.048) (-775.346) -- 0:00:17
      708500 -- [-774.125] (-773.911) (-773.710) (-774.529) * (-777.092) [-772.379] (-776.133) (-773.353) -- 0:00:17
      709000 -- (-774.311) [-773.210] (-773.908) (-774.382) * [-774.338] (-773.369) (-775.171) (-772.275) -- 0:00:17
      709500 -- (-772.592) [-773.023] (-774.772) (-773.206) * (-775.195) (-775.256) [-773.893] (-772.122) -- 0:00:17
      710000 -- (-771.887) (-773.162) (-776.560) [-773.843] * (-774.722) [-772.232] (-775.676) (-772.692) -- 0:00:17

      Average standard deviation of split frequencies: 0.008889

      710500 -- [-771.626] (-772.043) (-776.634) (-774.048) * [-776.572] (-773.988) (-773.843) (-772.631) -- 0:00:17
      711000 -- [-774.033] (-774.385) (-772.830) (-775.089) * (-775.691) (-773.139) (-772.576) [-772.244] -- 0:00:17
      711500 -- (-771.986) (-776.225) [-773.945] (-774.413) * (-774.657) [-772.810] (-772.797) (-774.421) -- 0:00:17
      712000 -- (-777.309) (-778.028) (-773.888) [-772.049] * [-773.557] (-774.267) (-772.715) (-777.980) -- 0:00:17
      712500 -- (-774.479) (-775.993) (-776.035) [-773.789] * (-779.866) (-772.893) (-772.291) [-776.474] -- 0:00:17
      713000 -- (-774.676) (-775.295) (-773.114) [-773.394] * (-773.484) (-775.198) [-772.767] (-777.703) -- 0:00:17
      713500 -- (-773.759) (-775.648) (-777.178) [-774.011] * (-773.544) (-771.671) [-775.615] (-774.558) -- 0:00:17
      714000 -- (-773.085) (-775.691) [-771.918] (-773.414) * (-775.355) (-773.922) [-774.038] (-775.467) -- 0:00:17
      714500 -- (-773.040) (-774.212) (-773.238) [-776.760] * [-772.474] (-772.808) (-774.303) (-773.711) -- 0:00:17
      715000 -- (-777.008) [-773.055] (-773.003) (-775.344) * [-772.939] (-775.842) (-775.763) (-774.660) -- 0:00:17

      Average standard deviation of split frequencies: 0.009042

      715500 -- (-772.772) [-772.858] (-774.385) (-775.343) * (-775.326) [-771.758] (-773.734) (-773.776) -- 0:00:17
      716000 -- (-773.583) (-774.573) (-773.820) [-775.234] * (-774.159) (-773.423) (-775.551) [-772.121] -- 0:00:17
      716500 -- [-774.184] (-774.147) (-776.023) (-772.668) * (-774.900) (-772.128) (-774.885) [-773.454] -- 0:00:17
      717000 -- [-772.442] (-775.249) (-776.935) (-772.206) * (-774.633) (-774.727) (-773.145) [-773.005] -- 0:00:17
      717500 -- (-775.185) [-773.526] (-773.716) (-772.259) * [-773.097] (-775.060) (-772.919) (-772.480) -- 0:00:17
      718000 -- (-773.142) (-777.125) [-773.603] (-774.586) * (-775.935) (-771.945) (-772.335) [-772.448] -- 0:00:17
      718500 -- (-772.415) (-775.738) (-773.727) [-775.017] * (-773.466) [-774.124] (-773.058) (-771.597) -- 0:00:17
      719000 -- (-773.379) (-773.305) (-778.978) [-773.711] * [-774.248] (-772.804) (-773.406) (-772.962) -- 0:00:17
      719500 -- (-773.144) [-772.409] (-773.447) (-772.566) * (-777.117) (-773.454) [-773.987] (-772.828) -- 0:00:17
      720000 -- (-772.517) (-773.368) [-772.476] (-772.835) * [-775.635] (-775.413) (-773.093) (-773.257) -- 0:00:17

      Average standard deviation of split frequencies: 0.008852

      720500 -- (-776.640) (-773.328) (-775.274) [-772.608] * [-773.146] (-774.366) (-773.115) (-772.916) -- 0:00:17
      721000 -- [-775.178] (-773.802) (-772.329) (-772.041) * (-773.351) (-772.403) [-776.725] (-772.728) -- 0:00:17
      721500 -- (-773.068) (-774.031) (-775.979) [-772.201] * (-774.688) (-776.115) (-773.001) [-772.541] -- 0:00:16
      722000 -- (-774.052) (-780.250) [-773.374] (-773.694) * (-772.134) (-771.633) [-775.852] (-774.032) -- 0:00:16
      722500 -- (-773.379) (-780.249) [-773.783] (-772.965) * (-773.992) (-774.155) (-774.662) [-776.355] -- 0:00:16
      723000 -- (-773.258) (-774.394) (-773.145) [-773.474] * (-775.847) (-772.626) (-775.038) [-772.651] -- 0:00:16
      723500 -- (-772.301) (-772.614) [-773.107] (-771.951) * [-774.564] (-774.812) (-777.542) (-774.432) -- 0:00:16
      724000 -- (-773.221) [-772.628] (-771.981) (-773.505) * (-773.813) [-772.820] (-773.310) (-772.436) -- 0:00:16
      724500 -- (-772.374) [-773.804] (-773.340) (-772.491) * (-773.543) (-773.003) [-772.155] (-774.339) -- 0:00:16
      725000 -- [-772.415] (-774.311) (-775.134) (-772.210) * (-772.405) (-771.758) [-772.492] (-776.481) -- 0:00:16

      Average standard deviation of split frequencies: 0.008787

      725500 -- (-773.670) (-775.858) [-773.242] (-773.226) * [-773.820] (-771.753) (-775.896) (-773.721) -- 0:00:16
      726000 -- (-773.326) [-772.873] (-773.841) (-774.637) * (-776.066) [-774.590] (-773.534) (-774.036) -- 0:00:16
      726500 -- (-774.797) (-773.283) [-773.154] (-774.717) * (-774.934) [-774.218] (-776.488) (-776.297) -- 0:00:16
      727000 -- [-772.577] (-771.627) (-773.685) (-775.462) * (-777.453) (-773.554) [-773.872] (-771.437) -- 0:00:16
      727500 -- (-774.601) (-773.970) (-773.957) [-776.115] * (-773.721) [-772.718] (-773.487) (-772.977) -- 0:00:16
      728000 -- (-772.748) (-771.642) [-774.573] (-774.794) * [-774.517] (-778.723) (-776.488) (-775.444) -- 0:00:16
      728500 -- [-772.465] (-772.320) (-775.164) (-775.760) * (-772.767) (-774.901) (-775.176) [-772.824] -- 0:00:16
      729000 -- (-777.210) (-772.347) (-775.858) [-772.712] * [-773.094] (-773.962) (-772.801) (-772.400) -- 0:00:16
      729500 -- (-773.618) (-775.381) [-773.993] (-774.429) * (-775.819) (-775.318) (-771.987) [-775.488] -- 0:00:16
      730000 -- (-773.464) [-774.140] (-774.174) (-772.421) * [-773.576] (-781.263) (-776.258) (-774.990) -- 0:00:16

      Average standard deviation of split frequencies: 0.008344

      730500 -- [-772.918] (-772.290) (-776.247) (-773.018) * [-774.812] (-778.766) (-779.434) (-773.590) -- 0:00:16
      731000 -- (-773.703) (-771.733) (-775.485) [-772.449] * (-773.465) (-774.953) (-774.196) [-773.721] -- 0:00:16
      731500 -- (-774.532) [-773.643] (-776.546) (-773.181) * (-774.663) [-778.549] (-775.410) (-775.657) -- 0:00:16
      732000 -- [-773.282] (-773.646) (-773.612) (-775.474) * (-779.741) (-774.416) (-775.432) [-773.846] -- 0:00:16
      732500 -- (-774.034) (-772.538) [-774.809] (-776.952) * (-779.855) (-772.716) [-771.581] (-774.338) -- 0:00:16
      733000 -- [-771.758] (-772.254) (-773.790) (-776.399) * [-776.705] (-772.873) (-771.429) (-774.120) -- 0:00:16
      733500 -- (-780.947) (-778.822) [-776.402] (-775.049) * (-774.144) (-775.598) (-772.763) [-771.842] -- 0:00:16
      734000 -- (-774.488) (-774.625) [-772.132] (-776.059) * (-774.835) (-774.309) (-772.670) [-773.414] -- 0:00:16
      734500 -- (-771.986) [-771.711] (-772.249) (-772.005) * (-774.661) (-777.076) [-774.246] (-775.966) -- 0:00:16
      735000 -- (-781.215) [-772.459] (-773.647) (-772.441) * (-775.095) (-771.882) [-772.548] (-775.321) -- 0:00:16

      Average standard deviation of split frequencies: 0.008668

      735500 -- (-774.104) (-776.995) [-773.825] (-771.991) * (-775.736) (-771.371) (-774.235) [-773.059] -- 0:00:16
      736000 -- [-775.773] (-777.879) (-775.660) (-776.435) * [-776.085] (-771.611) (-774.868) (-774.111) -- 0:00:16
      736500 -- (-772.888) (-774.814) (-776.534) [-773.701] * (-772.919) [-773.863] (-773.042) (-772.831) -- 0:00:16
      737000 -- (-773.228) (-777.314) (-776.772) [-773.277] * [-772.923] (-774.353) (-773.154) (-774.462) -- 0:00:16
      737500 -- (-777.910) (-774.045) (-772.755) [-774.013] * (-774.529) [-773.013] (-774.027) (-775.028) -- 0:00:16
      738000 -- (-775.779) [-777.696] (-772.018) (-772.999) * (-773.338) (-774.662) [-775.297] (-773.375) -- 0:00:15
      738500 -- (-772.869) (-773.186) (-772.479) [-774.281] * (-773.120) (-773.523) [-774.107] (-776.965) -- 0:00:15
      739000 -- (-772.480) (-773.187) (-775.088) [-771.726] * [-774.177] (-773.769) (-777.968) (-772.407) -- 0:00:15
      739500 -- (-772.903) [-777.032] (-774.900) (-773.554) * (-774.129) (-773.179) (-775.019) [-772.825] -- 0:00:15
      740000 -- [-772.010] (-776.481) (-772.411) (-773.677) * (-774.525) (-773.803) [-772.508] (-778.870) -- 0:00:15

      Average standard deviation of split frequencies: 0.008444

      740500 -- [-773.111] (-775.495) (-772.355) (-774.433) * (-774.007) [-772.880] (-773.657) (-772.566) -- 0:00:15
      741000 -- (-774.222) (-771.943) [-772.205] (-776.456) * (-773.011) [-775.507] (-773.694) (-772.711) -- 0:00:15
      741500 -- (-773.674) (-775.579) [-772.400] (-772.881) * (-772.613) (-774.534) [-772.831] (-772.484) -- 0:00:15
      742000 -- (-777.047) (-775.336) [-775.219] (-773.055) * (-772.694) (-775.050) [-771.490] (-775.702) -- 0:00:15
      742500 -- (-775.462) (-773.985) (-776.679) [-772.945] * [-773.061] (-776.559) (-772.738) (-776.164) -- 0:00:15
      743000 -- (-772.519) (-774.402) (-775.612) [-771.986] * [-772.392] (-775.851) (-778.029) (-773.090) -- 0:00:15
      743500 -- (-772.870) (-774.752) (-775.506) [-773.306] * [-775.099] (-773.244) (-775.432) (-773.505) -- 0:00:15
      744000 -- (-772.973) (-778.572) [-772.174] (-773.292) * (-773.343) (-777.295) [-777.292] (-775.626) -- 0:00:15
      744500 -- (-773.383) (-774.492) [-772.734] (-772.898) * (-774.864) (-776.310) [-773.654] (-772.354) -- 0:00:15
      745000 -- [-776.361] (-772.811) (-772.562) (-773.354) * (-774.449) (-774.338) [-772.444] (-771.916) -- 0:00:15

      Average standard deviation of split frequencies: 0.008491

      745500 -- (-772.251) (-774.241) [-774.707] (-775.190) * [-774.215] (-775.130) (-772.493) (-771.860) -- 0:00:15
      746000 -- (-771.555) (-772.558) [-771.796] (-778.561) * (-775.817) (-775.837) (-772.394) [-773.961] -- 0:00:15
      746500 -- (-772.104) [-773.632] (-774.164) (-775.438) * [-772.979] (-779.571) (-772.199) (-772.416) -- 0:00:15
      747000 -- [-772.998] (-773.028) (-773.413) (-773.503) * [-771.853] (-772.676) (-777.428) (-771.727) -- 0:00:15
      747500 -- (-771.688) (-773.929) (-772.637) [-773.803] * (-772.575) (-774.363) [-772.133] (-773.658) -- 0:00:15
      748000 -- (-771.965) [-773.108] (-776.791) (-773.269) * (-773.444) [-778.146] (-772.437) (-773.291) -- 0:00:15
      748500 -- (-773.273) (-773.482) (-778.462) [-773.622] * (-772.610) (-780.016) (-772.950) [-773.110] -- 0:00:15
      749000 -- [-774.030] (-774.869) (-775.149) (-773.770) * (-772.836) (-774.505) [-774.599] (-774.306) -- 0:00:15
      749500 -- (-774.836) (-774.476) [-776.082] (-775.574) * [-774.449] (-773.926) (-774.312) (-775.302) -- 0:00:15
      750000 -- (-772.329) [-777.357] (-773.368) (-772.900) * (-780.313) [-777.328] (-773.609) (-777.573) -- 0:00:15

      Average standard deviation of split frequencies: 0.008399

      750500 -- (-772.403) [-774.470] (-772.564) (-774.725) * (-775.723) [-773.245] (-771.740) (-773.178) -- 0:00:15
      751000 -- (-775.142) (-772.488) [-771.754] (-774.951) * (-773.876) (-773.266) [-775.867] (-774.459) -- 0:00:15
      751500 -- (-775.054) [-772.057] (-774.214) (-772.079) * [-773.846] (-774.125) (-774.594) (-779.720) -- 0:00:15
      752000 -- (-773.445) [-772.169] (-774.214) (-773.395) * [-772.430] (-776.558) (-774.935) (-773.902) -- 0:00:15
      752500 -- (-773.650) (-772.412) (-772.227) [-771.860] * [-772.717] (-773.626) (-772.055) (-775.618) -- 0:00:15
      753000 -- (-776.333) [-775.735] (-772.520) (-771.711) * (-774.432) [-773.424] (-771.504) (-774.327) -- 0:00:15
      753500 -- [-775.036] (-772.925) (-773.910) (-772.260) * (-773.276) [-771.809] (-772.056) (-775.641) -- 0:00:15
      754000 -- (-777.411) [-774.972] (-777.582) (-780.702) * (-773.100) (-774.729) (-774.596) [-773.547] -- 0:00:15
      754500 -- (-775.730) (-774.983) (-775.086) [-772.268] * (-772.722) (-777.024) [-774.429] (-772.950) -- 0:00:14
      755000 -- (-777.702) (-777.951) (-773.052) [-773.067] * [-773.253] (-778.694) (-772.684) (-773.029) -- 0:00:14

      Average standard deviation of split frequencies: 0.008065

      755500 -- [-776.643] (-772.937) (-773.604) (-774.630) * [-774.693] (-773.352) (-772.097) (-773.720) -- 0:00:14
      756000 -- (-773.713) (-773.242) [-772.178] (-772.303) * (-773.566) [-776.238] (-772.757) (-774.969) -- 0:00:14
      756500 -- (-774.802) (-775.818) [-774.412] (-777.360) * (-774.828) [-776.512] (-774.950) (-775.368) -- 0:00:14
      757000 -- (-771.870) (-772.946) [-772.165] (-774.294) * (-772.822) [-772.313] (-776.422) (-774.981) -- 0:00:14
      757500 -- (-772.871) (-773.779) [-773.375] (-774.645) * (-773.264) [-772.187] (-776.625) (-774.166) -- 0:00:14
      758000 -- (-773.658) (-771.953) [-773.713] (-775.748) * [-772.246] (-771.664) (-773.692) (-772.914) -- 0:00:14
      758500 -- (-773.914) [-772.636] (-774.326) (-773.007) * (-774.236) (-773.555) [-772.023] (-772.349) -- 0:00:14
      759000 -- (-771.675) [-774.555] (-774.081) (-772.596) * (-777.330) [-772.168] (-775.085) (-775.889) -- 0:00:14
      759500 -- (-774.009) (-773.517) (-773.627) [-772.539] * (-774.217) (-772.638) [-773.363] (-774.333) -- 0:00:14
      760000 -- [-774.837] (-772.194) (-772.669) (-774.234) * (-772.499) [-774.429] (-774.849) (-771.876) -- 0:00:14

      Average standard deviation of split frequencies: 0.007519

      760500 -- (-776.016) (-771.751) (-774.293) [-772.854] * (-772.936) [-776.824] (-775.333) (-774.019) -- 0:00:14
      761000 -- (-773.682) [-773.449] (-774.060) (-774.356) * (-775.647) (-774.967) (-777.031) [-776.666] -- 0:00:14
      761500 -- (-773.167) [-773.421] (-779.270) (-772.806) * [-774.446] (-772.935) (-773.812) (-776.483) -- 0:00:14
      762000 -- (-772.636) (-771.534) [-774.832] (-773.888) * (-775.675) [-772.815] (-775.045) (-773.888) -- 0:00:14
      762500 -- [-771.658] (-772.593) (-778.136) (-774.632) * [-772.982] (-771.530) (-773.840) (-772.489) -- 0:00:14
      763000 -- (-771.819) (-774.811) [-773.839] (-773.362) * (-771.898) (-773.659) (-773.716) [-771.748] -- 0:00:14
      763500 -- (-773.676) [-773.985] (-773.983) (-772.320) * (-773.866) (-774.951) [-777.931] (-771.425) -- 0:00:14
      764000 -- (-772.333) (-774.787) (-772.814) [-772.605] * (-772.990) (-772.385) (-773.818) [-771.886] -- 0:00:14
      764500 -- (-775.947) (-772.914) (-773.110) [-774.088] * (-773.264) [-773.939] (-778.389) (-773.904) -- 0:00:14
      765000 -- [-779.198] (-773.365) (-773.982) (-776.429) * [-776.058] (-781.262) (-778.799) (-771.777) -- 0:00:14

      Average standard deviation of split frequencies: 0.007693

      765500 -- (-777.380) (-775.542) (-772.966) [-772.916] * (-771.754) (-772.568) [-776.017] (-772.977) -- 0:00:14
      766000 -- (-777.066) (-775.031) (-774.262) [-774.349] * (-773.591) [-773.682] (-775.316) (-774.746) -- 0:00:14
      766500 -- (-774.045) (-773.965) [-779.140] (-773.937) * (-772.149) [-774.143] (-773.815) (-774.069) -- 0:00:14
      767000 -- [-773.607] (-774.057) (-773.826) (-773.306) * (-775.084) (-774.200) (-772.856) [-774.281] -- 0:00:14
      767500 -- (-773.935) (-772.675) (-777.693) [-772.210] * (-773.594) (-774.231) (-772.555) [-772.774] -- 0:00:14
      768000 -- (-774.123) (-773.443) [-779.527] (-777.913) * [-773.245] (-774.554) (-775.243) (-772.705) -- 0:00:14
      768500 -- [-773.388] (-773.895) (-772.260) (-777.904) * (-773.774) (-777.164) [-774.950] (-776.795) -- 0:00:14
      769000 -- (-775.673) (-776.046) (-771.804) [-773.019] * (-779.564) (-774.283) (-772.531) [-777.394] -- 0:00:14
      769500 -- (-773.681) [-773.422] (-773.754) (-773.106) * (-776.019) (-777.565) [-772.981] (-778.417) -- 0:00:14
      770000 -- (-775.280) (-772.224) (-774.320) [-772.879] * (-775.187) (-772.211) (-772.243) [-774.768] -- 0:00:14

      Average standard deviation of split frequencies: 0.008156

      770500 -- (-775.111) [-774.444] (-775.748) (-773.925) * [-774.460] (-772.723) (-776.070) (-772.466) -- 0:00:13
      771000 -- (-772.238) (-771.635) (-775.371) [-774.198] * [-778.504] (-772.567) (-772.269) (-773.115) -- 0:00:13
      771500 -- (-774.915) (-774.202) [-773.729] (-776.687) * (-777.515) (-772.010) (-773.042) [-771.482] -- 0:00:13
      772000 -- (-772.580) (-774.637) [-773.660] (-773.317) * (-773.108) [-772.717] (-771.752) (-771.510) -- 0:00:13
      772500 -- (-773.143) (-775.718) [-772.570] (-778.713) * [-772.875] (-773.861) (-774.205) (-775.251) -- 0:00:13
      773000 -- (-776.532) (-774.244) [-772.643] (-779.217) * (-772.264) [-775.768] (-777.170) (-773.415) -- 0:00:13
      773500 -- [-772.718] (-773.886) (-773.904) (-771.697) * (-773.924) (-778.975) [-772.861] (-774.235) -- 0:00:13
      774000 -- (-772.274) (-775.457) [-776.993] (-774.425) * (-779.425) [-774.705] (-776.035) (-773.062) -- 0:00:13
      774500 -- (-774.122) (-773.305) [-775.975] (-775.083) * [-773.094] (-775.960) (-774.359) (-772.996) -- 0:00:13
      775000 -- (-772.986) (-773.106) [-772.097] (-775.658) * (-772.599) (-772.860) [-772.218] (-774.710) -- 0:00:13

      Average standard deviation of split frequencies: 0.008059

      775500 -- (-772.610) (-775.034) (-774.877) [-776.307] * (-773.448) [-772.488] (-772.655) (-774.511) -- 0:00:13
      776000 -- [-774.513] (-773.939) (-773.506) (-776.290) * (-773.588) [-771.920] (-775.987) (-775.566) -- 0:00:13
      776500 -- (-773.631) [-774.761] (-774.770) (-771.599) * (-774.896) (-773.542) (-774.875) [-772.938] -- 0:00:13
      777000 -- (-773.986) [-773.496] (-775.088) (-772.895) * (-772.726) [-772.803] (-776.024) (-772.458) -- 0:00:13
      777500 -- (-775.924) [-774.508] (-776.152) (-771.974) * (-772.739) (-773.017) [-773.464] (-773.203) -- 0:00:13
      778000 -- (-777.771) (-772.154) (-774.128) [-771.693] * (-774.327) (-777.638) (-773.759) [-774.254] -- 0:00:13
      778500 -- [-775.183] (-776.772) (-774.176) (-773.393) * (-772.616) (-771.802) (-774.889) [-772.930] -- 0:00:13
      779000 -- (-772.233) [-775.524] (-774.584) (-774.814) * (-773.349) [-772.364] (-773.164) (-773.750) -- 0:00:13
      779500 -- (-773.775) (-773.484) [-772.739] (-775.257) * (-778.514) [-772.884] (-773.064) (-775.075) -- 0:00:13
      780000 -- (-773.616) (-773.786) [-774.112] (-772.999) * (-775.068) [-774.585] (-775.995) (-772.171) -- 0:00:13

      Average standard deviation of split frequencies: 0.008333

      780500 -- (-775.348) [-771.872] (-775.566) (-775.445) * [-773.508] (-776.799) (-775.139) (-772.744) -- 0:00:13
      781000 -- (-776.629) (-771.752) [-775.475] (-775.517) * [-774.011] (-774.498) (-777.490) (-772.216) -- 0:00:13
      781500 -- (-772.593) [-772.204] (-772.850) (-772.385) * (-772.383) (-774.739) (-775.983) [-772.452] -- 0:00:13
      782000 -- (-772.211) (-772.000) [-773.148] (-771.744) * (-772.679) (-776.393) (-772.236) [-773.289] -- 0:00:13
      782500 -- (-773.095) (-773.969) [-771.995] (-772.459) * (-773.245) (-773.837) [-774.905] (-772.899) -- 0:00:13
      783000 -- (-772.150) [-775.088] (-773.620) (-779.104) * (-775.273) (-779.221) [-777.095] (-772.846) -- 0:00:13
      783500 -- (-777.292) (-772.941) [-772.944] (-773.343) * (-774.068) (-773.459) [-774.381] (-772.064) -- 0:00:13
      784000 -- (-771.763) [-775.515] (-772.599) (-774.936) * (-772.331) [-772.673] (-773.576) (-772.050) -- 0:00:13
      784500 -- (-772.865) (-773.278) [-772.202] (-771.654) * (-773.303) [-776.128] (-773.761) (-771.908) -- 0:00:13
      785000 -- (-772.747) [-774.442] (-772.613) (-772.345) * [-776.324] (-772.876) (-773.285) (-773.197) -- 0:00:13

      Average standard deviation of split frequencies: 0.007957

      785500 -- (-772.774) (-772.465) (-772.589) [-773.059] * (-772.498) (-774.981) (-773.973) [-774.472] -- 0:00:13
      786000 -- (-772.483) [-774.219] (-775.149) (-772.955) * (-772.171) (-776.161) (-776.030) [-774.221] -- 0:00:13
      786500 -- (-771.947) [-777.334] (-773.756) (-773.533) * (-773.884) [-772.990] (-772.345) (-772.916) -- 0:00:13
      787000 -- (-775.466) (-771.699) [-775.852] (-777.937) * (-771.791) [-773.393] (-773.428) (-773.753) -- 0:00:12
      787500 -- (-774.575) (-774.206) (-777.011) [-775.758] * (-773.946) (-776.342) (-774.396) [-773.596] -- 0:00:12
      788000 -- (-772.731) (-780.794) [-773.469] (-773.574) * (-776.423) [-772.444] (-776.342) (-775.764) -- 0:00:12
      788500 -- (-773.020) [-778.272] (-776.411) (-776.142) * (-774.710) (-776.640) [-773.973] (-777.948) -- 0:00:12
      789000 -- [-772.824] (-774.109) (-772.486) (-775.074) * (-776.488) [-773.529] (-774.349) (-775.985) -- 0:00:12
      789500 -- [-774.267] (-772.651) (-772.155) (-773.142) * (-775.333) [-772.114] (-773.318) (-774.697) -- 0:00:12
      790000 -- (-773.111) [-771.505] (-774.203) (-772.481) * (-774.409) [-777.177] (-774.002) (-775.411) -- 0:00:12

      Average standard deviation of split frequencies: 0.007473

      790500 -- (-772.157) (-773.515) (-772.973) [-774.225] * [-772.832] (-774.393) (-772.159) (-774.144) -- 0:00:12
      791000 -- (-773.006) (-773.790) (-774.054) [-776.490] * (-773.991) (-773.994) (-773.653) [-772.861] -- 0:00:12
      791500 -- (-774.454) (-772.122) (-772.312) [-772.386] * (-774.411) (-775.506) (-777.004) [-773.035] -- 0:00:12
      792000 -- [-772.939] (-774.283) (-772.640) (-772.550) * (-774.258) [-775.640] (-775.233) (-775.640) -- 0:00:12
      792500 -- (-771.619) (-776.132) (-774.099) [-771.598] * [-774.833] (-772.575) (-777.750) (-774.320) -- 0:00:12
      793000 -- (-773.224) (-773.226) (-772.806) [-772.784] * [-776.351] (-777.087) (-774.680) (-773.025) -- 0:00:12
      793500 -- (-773.797) [-771.985] (-775.156) (-773.676) * (-773.881) (-777.853) (-773.888) [-771.888] -- 0:00:12
      794000 -- (-774.838) (-774.034) [-774.112] (-773.462) * (-776.725) [-771.787] (-774.226) (-776.345) -- 0:00:12
      794500 -- (-773.558) [-772.909] (-774.642) (-772.827) * (-777.527) (-772.458) [-775.719] (-775.643) -- 0:00:12
      795000 -- (-771.741) (-771.644) [-773.378] (-772.867) * (-774.096) [-773.046] (-772.656) (-774.107) -- 0:00:12

      Average standard deviation of split frequencies: 0.007186

      795500 -- (-772.991) (-773.972) (-775.035) [-775.069] * (-773.893) (-771.580) [-772.583] (-777.226) -- 0:00:12
      796000 -- (-772.659) [-772.525] (-772.620) (-773.193) * (-771.923) (-771.817) (-776.186) [-774.112] -- 0:00:12
      796500 -- [-772.313] (-774.438) (-774.586) (-771.968) * (-771.717) [-779.143] (-772.839) (-777.247) -- 0:00:12
      797000 -- [-777.981] (-777.489) (-773.422) (-772.756) * (-776.551) [-772.296] (-774.345) (-773.358) -- 0:00:12
      797500 -- (-773.718) [-771.760] (-777.939) (-774.589) * (-773.399) (-776.995) (-771.535) [-775.041] -- 0:00:12
      798000 -- [-773.097] (-776.610) (-775.582) (-773.739) * (-774.485) (-772.347) [-776.063] (-772.822) -- 0:00:12
      798500 -- [-775.547] (-774.359) (-776.828) (-774.556) * [-773.843] (-772.527) (-772.290) (-775.245) -- 0:00:12
      799000 -- (-774.788) (-774.746) (-774.433) [-773.286] * (-772.289) (-775.287) (-772.285) [-778.056] -- 0:00:12
      799500 -- [-775.027] (-775.138) (-775.438) (-772.811) * (-772.334) (-773.832) (-772.745) [-772.811] -- 0:00:12
      800000 -- [-774.487] (-773.580) (-771.778) (-772.040) * (-772.866) (-774.229) (-775.829) [-774.382] -- 0:00:12

      Average standard deviation of split frequencies: 0.007458

      800500 -- (-772.687) [-773.844] (-772.376) (-772.416) * (-773.140) (-773.418) (-774.403) [-774.254] -- 0:00:12
      801000 -- [-773.598] (-773.606) (-772.986) (-773.073) * (-775.441) (-774.896) (-777.658) [-773.216] -- 0:00:12
      801500 -- (-773.815) (-771.845) [-772.147] (-775.503) * (-775.159) (-773.171) [-774.087] (-772.020) -- 0:00:12
      802000 -- (-775.955) [-774.293] (-773.883) (-772.891) * (-773.128) (-773.268) [-774.278] (-774.762) -- 0:00:12
      802500 -- (-773.734) [-775.332] (-773.579) (-775.695) * (-775.040) (-775.629) [-773.152] (-773.806) -- 0:00:12
      803000 -- [-774.064] (-778.685) (-773.134) (-776.548) * (-775.373) (-774.638) (-773.539) [-777.243] -- 0:00:12
      803500 -- (-774.873) (-774.400) (-773.915) [-777.824] * (-776.015) [-775.640] (-773.507) (-774.754) -- 0:00:11
      804000 -- (-775.986) [-772.935] (-773.751) (-774.953) * (-772.693) (-773.205) (-776.009) [-776.790] -- 0:00:11
      804500 -- (-773.617) (-771.789) (-773.935) [-773.720] * (-774.630) [-775.025] (-776.486) (-775.919) -- 0:00:11
      805000 -- [-773.327] (-771.857) (-773.328) (-774.612) * (-774.425) (-776.410) [-774.460] (-774.378) -- 0:00:11

      Average standard deviation of split frequencies: 0.007642

      805500 -- (-773.098) (-775.452) (-777.473) [-775.101] * (-775.918) (-775.191) [-773.812] (-775.410) -- 0:00:11
      806000 -- (-774.899) (-772.596) (-773.301) [-773.938] * (-772.582) (-773.551) (-775.157) [-772.959] -- 0:00:11
      806500 -- (-772.622) [-772.701] (-773.907) (-774.214) * (-773.155) (-774.017) [-774.584] (-773.360) -- 0:00:11
      807000 -- (-774.509) (-773.159) [-773.985] (-772.566) * [-773.834] (-776.239) (-773.989) (-773.128) -- 0:00:11
      807500 -- (-774.823) [-772.383] (-773.756) (-776.514) * [-775.079] (-775.455) (-772.500) (-774.490) -- 0:00:11
      808000 -- (-773.930) [-771.952] (-773.166) (-775.770) * (-773.487) (-773.220) (-773.737) [-771.305] -- 0:00:11
      808500 -- [-771.586] (-772.243) (-773.926) (-774.295) * (-771.627) (-774.651) [-775.477] (-774.417) -- 0:00:11
      809000 -- (-773.188) (-772.810) [-774.963] (-773.074) * (-772.589) (-774.887) [-775.267] (-772.959) -- 0:00:11
      809500 -- (-773.718) (-774.991) [-771.707] (-774.363) * (-782.261) (-775.528) (-773.982) [-771.758] -- 0:00:11
      810000 -- [-772.670] (-774.689) (-772.028) (-773.106) * [-772.713] (-774.249) (-773.246) (-772.952) -- 0:00:11

      Average standard deviation of split frequencies: 0.007443

      810500 -- [-772.993] (-772.712) (-772.182) (-778.933) * [-772.234] (-774.825) (-774.884) (-774.377) -- 0:00:11
      811000 -- [-777.369] (-773.344) (-775.917) (-774.634) * (-771.971) (-773.562) [-773.004] (-773.871) -- 0:00:11
      811500 -- (-774.682) (-772.431) [-781.474] (-773.756) * [-773.503] (-774.228) (-774.102) (-775.103) -- 0:00:11
      812000 -- (-774.273) [-775.520] (-771.995) (-775.022) * (-773.514) (-772.808) [-772.784] (-772.600) -- 0:00:11
      812500 -- (-772.455) (-777.727) (-775.519) [-773.135] * [-772.636] (-774.353) (-773.154) (-772.878) -- 0:00:11
      813000 -- [-773.235] (-774.580) (-779.321) (-772.839) * (-772.620) (-775.507) [-772.375] (-772.103) -- 0:00:11
      813500 -- (-774.063) (-772.560) (-780.013) [-772.591] * (-775.666) (-775.075) (-775.600) [-776.135] -- 0:00:11
      814000 -- (-773.150) (-773.952) [-773.659] (-775.712) * (-776.293) (-774.896) (-772.964) [-771.787] -- 0:00:11
      814500 -- (-774.495) (-773.857) (-778.403) [-775.070] * (-776.801) (-779.691) (-772.786) [-773.480] -- 0:00:11
      815000 -- (-775.101) (-772.528) (-773.771) [-773.386] * (-781.353) [-776.852] (-773.206) (-773.671) -- 0:00:11

      Average standard deviation of split frequencies: 0.007164

      815500 -- (-774.426) (-773.027) (-773.289) [-772.513] * (-774.311) [-772.447] (-776.744) (-773.241) -- 0:00:11
      816000 -- (-774.460) (-775.389) [-773.325] (-773.186) * (-773.511) (-772.407) [-775.659] (-773.433) -- 0:00:11
      816500 -- [-772.388] (-773.500) (-772.727) (-774.954) * (-772.135) (-777.272) [-776.594] (-771.813) -- 0:00:11
      817000 -- (-771.779) (-772.690) (-774.288) [-772.189] * [-772.672] (-773.602) (-778.912) (-771.745) -- 0:00:11
      817500 -- [-773.414] (-773.645) (-772.623) (-772.136) * (-771.832) [-773.250] (-771.821) (-772.779) -- 0:00:11
      818000 -- [-774.059] (-772.969) (-772.488) (-772.826) * (-774.020) (-773.057) (-773.871) [-772.196] -- 0:00:11
      818500 -- (-773.113) [-772.017] (-772.814) (-777.064) * (-773.243) (-773.713) (-771.881) [-772.704] -- 0:00:11
      819000 -- (-773.535) [-773.943] (-772.779) (-774.584) * (-772.405) (-775.102) [-772.687] (-775.559) -- 0:00:11
      819500 -- (-773.292) [-775.973] (-774.034) (-779.227) * (-776.984) [-772.997] (-775.755) (-774.166) -- 0:00:11
      820000 -- (-772.198) (-774.892) [-773.884] (-776.179) * (-774.571) (-773.702) (-777.228) [-772.522] -- 0:00:10

      Average standard deviation of split frequencies: 0.007084

      820500 -- (-773.141) (-774.419) (-778.310) [-775.839] * (-773.412) [-771.846] (-773.504) (-773.765) -- 0:00:10
      821000 -- (-772.363) (-773.167) (-775.992) [-773.750] * (-774.187) [-774.897] (-773.621) (-773.404) -- 0:00:10
      821500 -- (-775.169) (-772.867) (-772.917) [-771.827] * (-781.623) [-773.927] (-779.043) (-773.494) -- 0:00:10
      822000 -- (-773.318) [-773.783] (-773.235) (-775.742) * [-773.676] (-771.997) (-775.669) (-774.899) -- 0:00:10
      822500 -- (-774.871) (-771.907) (-773.840) [-774.269] * (-774.916) (-774.127) [-773.398] (-775.350) -- 0:00:10
      823000 -- (-772.909) (-771.877) [-772.080] (-778.173) * (-776.593) (-774.071) (-772.748) [-772.956] -- 0:00:10
      823500 -- (-775.223) (-772.763) (-772.332) [-772.131] * (-773.773) [-771.370] (-776.331) (-772.743) -- 0:00:10
      824000 -- [-774.886] (-774.838) (-771.887) (-773.921) * (-776.130) (-773.596) (-775.082) [-773.421] -- 0:00:10
      824500 -- (-777.994) (-774.515) [-771.626] (-775.797) * (-777.643) (-774.498) [-771.887] (-773.421) -- 0:00:10
      825000 -- (-775.129) (-774.176) (-774.041) [-775.367] * (-773.193) (-774.260) (-775.425) [-772.457] -- 0:00:10

      Average standard deviation of split frequencies: 0.007457

      825500 -- (-778.343) [-774.551] (-773.096) (-773.688) * (-774.985) [-775.672] (-771.695) (-772.255) -- 0:00:10
      826000 -- (-773.850) (-774.711) [-772.793] (-777.382) * (-774.461) (-776.989) (-773.859) [-772.263] -- 0:00:10
      826500 -- (-773.449) [-773.516] (-772.554) (-774.185) * (-775.939) (-773.916) [-775.405] (-772.232) -- 0:00:10
      827000 -- (-776.717) (-779.594) (-772.250) [-775.166] * (-774.398) (-773.138) (-773.059) [-773.267] -- 0:00:10
      827500 -- [-775.916] (-774.971) (-772.761) (-776.370) * (-774.785) (-772.469) (-775.611) [-772.488] -- 0:00:10
      828000 -- (-772.380) (-777.026) (-772.260) [-773.806] * (-773.690) (-773.536) (-774.958) [-772.460] -- 0:00:10
      828500 -- (-773.801) (-778.119) [-772.531] (-775.663) * (-773.552) [-773.434] (-775.149) (-772.801) -- 0:00:10
      829000 -- (-773.913) [-774.168] (-771.977) (-776.462) * (-772.327) [-776.753] (-780.922) (-783.542) -- 0:00:10
      829500 -- (-773.149) [-775.234] (-774.629) (-773.777) * (-773.999) (-774.221) (-778.194) [-780.002] -- 0:00:10
      830000 -- (-773.128) (-773.237) (-773.959) [-771.830] * (-776.432) (-772.673) [-775.969] (-778.886) -- 0:00:10

      Average standard deviation of split frequencies: 0.007945

      830500 -- (-773.156) (-775.410) (-773.602) [-772.789] * (-772.830) (-773.710) [-773.954] (-781.832) -- 0:00:10
      831000 -- [-774.666] (-773.656) (-776.101) (-772.661) * (-772.813) (-775.642) (-775.694) [-774.599] -- 0:00:10
      831500 -- (-774.554) (-776.095) (-773.183) [-774.328] * [-772.746] (-778.621) (-776.363) (-774.343) -- 0:00:10
      832000 -- (-774.495) (-778.789) (-773.051) [-776.895] * (-771.991) (-772.456) (-773.681) [-774.465] -- 0:00:10
      832500 -- (-773.390) [-776.705] (-772.195) (-779.297) * (-773.620) (-773.213) (-777.811) [-773.064] -- 0:00:10
      833000 -- [-775.450] (-772.613) (-773.584) (-777.788) * (-775.710) (-773.205) (-772.026) [-773.705] -- 0:00:10
      833500 -- (-774.124) [-772.198] (-774.022) (-773.901) * (-774.030) (-773.106) (-772.389) [-773.504] -- 0:00:10
      834000 -- (-772.847) (-772.588) (-772.803) [-772.633] * (-772.377) (-775.289) (-771.538) [-773.182] -- 0:00:10
      834500 -- (-771.765) [-775.669] (-773.393) (-772.204) * [-775.889] (-774.104) (-772.606) (-773.673) -- 0:00:10
      835000 -- [-774.090] (-775.545) (-778.487) (-774.104) * (-778.307) (-779.844) [-775.031] (-772.969) -- 0:00:10

      Average standard deviation of split frequencies: 0.007970

      835500 -- (-772.349) (-773.128) (-780.262) [-772.999] * [-774.924] (-775.932) (-773.500) (-773.638) -- 0:00:10
      836000 -- (-772.906) (-773.589) [-772.711] (-772.117) * [-773.272] (-772.747) (-774.114) (-772.655) -- 0:00:10
      836500 -- (-772.642) (-772.635) (-772.729) [-772.776] * (-772.893) [-774.904] (-773.163) (-773.868) -- 0:00:09
      837000 -- (-771.928) [-773.181] (-773.117) (-772.357) * (-773.148) (-777.354) [-771.765] (-774.634) -- 0:00:09
      837500 -- (-772.829) [-773.369] (-772.332) (-777.041) * [-773.012] (-773.459) (-771.763) (-775.927) -- 0:00:09
      838000 -- (-773.476) [-773.381] (-776.098) (-776.948) * (-773.165) [-772.403] (-774.463) (-776.780) -- 0:00:09
      838500 -- (-773.556) [-776.597] (-776.445) (-775.046) * (-771.485) (-774.141) [-774.192] (-776.142) -- 0:00:09
      839000 -- [-774.271] (-775.263) (-775.035) (-775.902) * [-771.485] (-772.414) (-775.741) (-772.056) -- 0:00:09
      839500 -- (-771.951) (-772.504) [-772.281] (-781.130) * (-774.019) (-773.616) (-775.316) [-774.730] -- 0:00:09
      840000 -- (-774.690) (-776.302) [-771.380] (-773.756) * [-772.818] (-773.037) (-773.078) (-775.832) -- 0:00:09

      Average standard deviation of split frequencies: 0.007439

      840500 -- (-772.031) (-771.958) (-773.074) [-773.601] * (-773.314) [-775.226] (-777.447) (-773.967) -- 0:00:09
      841000 -- (-771.622) (-773.070) [-771.834] (-773.253) * [-772.887] (-773.155) (-774.744) (-772.461) -- 0:00:09
      841500 -- [-771.468] (-773.266) (-777.252) (-772.939) * (-772.458) (-773.018) [-776.115] (-774.176) -- 0:00:09
      842000 -- (-771.371) [-772.981] (-779.634) (-773.122) * (-772.346) (-773.001) (-775.764) [-772.341] -- 0:00:09
      842500 -- [-771.646] (-774.421) (-777.969) (-773.684) * (-774.119) [-772.676] (-773.006) (-772.442) -- 0:00:09
      843000 -- (-775.190) (-773.953) (-771.744) [-773.354] * (-773.017) (-774.910) [-776.438] (-773.803) -- 0:00:09
      843500 -- [-772.932] (-774.897) (-772.816) (-775.019) * (-773.035) (-773.226) (-772.902) [-773.007] -- 0:00:09
      844000 -- (-772.838) (-773.558) [-771.270] (-772.088) * (-773.564) (-774.017) (-774.716) [-773.236] -- 0:00:09
      844500 -- (-772.802) [-773.734] (-773.076) (-774.076) * [-774.809] (-773.099) (-777.449) (-773.262) -- 0:00:09
      845000 -- [-772.951] (-773.073) (-774.539) (-771.499) * [-774.336] (-773.850) (-778.735) (-772.843) -- 0:00:09

      Average standard deviation of split frequencies: 0.007504

      845500 -- (-772.463) [-777.368] (-771.814) (-772.475) * (-773.252) (-777.832) (-774.469) [-775.712] -- 0:00:09
      846000 -- (-771.704) [-772.989] (-774.160) (-772.883) * (-772.096) [-773.899] (-772.876) (-776.469) -- 0:00:09
      846500 -- (-775.281) (-773.680) (-777.902) [-773.106] * (-775.326) [-772.719] (-772.616) (-773.841) -- 0:00:09
      847000 -- (-776.414) [-772.718] (-774.634) (-772.976) * (-775.121) (-775.805) [-774.126] (-772.580) -- 0:00:09
      847500 -- (-775.720) [-772.335] (-773.071) (-773.149) * (-775.660) (-780.433) (-776.925) [-772.755] -- 0:00:09
      848000 -- (-778.722) (-774.113) (-774.355) [-773.009] * [-773.392] (-772.846) (-773.040) (-773.327) -- 0:00:09
      848500 -- (-772.701) (-773.381) [-772.739] (-773.523) * [-772.430] (-772.509) (-773.518) (-776.169) -- 0:00:09
      849000 -- (-772.004) [-772.983] (-776.010) (-771.904) * (-773.465) (-775.085) [-773.948] (-774.692) -- 0:00:09
      849500 -- (-774.315) (-773.186) (-776.872) [-771.661] * [-772.654] (-775.986) (-772.791) (-772.339) -- 0:00:09
      850000 -- (-775.129) (-772.069) [-776.427] (-772.474) * (-772.681) (-772.731) [-776.807] (-772.526) -- 0:00:09

      Average standard deviation of split frequencies: 0.007574

      850500 -- [-772.924] (-773.635) (-772.447) (-773.560) * (-774.000) [-772.737] (-774.672) (-776.650) -- 0:00:09
      851000 -- [-772.452] (-777.558) (-776.489) (-775.369) * (-775.878) [-771.912] (-772.226) (-776.014) -- 0:00:09
      851500 -- (-772.195) [-773.083] (-774.623) (-772.051) * (-774.912) [-774.403] (-772.509) (-771.656) -- 0:00:09
      852000 -- (-772.850) [-774.994] (-775.128) (-773.978) * [-776.231] (-773.485) (-772.087) (-773.204) -- 0:00:09
      852500 -- (-773.153) (-774.849) [-772.712] (-773.055) * (-773.471) (-772.187) [-775.671] (-773.789) -- 0:00:08
      853000 -- (-773.317) (-773.206) [-771.895] (-775.983) * (-775.431) (-772.850) (-773.499) [-773.023] -- 0:00:08
      853500 -- (-773.450) [-772.591] (-772.201) (-771.781) * [-772.999] (-774.570) (-774.143) (-772.290) -- 0:00:08
      854000 -- (-775.066) (-775.019) (-775.177) [-773.857] * (-772.279) (-774.123) (-773.886) [-773.517] -- 0:00:08
      854500 -- [-772.132] (-775.762) (-774.788) (-773.124) * [-773.247] (-772.208) (-776.005) (-777.415) -- 0:00:08
      855000 -- [-771.957] (-774.746) (-775.457) (-775.417) * (-772.052) (-772.818) [-773.548] (-776.124) -- 0:00:08

      Average standard deviation of split frequencies: 0.007710

      855500 -- (-776.037) [-776.176] (-773.530) (-773.883) * [-772.791] (-771.892) (-774.594) (-776.964) -- 0:00:08
      856000 -- [-772.950] (-775.164) (-774.047) (-772.144) * (-772.669) (-775.354) [-773.035] (-773.327) -- 0:00:08
      856500 -- [-773.785] (-775.291) (-772.253) (-772.275) * (-777.394) (-775.880) [-774.742] (-772.388) -- 0:00:08
      857000 -- [-773.146] (-775.268) (-773.904) (-773.396) * (-774.004) (-775.214) [-773.389] (-772.916) -- 0:00:08
      857500 -- (-773.046) (-776.546) [-772.000] (-773.460) * (-775.380) (-774.831) [-772.737] (-773.416) -- 0:00:08
      858000 -- [-772.930] (-776.682) (-773.072) (-777.555) * (-774.330) (-774.424) [-773.022] (-773.576) -- 0:00:08
      858500 -- [-774.959] (-776.003) (-777.482) (-773.645) * (-772.286) (-773.495) [-773.544] (-771.552) -- 0:00:08
      859000 -- (-771.997) [-774.933] (-776.462) (-775.008) * (-772.745) (-774.884) [-772.571] (-771.834) -- 0:00:08
      859500 -- (-776.687) (-775.047) [-775.778] (-772.443) * [-773.515] (-775.841) (-775.496) (-780.642) -- 0:00:08
      860000 -- (-776.094) [-771.694] (-774.033) (-775.595) * (-774.615) [-774.140] (-776.916) (-774.918) -- 0:00:08

      Average standard deviation of split frequencies: 0.008289

      860500 -- [-772.719] (-771.982) (-772.973) (-780.539) * (-774.795) (-775.021) (-773.670) [-772.330] -- 0:00:08
      861000 -- (-775.148) (-772.234) [-771.389] (-773.823) * (-772.649) (-774.082) [-772.984] (-773.132) -- 0:00:08
      861500 -- [-775.834] (-771.656) (-772.015) (-773.235) * (-771.907) (-774.567) [-774.409] (-772.189) -- 0:00:08
      862000 -- (-773.855) [-774.256] (-773.603) (-773.952) * (-773.456) (-775.019) [-772.686] (-774.798) -- 0:00:08
      862500 -- (-772.495) (-776.511) [-772.962] (-771.568) * [-773.862] (-776.910) (-772.718) (-772.931) -- 0:00:08
      863000 -- (-773.271) (-774.925) [-773.207] (-772.298) * (-772.259) (-772.775) [-773.506] (-771.781) -- 0:00:08
      863500 -- [-771.978] (-780.180) (-776.889) (-773.429) * (-774.085) (-773.085) [-772.381] (-771.828) -- 0:00:08
      864000 -- (-772.648) (-774.308) (-773.094) [-771.792] * [-773.234] (-772.121) (-771.923) (-774.557) -- 0:00:08
      864500 -- (-773.162) (-775.946) (-772.977) [-773.961] * (-774.333) (-772.643) [-775.556] (-775.685) -- 0:00:08
      865000 -- (-773.458) [-772.291] (-773.155) (-776.378) * (-774.294) (-773.179) (-772.682) [-774.009] -- 0:00:08

      Average standard deviation of split frequencies: 0.007947

      865500 -- (-774.100) (-773.793) (-772.264) [-774.429] * (-773.915) (-774.263) (-771.877) [-772.851] -- 0:00:08
      866000 -- [-772.274] (-771.710) (-773.024) (-775.901) * (-772.653) [-774.230] (-771.877) (-772.151) -- 0:00:08
      866500 -- [-774.460] (-771.978) (-774.211) (-772.982) * (-775.498) (-774.944) (-773.290) [-772.503] -- 0:00:08
      867000 -- (-774.009) (-771.938) [-772.131] (-772.739) * (-774.468) [-773.543] (-771.445) (-772.617) -- 0:00:08
      867500 -- [-772.030] (-774.790) (-772.233) (-771.749) * (-774.100) [-775.359] (-772.657) (-773.274) -- 0:00:08
      868000 -- (-772.574) (-771.865) [-772.315] (-773.229) * (-777.001) (-772.321) (-773.449) [-775.139] -- 0:00:08
      868500 -- (-771.840) (-774.613) (-775.647) [-777.546] * (-773.465) (-777.096) [-772.838] (-773.376) -- 0:00:08
      869000 -- (-773.268) (-773.640) (-773.068) [-772.123] * (-774.357) (-773.035) [-774.827] (-776.315) -- 0:00:07
      869500 -- [-774.096] (-772.445) (-772.443) (-773.997) * (-772.124) (-773.623) [-773.912] (-771.832) -- 0:00:07
      870000 -- (-773.351) [-772.369] (-772.608) (-776.504) * [-771.992] (-772.025) (-772.810) (-774.493) -- 0:00:07

      Average standard deviation of split frequencies: 0.007724

      870500 -- [-774.350] (-771.835) (-772.267) (-775.701) * [-773.505] (-773.965) (-776.173) (-773.817) -- 0:00:07
      871000 -- (-772.149) (-773.816) (-772.739) [-775.946] * (-773.558) (-773.592) (-774.792) [-774.005] -- 0:00:07
      871500 -- (-771.664) (-772.783) (-774.856) [-776.523] * (-774.524) [-772.116] (-774.995) (-775.350) -- 0:00:07
      872000 -- (-772.693) (-774.492) (-776.674) [-773.113] * (-773.711) (-773.868) [-773.040] (-772.505) -- 0:00:07
      872500 -- [-774.157] (-772.782) (-773.396) (-773.142) * (-772.965) (-773.135) (-772.013) [-773.130] -- 0:00:07
      873000 -- (-773.539) (-771.909) (-773.096) [-774.072] * (-773.885) (-775.510) [-774.579] (-772.903) -- 0:00:07
      873500 -- (-773.539) (-772.988) [-777.495] (-771.899) * (-779.529) [-773.325] (-777.872) (-773.360) -- 0:00:07
      874000 -- (-773.635) [-772.364] (-773.230) (-774.991) * (-779.013) (-773.297) (-773.421) [-772.942] -- 0:00:07
      874500 -- (-772.521) (-773.579) (-776.084) [-771.947] * (-774.955) [-774.475] (-772.846) (-776.867) -- 0:00:07
      875000 -- (-773.757) (-775.920) [-775.451] (-773.246) * (-775.051) (-773.801) [-772.399] (-772.698) -- 0:00:07

      Average standard deviation of split frequencies: 0.007893

      875500 -- (-774.192) (-774.616) [-779.419] (-772.243) * [-774.206] (-772.723) (-775.370) (-772.164) -- 0:00:07
      876000 -- (-778.328) (-777.170) (-776.073) [-772.608] * [-772.625] (-774.219) (-773.682) (-774.611) -- 0:00:07
      876500 -- [-773.401] (-774.682) (-775.605) (-773.536) * (-773.707) (-775.520) [-772.640] (-772.542) -- 0:00:07
      877000 -- (-772.312) (-772.998) [-772.142] (-777.492) * (-773.933) (-772.814) [-773.076] (-773.528) -- 0:00:07
      877500 -- (-772.638) [-775.231] (-771.634) (-774.191) * (-773.172) [-774.273] (-778.475) (-772.616) -- 0:00:07
      878000 -- (-775.722) (-776.113) [-774.441] (-773.443) * [-775.787] (-773.203) (-777.246) (-771.847) -- 0:00:07
      878500 -- (-774.708) (-775.082) (-778.688) [-776.295] * (-771.891) (-774.127) (-776.704) [-771.847] -- 0:00:07
      879000 -- (-772.252) (-777.133) [-774.455] (-776.261) * (-774.860) [-771.613] (-773.657) (-779.694) -- 0:00:07
      879500 -- (-772.286) [-778.159] (-774.650) (-774.274) * (-774.874) [-774.441] (-775.521) (-773.296) -- 0:00:07
      880000 -- (-773.507) (-774.449) [-772.841] (-773.354) * (-773.778) [-774.440] (-771.539) (-777.656) -- 0:00:07

      Average standard deviation of split frequencies: 0.008101

      880500 -- (-773.739) (-774.208) [-774.367] (-774.187) * (-773.156) (-775.583) (-771.572) [-773.466] -- 0:00:07
      881000 -- [-774.519] (-772.599) (-772.270) (-773.659) * (-773.642) (-774.812) (-777.183) [-772.317] -- 0:00:07
      881500 -- (-773.486) (-773.045) (-772.297) [-775.585] * (-779.166) (-773.662) [-775.578] (-775.255) -- 0:00:07
      882000 -- [-772.824] (-774.685) (-774.638) (-775.764) * [-775.462] (-772.199) (-773.109) (-773.513) -- 0:00:07
      882500 -- (-772.705) (-773.193) [-774.563] (-772.164) * (-773.679) [-772.905] (-773.194) (-772.643) -- 0:00:07
      883000 -- [-772.721] (-777.471) (-775.562) (-772.300) * [-773.874] (-772.238) (-771.479) (-775.152) -- 0:00:07
      883500 -- (-774.237) (-773.019) [-771.694] (-772.936) * (-773.635) (-772.949) [-773.566] (-777.585) -- 0:00:07
      884000 -- (-773.182) (-775.713) (-775.333) [-776.090] * (-772.497) (-774.420) [-774.201] (-774.438) -- 0:00:07
      884500 -- (-774.586) (-779.342) (-773.528) [-774.056] * (-773.651) (-773.369) [-775.330] (-773.144) -- 0:00:07
      885000 -- (-774.894) (-774.775) (-772.102) [-773.054] * (-774.680) [-773.404] (-775.795) (-777.526) -- 0:00:07

      Average standard deviation of split frequencies: 0.008655

      885500 -- [-772.528] (-772.538) (-773.826) (-775.271) * (-773.016) [-772.244] (-774.100) (-777.529) -- 0:00:06
      886000 -- (-772.040) (-778.507) (-772.562) [-772.825] * (-773.664) (-773.389) (-774.106) [-776.205] -- 0:00:06
      886500 -- (-776.682) [-774.080] (-774.143) (-771.960) * [-772.853] (-772.867) (-772.788) (-777.935) -- 0:00:06
      887000 -- [-773.770] (-775.459) (-774.756) (-772.406) * (-773.235) (-772.840) [-773.670] (-774.586) -- 0:00:06
      887500 -- (-772.574) (-775.258) [-774.036] (-773.537) * (-773.013) (-777.345) [-771.668] (-775.536) -- 0:00:06
      888000 -- (-772.084) [-773.402] (-775.324) (-772.633) * (-776.593) (-777.865) (-773.119) [-772.627] -- 0:00:06
      888500 -- (-778.652) (-776.328) (-774.584) [-771.986] * (-772.944) (-779.416) (-772.289) [-774.500] -- 0:00:06
      889000 -- (-779.363) [-772.639] (-772.432) (-772.887) * (-773.222) (-772.543) (-771.957) [-773.707] -- 0:00:06
      889500 -- (-776.657) (-774.903) [-773.014] (-773.148) * (-776.304) [-775.019] (-773.517) (-773.783) -- 0:00:06
      890000 -- (-774.145) [-775.352] (-774.029) (-775.404) * (-772.859) (-774.461) (-774.287) [-773.783] -- 0:00:06

      Average standard deviation of split frequencies: 0.008468

      890500 -- (-773.351) (-777.850) (-772.487) [-775.410] * (-771.986) [-772.195] (-772.501) (-778.134) -- 0:00:06
      891000 -- (-772.997) (-777.338) (-776.300) [-773.764] * (-774.154) (-772.003) (-776.954) [-773.885] -- 0:00:06
      891500 -- (-772.698) [-773.502] (-773.270) (-776.554) * (-773.158) (-772.830) [-774.020] (-773.576) -- 0:00:06
      892000 -- (-772.930) (-771.701) [-773.910] (-772.950) * (-772.788) (-771.557) [-772.740] (-774.273) -- 0:00:06
      892500 -- (-772.176) (-773.850) (-775.187) [-773.007] * (-771.815) [-771.670] (-776.481) (-775.581) -- 0:00:06
      893000 -- (-773.618) (-776.066) (-773.419) [-773.267] * (-772.014) (-774.284) (-772.809) [-772.449] -- 0:00:06
      893500 -- (-774.880) (-775.874) [-772.740] (-775.089) * (-778.217) (-776.400) [-774.600] (-773.156) -- 0:00:06
      894000 -- [-771.604] (-773.243) (-773.539) (-778.126) * (-777.965) [-774.571] (-772.285) (-772.139) -- 0:00:06
      894500 -- (-772.657) [-773.273] (-772.683) (-776.176) * (-773.348) (-772.587) [-772.503] (-772.618) -- 0:00:06
      895000 -- (-772.388) (-777.221) [-774.180] (-776.106) * [-773.294] (-777.766) (-772.694) (-773.044) -- 0:00:06

      Average standard deviation of split frequencies: 0.008628

      895500 -- [-771.715] (-774.248) (-774.892) (-773.135) * [-772.119] (-772.902) (-772.181) (-775.354) -- 0:00:06
      896000 -- [-772.911] (-772.932) (-780.141) (-773.840) * [-773.570] (-774.095) (-776.676) (-773.585) -- 0:00:06
      896500 -- [-773.354] (-773.710) (-774.291) (-775.408) * [-774.331] (-777.315) (-777.443) (-773.143) -- 0:00:06
      897000 -- (-772.989) [-774.828] (-776.124) (-775.043) * (-774.970) (-773.592) [-774.549] (-774.053) -- 0:00:06
      897500 -- (-774.867) (-774.254) (-774.759) [-775.598] * (-774.244) (-776.251) (-772.733) [-771.642] -- 0:00:06
      898000 -- [-773.588] (-773.930) (-773.384) (-772.185) * [-772.533] (-777.484) (-774.089) (-777.336) -- 0:00:06
      898500 -- (-774.586) [-773.894] (-780.234) (-775.442) * (-776.329) (-776.266) [-771.513] (-775.811) -- 0:00:06
      899000 -- (-775.833) (-775.074) (-774.164) [-774.338] * (-775.596) [-774.999] (-772.109) (-776.386) -- 0:00:06
      899500 -- (-772.758) (-772.690) (-774.515) [-772.577] * [-775.663] (-772.419) (-771.846) (-776.507) -- 0:00:06
      900000 -- [-772.153] (-772.190) (-776.564) (-772.589) * (-773.611) (-772.355) [-772.442] (-773.585) -- 0:00:06

      Average standard deviation of split frequencies: 0.008863

      900500 -- (-774.455) (-774.701) [-775.519] (-774.841) * (-777.346) (-773.436) (-772.170) [-772.457] -- 0:00:06
      901000 -- [-771.691] (-773.747) (-775.325) (-773.707) * (-777.191) (-772.019) [-773.881] (-774.627) -- 0:00:06
      901500 -- (-771.754) (-771.325) (-775.061) [-771.804] * (-775.838) (-772.123) [-772.107] (-773.929) -- 0:00:06
      902000 -- (-771.469) (-772.807) [-773.327] (-771.841) * (-775.079) (-774.394) [-771.404] (-773.405) -- 0:00:05
      902500 -- [-771.697] (-773.704) (-773.274) (-774.212) * [-775.088] (-774.388) (-774.575) (-772.739) -- 0:00:05
      903000 -- (-773.647) (-775.407) (-772.281) [-774.288] * (-774.943) [-773.346] (-773.424) (-772.736) -- 0:00:05
      903500 -- [-773.213] (-773.339) (-773.649) (-776.960) * (-772.303) (-772.362) [-773.678] (-776.042) -- 0:00:05
      904000 -- (-774.722) (-771.948) (-772.337) [-774.512] * [-774.426] (-772.183) (-776.883) (-775.620) -- 0:00:05
      904500 -- (-773.921) (-774.786) (-773.110) [-775.217] * [-773.412] (-771.849) (-772.764) (-774.694) -- 0:00:05
      905000 -- (-772.297) [-775.254] (-772.843) (-775.962) * (-774.394) (-771.640) (-774.298) [-775.942] -- 0:00:05

      Average standard deviation of split frequencies: 0.008498

      905500 -- (-777.435) [-774.314] (-776.114) (-778.893) * (-774.052) [-773.850] (-772.930) (-771.870) -- 0:00:05
      906000 -- (-774.066) [-775.127] (-776.632) (-773.481) * (-774.321) (-775.170) (-771.716) [-772.197] -- 0:00:05
      906500 -- (-773.245) (-772.931) (-777.395) [-771.567] * [-773.824] (-773.158) (-774.745) (-773.084) -- 0:00:05
      907000 -- (-772.519) (-779.480) [-773.165] (-772.478) * [-773.743] (-774.558) (-775.173) (-772.666) -- 0:00:05
      907500 -- (-774.421) (-778.888) [-773.516] (-773.192) * (-772.867) (-777.357) [-778.138] (-772.157) -- 0:00:05
      908000 -- [-771.774] (-771.714) (-772.891) (-772.260) * (-773.676) (-776.372) (-777.401) [-774.973] -- 0:00:05
      908500 -- (-772.142) (-772.002) [-774.330] (-775.005) * (-775.613) [-774.084] (-776.360) (-774.058) -- 0:00:05
      909000 -- (-772.575) [-774.466] (-777.921) (-773.832) * (-772.733) (-774.892) (-774.301) [-772.557] -- 0:00:05
      909500 -- (-772.907) (-772.149) (-775.110) [-773.398] * (-773.078) (-773.364) [-773.094] (-771.500) -- 0:00:05
      910000 -- [-772.968] (-775.621) (-773.857) (-773.341) * (-773.170) (-773.208) (-771.820) [-774.856] -- 0:00:05

      Average standard deviation of split frequencies: 0.008627

      910500 -- (-773.560) [-771.757] (-771.452) (-772.766) * (-773.002) (-773.207) [-775.407] (-776.519) -- 0:00:05
      911000 -- [-773.731] (-771.770) (-776.299) (-772.116) * (-772.427) [-777.117] (-778.808) (-775.093) -- 0:00:05
      911500 -- (-774.457) (-771.932) (-772.301) [-772.515] * [-772.893] (-772.388) (-780.268) (-772.016) -- 0:00:05
      912000 -- [-775.188] (-775.297) (-777.934) (-774.790) * (-775.841) (-772.918) [-774.652] (-772.762) -- 0:00:05
      912500 -- [-773.858] (-774.873) (-774.951) (-774.180) * (-773.414) (-778.065) (-772.316) [-777.179] -- 0:00:05
      913000 -- [-776.267] (-772.429) (-774.922) (-774.636) * (-775.727) [-775.644] (-774.458) (-774.095) -- 0:00:05
      913500 -- (-776.055) [-772.197] (-772.716) (-772.205) * [-773.379] (-775.664) (-774.876) (-772.469) -- 0:00:05
      914000 -- [-773.760] (-772.377) (-773.314) (-773.456) * (-772.406) (-773.266) (-776.552) [-777.208] -- 0:00:05
      914500 -- (-776.697) [-772.232] (-774.406) (-771.884) * [-772.249] (-775.967) (-775.950) (-774.828) -- 0:00:05
      915000 -- (-773.298) [-772.812] (-774.298) (-774.533) * (-774.328) [-774.644] (-773.928) (-774.649) -- 0:00:05

      Average standard deviation of split frequencies: 0.008612

      915500 -- (-777.716) (-776.528) (-773.178) [-774.666] * (-773.825) (-774.939) (-772.924) [-773.142] -- 0:00:05
      916000 -- (-776.932) (-775.250) [-772.415] (-779.255) * (-776.103) (-772.805) [-775.305] (-771.846) -- 0:00:05
      916500 -- (-775.948) (-774.137) [-775.872] (-774.989) * [-774.233] (-773.621) (-773.305) (-771.946) -- 0:00:05
      917000 -- (-774.412) (-774.277) [-773.875] (-774.921) * (-773.585) [-776.456] (-774.271) (-772.349) -- 0:00:05
      917500 -- (-775.746) [-776.044] (-772.441) (-773.202) * (-774.251) [-777.860] (-775.600) (-773.714) -- 0:00:05
      918000 -- (-773.487) [-773.727] (-773.757) (-773.882) * (-773.338) (-772.142) [-772.698] (-774.086) -- 0:00:05
      918500 -- (-773.777) (-775.517) [-775.329] (-771.939) * (-775.657) [-775.588] (-777.652) (-774.234) -- 0:00:04
      919000 -- [-774.226] (-773.333) (-773.413) (-774.014) * (-776.445) [-773.442] (-772.287) (-774.765) -- 0:00:04
      919500 -- [-771.931] (-772.263) (-779.459) (-772.268) * [-772.343] (-774.566) (-774.539) (-775.303) -- 0:00:04
      920000 -- (-771.777) (-773.077) [-772.985] (-774.779) * [-772.566] (-772.342) (-774.921) (-780.116) -- 0:00:04

      Average standard deviation of split frequencies: 0.008602

      920500 -- (-771.954) [-772.691] (-773.120) (-774.245) * (-773.540) (-772.590) [-775.084] (-776.534) -- 0:00:04
      921000 -- [-773.992] (-771.944) (-774.434) (-772.279) * (-772.925) (-772.901) (-774.096) [-773.374] -- 0:00:04
      921500 -- (-772.403) (-772.431) [-774.386] (-773.901) * [-772.843] (-777.080) (-774.311) (-777.714) -- 0:00:04
      922000 -- (-773.000) (-778.498) (-774.957) [-773.876] * (-773.447) (-773.022) [-772.409] (-777.714) -- 0:00:04
      922500 -- (-772.090) [-772.711] (-772.379) (-773.763) * (-773.700) [-772.205] (-773.338) (-772.756) -- 0:00:04
      923000 -- (-772.111) [-773.009] (-775.375) (-772.006) * (-775.057) [-774.146] (-772.771) (-773.463) -- 0:00:04
      923500 -- (-772.859) (-776.720) [-774.434] (-774.394) * [-772.349] (-772.994) (-773.178) (-771.951) -- 0:00:04
      924000 -- (-772.702) (-780.814) [-773.178] (-774.111) * (-775.565) (-774.019) (-775.513) [-773.281] -- 0:00:04
      924500 -- [-774.132] (-774.056) (-772.748) (-771.683) * (-773.699) (-774.282) (-777.187) [-774.144] -- 0:00:04
      925000 -- (-773.458) (-774.904) [-772.522] (-775.510) * (-773.247) (-774.498) [-773.812] (-772.325) -- 0:00:04

      Average standard deviation of split frequencies: 0.008451

      925500 -- (-775.229) (-776.946) (-776.577) [-771.814] * [-774.451] (-773.210) (-772.972) (-773.565) -- 0:00:04
      926000 -- (-772.890) [-774.634] (-772.637) (-774.971) * (-773.472) (-773.733) (-772.787) [-774.076] -- 0:00:04
      926500 -- [-771.829] (-775.292) (-775.956) (-774.983) * (-775.832) (-772.012) [-773.580] (-772.360) -- 0:00:04
      927000 -- [-772.702] (-774.549) (-774.796) (-773.247) * (-773.497) [-776.046] (-773.288) (-772.759) -- 0:00:04
      927500 -- [-773.498] (-775.148) (-774.635) (-773.154) * (-773.786) (-778.823) [-775.926] (-774.704) -- 0:00:04
      928000 -- (-772.367) (-774.747) [-773.400] (-772.694) * (-774.431) (-772.523) [-774.064] (-775.651) -- 0:00:04
      928500 -- (-772.634) [-772.878] (-777.826) (-773.425) * [-773.464] (-771.762) (-775.430) (-775.369) -- 0:00:04
      929000 -- [-772.860] (-772.477) (-771.358) (-771.810) * (-777.590) (-775.559) [-774.630] (-773.166) -- 0:00:04
      929500 -- (-774.411) (-773.985) (-772.933) [-772.912] * (-775.917) (-778.665) [-774.182] (-773.165) -- 0:00:04
      930000 -- (-772.082) (-772.071) [-773.339] (-774.856) * (-773.943) (-774.037) [-775.448] (-771.301) -- 0:00:04

      Average standard deviation of split frequencies: 0.008172

      930500 -- (-772.807) (-772.014) [-773.057] (-775.537) * (-772.271) (-774.026) [-772.200] (-774.251) -- 0:00:04
      931000 -- (-773.234) (-777.850) (-773.122) [-775.372] * (-772.039) (-774.308) [-771.960] (-772.761) -- 0:00:04
      931500 -- (-773.948) (-771.756) [-774.263] (-777.841) * (-774.121) (-773.171) [-775.822] (-772.604) -- 0:00:04
      932000 -- (-773.735) (-771.995) (-774.328) [-777.757] * (-771.975) [-775.203] (-775.762) (-773.458) -- 0:00:04
      932500 -- (-775.501) (-779.178) (-773.239) [-774.621] * (-772.736) (-775.787) (-774.128) [-773.510] -- 0:00:04
      933000 -- (-776.550) (-775.802) (-773.548) [-774.285] * [-774.290] (-773.164) (-773.777) (-774.788) -- 0:00:04
      933500 -- (-775.337) (-775.880) [-775.152] (-776.227) * (-772.521) [-774.120] (-774.845) (-777.799) -- 0:00:04
      934000 -- [-774.677] (-773.659) (-775.866) (-775.200) * [-772.671] (-776.297) (-778.503) (-774.626) -- 0:00:04
      934500 -- [-775.056] (-774.853) (-772.014) (-775.437) * (-774.105) (-774.866) (-773.168) [-778.444] -- 0:00:03
      935000 -- [-774.376] (-772.529) (-774.744) (-773.462) * (-771.763) (-775.462) (-776.652) [-775.889] -- 0:00:03

      Average standard deviation of split frequencies: 0.008428

      935500 -- [-773.068] (-775.243) (-773.781) (-774.768) * (-771.958) [-774.553] (-772.472) (-772.716) -- 0:00:03
      936000 -- [-773.662] (-772.163) (-772.544) (-772.243) * (-771.822) [-775.899] (-777.732) (-773.705) -- 0:00:03
      936500 -- (-774.924) (-774.028) (-772.973) [-772.086] * [-776.430] (-777.348) (-772.633) (-773.717) -- 0:00:03
      937000 -- [-772.129] (-775.293) (-774.337) (-772.040) * (-774.712) (-772.347) (-772.782) [-774.129] -- 0:00:03
      937500 -- (-773.018) (-772.553) [-772.598] (-772.743) * (-778.840) [-773.853] (-773.481) (-772.490) -- 0:00:03
      938000 -- (-776.465) [-772.946] (-776.155) (-775.734) * (-773.688) [-773.351] (-774.977) (-772.662) -- 0:00:03
      938500 -- (-774.103) (-772.933) (-774.051) [-774.913] * (-775.897) (-774.098) [-774.370] (-775.435) -- 0:00:03
      939000 -- (-772.599) (-774.305) [-773.854] (-772.428) * (-773.056) (-777.038) [-773.999] (-771.973) -- 0:00:03
      939500 -- (-773.700) (-775.693) (-775.913) [-777.424] * (-771.984) [-774.159] (-773.117) (-773.562) -- 0:00:03
      940000 -- [-772.300] (-772.164) (-774.038) (-774.240) * (-772.616) [-772.260] (-772.453) (-778.841) -- 0:00:03

      Average standard deviation of split frequencies: 0.008152

      940500 -- (-772.148) (-772.164) (-775.602) [-771.681] * (-782.760) (-773.231) [-772.100] (-774.019) -- 0:00:03
      941000 -- (-773.863) [-773.419] (-775.867) (-772.850) * (-773.952) [-772.110] (-773.086) (-776.910) -- 0:00:03
      941500 -- (-773.436) [-772.106] (-772.519) (-774.137) * [-773.479] (-772.480) (-771.984) (-774.475) -- 0:00:03
      942000 -- (-775.928) (-772.097) [-771.968] (-771.901) * (-772.697) (-773.002) [-772.835] (-773.346) -- 0:00:03
      942500 -- [-774.462] (-771.906) (-778.301) (-772.625) * (-772.681) (-772.380) (-776.810) [-776.734] -- 0:00:03
      943000 -- (-773.735) [-772.134] (-773.467) (-772.317) * (-774.702) [-772.567] (-774.217) (-774.921) -- 0:00:03
      943500 -- (-773.868) (-774.415) [-772.772] (-773.855) * (-776.040) (-774.324) [-773.339] (-774.188) -- 0:00:03
      944000 -- [-773.671] (-773.636) (-774.770) (-773.122) * [-773.834] (-773.231) (-772.795) (-774.330) -- 0:00:03
      944500 -- (-774.814) [-773.519] (-775.796) (-772.077) * (-772.820) (-772.353) (-775.211) [-772.984] -- 0:00:03
      945000 -- (-772.209) (-774.479) (-772.285) [-772.247] * (-772.227) (-775.122) (-772.214) [-771.894] -- 0:00:03

      Average standard deviation of split frequencies: 0.008305

      945500 -- [-775.976] (-773.730) (-772.922) (-771.948) * [-772.233] (-776.758) (-772.436) (-772.345) -- 0:00:03
      946000 -- (-773.971) (-773.532) [-772.642] (-773.082) * [-774.326] (-773.719) (-772.265) (-777.356) -- 0:00:03
      946500 -- [-774.519] (-773.170) (-773.139) (-774.010) * [-774.485] (-772.434) (-774.192) (-772.509) -- 0:00:03
      947000 -- (-772.614) (-773.791) (-773.665) [-772.024] * (-773.009) (-772.154) (-773.885) [-771.788] -- 0:00:03
      947500 -- (-773.600) (-776.321) [-775.896] (-773.361) * (-775.123) (-773.471) [-773.507] (-773.501) -- 0:00:03
      948000 -- (-772.678) (-773.776) (-773.720) [-773.365] * (-774.614) (-773.464) [-773.070] (-772.220) -- 0:00:03
      948500 -- (-773.801) (-774.365) [-771.462] (-773.639) * [-773.861] (-775.080) (-773.074) (-774.897) -- 0:00:03
      949000 -- (-773.878) (-779.787) [-773.457] (-776.559) * (-773.006) (-776.864) (-773.213) [-776.366] -- 0:00:03
      949500 -- (-772.608) [-774.125] (-773.476) (-777.904) * (-772.231) [-777.728] (-773.341) (-776.661) -- 0:00:03
      950000 -- (-773.239) [-777.981] (-773.827) (-772.248) * (-774.436) (-772.797) (-772.138) [-773.209] -- 0:00:03

      Average standard deviation of split frequencies: 0.008132

      950500 -- (-773.697) [-773.939] (-778.032) (-776.359) * [-772.604] (-773.201) (-775.612) (-771.406) -- 0:00:03
      951000 -- [-776.292] (-774.365) (-777.588) (-775.375) * (-777.074) [-773.319] (-772.630) (-771.720) -- 0:00:02
      951500 -- (-774.949) [-774.461] (-776.325) (-773.572) * (-776.308) [-773.321] (-775.561) (-778.130) -- 0:00:02
      952000 -- (-776.290) [-772.201] (-775.575) (-773.335) * (-776.476) [-771.997] (-775.963) (-773.547) -- 0:00:02
      952500 -- (-772.899) [-774.487] (-773.881) (-773.810) * (-774.239) [-775.155] (-772.841) (-772.293) -- 0:00:02
      953000 -- (-775.730) (-776.884) (-773.308) [-773.712] * [-772.675] (-773.584) (-772.436) (-775.713) -- 0:00:02
      953500 -- [-777.258] (-774.754) (-772.706) (-773.565) * (-774.985) (-774.251) (-773.031) [-775.327] -- 0:00:02
      954000 -- (-771.775) (-774.521) [-773.553] (-771.543) * (-772.831) [-772.236] (-772.497) (-774.579) -- 0:00:02
      954500 -- [-773.122] (-779.442) (-773.782) (-772.720) * [-772.515] (-776.284) (-774.369) (-773.440) -- 0:00:02
      955000 -- [-773.752] (-777.321) (-774.108) (-774.038) * [-773.517] (-772.192) (-772.158) (-773.440) -- 0:00:02

      Average standard deviation of split frequencies: 0.007922

      955500 -- (-774.799) [-772.938] (-772.127) (-776.995) * [-773.286] (-773.162) (-773.457) (-774.033) -- 0:00:02
      956000 -- (-775.106) [-773.278] (-776.611) (-774.588) * (-774.062) (-771.815) [-776.057] (-775.706) -- 0:00:02
      956500 -- (-771.531) [-775.976] (-776.376) (-773.369) * (-775.020) (-774.116) (-773.809) [-774.566] -- 0:00:02
      957000 -- (-772.586) [-773.099] (-777.734) (-774.035) * (-773.586) [-774.004] (-773.880) (-778.026) -- 0:00:02
      957500 -- [-772.394] (-774.633) (-774.600) (-773.763) * [-774.713] (-773.363) (-775.527) (-774.047) -- 0:00:02
      958000 -- (-776.320) [-771.838] (-771.865) (-772.677) * (-772.067) [-776.268] (-773.640) (-772.670) -- 0:00:02
      958500 -- (-775.119) (-773.407) (-772.231) [-773.456] * [-772.635] (-775.170) (-772.691) (-773.346) -- 0:00:02
      959000 -- [-772.198] (-773.845) (-773.123) (-772.633) * (-778.247) [-778.050] (-772.317) (-772.162) -- 0:00:02
      959500 -- [-775.041] (-772.991) (-773.592) (-772.232) * [-773.194] (-771.593) (-772.363) (-773.077) -- 0:00:02
      960000 -- (-773.213) (-773.229) [-774.759] (-771.862) * [-773.454] (-774.091) (-774.295) (-774.311) -- 0:00:02

      Average standard deviation of split frequencies: 0.007753

      960500 -- (-771.580) (-772.437) [-775.087] (-771.519) * (-776.059) (-776.195) (-774.285) [-771.504] -- 0:00:02
      961000 -- (-772.692) [-772.182] (-774.669) (-773.788) * (-774.725) (-774.278) (-772.097) [-772.717] -- 0:00:02
      961500 -- (-781.363) (-771.963) (-771.584) [-773.843] * (-775.065) (-773.420) [-772.260] (-777.799) -- 0:00:02
      962000 -- (-773.139) [-776.001] (-772.448) (-778.862) * (-774.424) (-774.270) [-773.490] (-777.677) -- 0:00:02
      962500 -- (-773.723) (-774.003) (-773.488) [-772.487] * (-774.175) (-773.312) [-773.083] (-772.605) -- 0:00:02
      963000 -- (-772.311) (-774.356) (-771.991) [-775.392] * (-775.164) (-774.522) [-772.852] (-772.621) -- 0:00:02
      963500 -- (-772.150) [-774.327] (-772.487) (-773.240) * (-777.087) [-773.205] (-772.113) (-774.698) -- 0:00:02
      964000 -- (-773.245) (-778.504) [-774.944] (-774.570) * (-772.235) (-776.554) [-772.606] (-772.767) -- 0:00:02
      964500 -- (-772.234) (-778.667) [-773.776] (-772.390) * (-772.571) (-778.170) (-771.363) [-772.634] -- 0:00:02
      965000 -- [-772.988] (-772.561) (-775.387) (-781.976) * (-775.170) (-771.983) [-773.193] (-772.718) -- 0:00:02

      Average standard deviation of split frequencies: 0.007580

      965500 -- (-773.176) [-772.479] (-772.048) (-772.362) * (-774.050) (-773.219) (-775.324) [-773.330] -- 0:00:02
      966000 -- (-774.708) (-772.162) [-772.923] (-775.031) * (-773.961) (-774.893) [-772.937] (-772.573) -- 0:00:02
      966500 -- (-775.087) (-774.340) (-773.009) [-774.399] * (-773.442) [-774.332] (-773.125) (-773.129) -- 0:00:02
      967000 -- (-773.873) [-775.892] (-773.884) (-772.330) * [-771.722] (-779.487) (-774.066) (-774.961) -- 0:00:02
      967500 -- (-774.184) (-776.259) [-771.485] (-776.592) * [-775.082] (-772.904) (-775.971) (-773.735) -- 0:00:01
      968000 -- [-773.603] (-778.079) (-774.233) (-772.304) * (-772.998) (-772.870) [-772.809] (-775.595) -- 0:00:01
      968500 -- (-773.473) [-775.020] (-773.882) (-772.600) * (-774.697) [-773.063] (-773.826) (-779.092) -- 0:00:01
      969000 -- (-778.118) [-772.474] (-772.833) (-772.849) * (-774.364) [-773.108] (-775.108) (-780.691) -- 0:00:01
      969500 -- (-771.991) (-772.363) [-771.393] (-774.542) * (-774.570) [-771.872] (-771.854) (-777.501) -- 0:00:01
      970000 -- (-779.617) [-772.749] (-771.444) (-774.109) * (-772.907) (-774.443) [-773.168] (-778.691) -- 0:00:01

      Average standard deviation of split frequencies: 0.007932

      970500 -- [-773.716] (-773.524) (-774.813) (-775.378) * [-773.870] (-773.148) (-775.925) (-774.331) -- 0:00:01
      971000 -- (-773.348) (-777.396) [-771.863] (-771.549) * (-771.989) (-772.558) (-773.125) [-774.288] -- 0:00:01
      971500 -- (-775.461) (-779.292) [-772.705] (-774.104) * [-772.052] (-776.196) (-772.199) (-773.741) -- 0:00:01
      972000 -- (-780.588) [-771.757] (-771.441) (-771.648) * (-772.255) (-775.560) [-772.477] (-772.400) -- 0:00:01
      972500 -- [-772.016] (-772.396) (-773.157) (-772.695) * [-772.459] (-774.897) (-772.480) (-773.887) -- 0:00:01
      973000 -- (-772.696) [-771.933] (-772.340) (-774.721) * (-773.789) [-772.714] (-774.209) (-775.872) -- 0:00:01
      973500 -- [-772.421] (-773.751) (-773.620) (-774.166) * (-773.065) [-772.951] (-773.538) (-776.420) -- 0:00:01
      974000 -- (-774.289) (-773.793) (-772.888) [-771.880] * (-773.584) (-771.793) (-772.516) [-773.565] -- 0:00:01
      974500 -- (-779.321) (-773.947) [-773.299] (-771.599) * [-777.311] (-771.710) (-776.907) (-774.922) -- 0:00:01
      975000 -- (-780.126) [-775.242] (-773.942) (-772.962) * (-775.561) (-772.148) [-775.513] (-777.981) -- 0:00:01

      Average standard deviation of split frequencies: 0.008436

      975500 -- (-777.357) [-772.003] (-773.271) (-773.210) * (-773.409) (-775.944) (-772.449) [-774.153] -- 0:00:01
      976000 -- [-775.136] (-774.564) (-773.760) (-773.043) * [-771.934] (-774.687) (-774.112) (-779.664) -- 0:00:01
      976500 -- (-773.686) (-775.199) [-771.933] (-772.833) * [-772.413] (-775.871) (-773.201) (-774.079) -- 0:00:01
      977000 -- (-773.380) [-773.007] (-774.250) (-772.197) * (-773.775) (-773.163) (-773.115) [-778.824] -- 0:00:01
      977500 -- (-773.317) [-774.908] (-772.270) (-776.372) * (-773.823) [-771.918] (-773.719) (-777.599) -- 0:00:01
      978000 -- (-773.354) (-778.320) (-775.102) [-773.934] * (-774.445) (-775.796) (-774.902) [-774.448] -- 0:00:01
      978500 -- (-773.856) (-780.569) (-773.881) [-773.575] * (-775.000) [-772.281] (-774.272) (-772.728) -- 0:00:01
      979000 -- (-773.774) (-776.947) [-774.201] (-775.432) * (-776.801) (-772.801) [-773.648] (-775.764) -- 0:00:01
      979500 -- (-773.015) (-772.756) (-772.482) [-774.093] * (-777.955) (-774.047) (-778.068) [-774.943] -- 0:00:01
      980000 -- (-772.098) [-775.049] (-773.972) (-776.545) * [-772.556] (-774.829) (-772.188) (-774.669) -- 0:00:01

      Average standard deviation of split frequencies: 0.008749

      980500 -- (-772.239) (-774.556) (-776.077) [-774.125] * (-777.176) (-778.058) [-772.509] (-779.424) -- 0:00:01
      981000 -- [-773.893] (-773.588) (-772.612) (-775.938) * (-775.891) (-775.645) [-773.052] (-777.376) -- 0:00:01
      981500 -- (-771.609) (-773.536) (-774.248) [-774.395] * [-774.516] (-776.773) (-773.653) (-774.475) -- 0:00:01
      982000 -- (-774.337) (-775.597) (-773.260) [-777.180] * [-778.010] (-776.655) (-772.486) (-774.780) -- 0:00:01
      982500 -- [-774.169] (-775.465) (-773.325) (-772.912) * (-775.329) (-774.618) (-773.414) [-778.262] -- 0:00:01
      983000 -- [-773.752] (-772.360) (-772.919) (-772.142) * (-772.208) [-775.985] (-773.307) (-772.590) -- 0:00:01
      983500 -- (-772.524) (-773.199) [-773.336] (-775.846) * [-772.670] (-775.153) (-771.966) (-773.449) -- 0:00:01
      984000 -- (-777.235) (-772.308) [-773.094] (-776.953) * (-774.873) (-773.380) (-772.119) [-772.883] -- 0:00:00
      984500 -- (-773.674) [-772.214] (-773.086) (-778.465) * (-772.383) (-774.385) (-772.134) [-773.381] -- 0:00:00
      985000 -- (-773.925) [-772.146] (-775.303) (-771.861) * (-772.563) (-774.319) [-772.922] (-771.950) -- 0:00:00

      Average standard deviation of split frequencies: 0.008765

      985500 -- (-773.723) (-771.663) (-775.281) [-773.086] * (-775.536) (-774.865) (-773.552) [-772.897] -- 0:00:00
      986000 -- [-772.816] (-775.925) (-774.501) (-774.466) * (-777.481) [-772.491] (-773.373) (-773.900) -- 0:00:00
      986500 -- (-773.050) (-775.561) (-777.321) [-776.222] * (-777.577) (-777.962) [-773.139] (-774.302) -- 0:00:00
      987000 -- (-772.294) [-771.909] (-773.431) (-774.271) * (-773.048) [-773.660] (-773.680) (-774.346) -- 0:00:00
      987500 -- (-773.848) (-774.084) (-775.405) [-773.595] * (-774.388) (-776.321) (-774.304) [-773.474] -- 0:00:00
      988000 -- (-773.616) (-773.959) [-773.443] (-774.966) * (-772.674) [-773.589] (-774.699) (-772.369) -- 0:00:00
      988500 -- (-778.188) [-773.898] (-773.728) (-777.747) * [-773.420] (-773.093) (-772.976) (-772.963) -- 0:00:00
      989000 -- (-778.253) [-774.392] (-773.375) (-775.892) * (-773.605) (-773.993) (-771.962) [-774.062] -- 0:00:00
      989500 -- [-772.316] (-775.788) (-772.115) (-773.288) * (-777.948) [-771.458] (-775.572) (-774.705) -- 0:00:00
      990000 -- (-775.946) [-774.439] (-771.774) (-772.154) * (-775.877) (-774.453) [-773.588] (-774.228) -- 0:00:00

      Average standard deviation of split frequencies: 0.008787

      990500 -- (-773.082) (-773.725) (-773.483) [-771.730] * (-776.229) [-772.701] (-773.555) (-774.303) -- 0:00:00
      991000 -- (-772.970) (-773.970) [-785.127] (-772.032) * (-774.225) [-772.102] (-776.703) (-774.524) -- 0:00:00
      991500 -- [-773.161] (-774.829) (-779.117) (-778.664) * (-774.880) [-774.729] (-780.661) (-775.190) -- 0:00:00
      992000 -- (-773.208) [-774.721] (-774.554) (-775.451) * (-775.182) [-774.106] (-776.094) (-774.433) -- 0:00:00
      992500 -- (-776.876) [-772.358] (-774.673) (-773.088) * (-783.291) (-776.785) (-773.924) [-774.204] -- 0:00:00
      993000 -- [-772.323] (-772.465) (-775.965) (-775.154) * [-778.111] (-779.729) (-773.700) (-776.261) -- 0:00:00
      993500 -- [-772.568] (-774.497) (-775.418) (-776.728) * (-776.136) [-775.194] (-777.019) (-774.616) -- 0:00:00
      994000 -- [-772.754] (-772.738) (-774.924) (-773.491) * (-776.374) (-775.268) (-772.726) [-772.053] -- 0:00:00
      994500 -- (-772.109) [-779.725] (-773.378) (-772.699) * (-778.074) (-774.392) [-772.660] (-772.438) -- 0:00:00
      995000 -- (-772.000) (-774.314) [-773.291] (-774.077) * [-774.513] (-776.021) (-775.233) (-772.077) -- 0:00:00

      Average standard deviation of split frequencies: 0.008740

      995500 -- (-773.272) (-773.612) [-773.491] (-774.819) * [-774.746] (-775.523) (-774.764) (-772.141) -- 0:00:00
      996000 -- (-773.357) [-775.229] (-772.497) (-775.803) * (-774.212) (-775.380) (-773.436) [-771.849] -- 0:00:00
      996500 -- (-771.455) [-773.978] (-771.979) (-773.094) * (-773.015) (-775.182) [-772.858] (-773.367) -- 0:00:00
      997000 -- (-772.290) (-772.842) (-773.547) [-773.442] * [-776.629] (-778.293) (-772.486) (-775.182) -- 0:00:00
      997500 -- [-771.630] (-774.216) (-773.245) (-774.771) * [-773.522] (-781.118) (-773.126) (-772.449) -- 0:00:00
      998000 -- [-772.159] (-775.311) (-771.597) (-772.433) * [-774.295] (-773.681) (-773.295) (-773.368) -- 0:00:00
      998500 -- [-774.686] (-774.708) (-772.904) (-773.703) * (-776.017) (-771.982) [-775.332] (-774.258) -- 0:00:00
      999000 -- (-771.523) [-775.273] (-774.603) (-774.028) * [-774.365] (-772.725) (-772.289) (-777.850) -- 0:00:00
      999500 -- (-772.547) [-771.863] (-777.837) (-772.290) * (-773.576) (-773.007) [-771.472] (-776.972) -- 0:00:00
      1000000 -- (-773.735) (-771.721) (-773.514) [-772.914] * (-773.090) (-776.024) (-773.613) [-774.066] -- 0:00:00

      Average standard deviation of split frequencies: 0.008605

      Analysis completed in 1 mins 1 seconds
      Analysis used 60.01 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -771.26
      Likelihood of best state for "cold" chain of run 2 was -771.26

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            74.7 %     ( 69 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            30.0 %     ( 31 %)     Dirichlet(Pi{all})
            30.8 %     ( 18 %)     Slider(Pi{all})
            78.7 %     ( 48 %)     Multiplier(Alpha{1,2})
            77.7 %     ( 44 %)     Multiplier(Alpha{3})
            23.0 %     ( 24 %)     Slider(Pinvar{all})
            98.6 %     ( 95 %)     ExtSPR(Tau{all},V{all})
            70.1 %     ( 70 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.5 %     ( 95 %)     ParsSPR(Tau{all},V{all})
            28.1 %     ( 21 %)     Multiplier(V{all})
            97.4 %     ( 97 %)     Nodeslider(V{all})
            30.6 %     ( 27 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            75.8 %     ( 73 %)     Dirichlet(Revmat{all})
           100.0 %     (100 %)     Slider(Revmat{all})
            29.8 %     ( 30 %)     Dirichlet(Pi{all})
            30.9 %     ( 33 %)     Slider(Pi{all})
            79.2 %     ( 56 %)     Multiplier(Alpha{1,2})
            78.1 %     ( 56 %)     Multiplier(Alpha{3})
            22.3 %     ( 24 %)     Slider(Pinvar{all})
            98.6 %     ( 99 %)     ExtSPR(Tau{all},V{all})
            70.3 %     ( 70 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.4 %     ( 92 %)     ParsSPR(Tau{all},V{all})
            28.2 %     ( 24 %)     Multiplier(V{all})
            97.5 %     ( 97 %)     Nodeslider(V{all})
            30.7 %     ( 29 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166579            0.82    0.67 
         3 |  166479  166406            0.84 
         4 |  166706  167331  166499         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166968            0.82    0.67 
         3 |  166297  167140            0.84 
         4 |  166531  166151  166913         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -773.04
      |2                                              1         1  |
      |                               2                         2  |
      |          2 221          2                                  |
      |         1                  1       1        *     2   1    |
      |   11            *         1 2      211         1  11       |
      |    2  2      2    21     1   2   2            22*     2    |
      |1    1     1        2 *1    2 1        *1 2       2   1 2   |
      |   2   1  1    2  11              1  2     1         1    12|
      |  2   * *              2* 2    1 1    2 2                 2 |
      | *          1   1 2  *   1       2        1 2       2      1|
      |  1  2   2 2 1  2          2 1     1        1 1      2  1   |
      |                                2  2     * 2  2             |
      |                                1                 1         |
      |                                                            |
      |               1                                      2     |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -774.59
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -773.00          -777.97
        2       -773.00          -776.21
      --------------------------------------
      TOTAL     -773.00          -777.44
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.894177    0.084197    0.383995    1.461167    0.855900   1501.00   1501.00    1.001
      r(A<->C){all}   0.164484    0.020497    0.000028    0.456643    0.126515    196.81    200.43    1.000
      r(A<->G){all}   0.163031    0.019268    0.000001    0.432411    0.126110    110.57    258.19    1.000
      r(A<->T){all}   0.162398    0.018275    0.000017    0.439707    0.132458    321.60    339.96    1.000
      r(C<->G){all}   0.163441    0.020112    0.000001    0.455415    0.121497    108.00    156.71    1.001
      r(C<->T){all}   0.173371    0.021721    0.000095    0.466102    0.134788    143.05    178.57    1.001
      r(G<->T){all}   0.173275    0.021290    0.000048    0.463911    0.135435    202.27    223.61    1.000
      pi(A){all}      0.202737    0.000278    0.171995    0.237212    0.202208   1169.20   1317.46    1.000
      pi(C){all}      0.251685    0.000342    0.214565    0.286784    0.252294   1253.13   1296.60    1.000
      pi(G){all}      0.328915    0.000382    0.290249    0.366322    0.328613   1320.51   1376.22    1.000
      pi(T){all}      0.216663    0.000296    0.182273    0.249708    0.216129   1266.65   1273.42    1.000
      alpha{1,2}      0.417422    0.217565    0.000117    1.382974    0.252048   1222.63   1333.96    1.000
      alpha{3}        0.470663    0.258414    0.000127    1.473455    0.304404    752.31    957.63    1.000
      pinvar{all}     0.997213    0.000010    0.990779    1.000000    0.998228   1235.41   1305.76    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6

   Key to taxon bipartitions (saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ------------
    1 -- .*****
    2 -- .*....
    3 -- ..*...
    4 -- ...*..
    5 -- ....*.
    6 -- .....*
    7 -- ...*.*
    8 -- .*..*.
    9 -- .****.
   10 -- .**...
   11 -- ..*.*.
   12 -- .***.*
   13 -- ..**..
   14 -- ....**
   15 -- .**.**
   16 -- .*.***
   17 -- .*.*..
   18 -- ..****
   19 -- ..*..*
   20 -- ...**.
   21 -- .*...*
   ------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    7   467    0.155563    0.011777    0.147235    0.163891    2
    8   456    0.151899    0.007537    0.146569    0.157229    2
    9   453    0.150899    0.010835    0.143238    0.158561    2
   10   453    0.150899    0.008951    0.144570    0.157229    2
   11   451    0.150233    0.004240    0.147235    0.153231    2
   12   445    0.148235    0.000471    0.147901    0.148568    2
   13   441    0.146902    0.008009    0.141239    0.152565    2
   14   421    0.140240    0.008009    0.134577    0.145903    2
   15   417    0.138907    0.008951    0.132578    0.145237    2
   16   409    0.136243    0.024026    0.119254    0.153231    2
   17   409    0.136243    0.002355    0.134577    0.137908    2
   18   407    0.135576    0.004240    0.132578    0.138574    2
   19   407    0.135576    0.006124    0.131246    0.139907    2
   20   402    0.133911    0.017901    0.121252    0.146569    2
   21   390    0.129913    0.005653    0.125916    0.133911    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.100096    0.010379    0.000004    0.298967    0.069203    1.000    2
   length{all}[2]     0.098621    0.009826    0.000113    0.294627    0.067365    1.000    2
   length{all}[3]     0.098815    0.009422    0.000004    0.291521    0.070183    1.000    2
   length{all}[4]     0.099691    0.009871    0.000022    0.289742    0.070407    1.000    2
   length{all}[5]     0.102778    0.009987    0.000017    0.302766    0.074937    1.000    2
   length{all}[6]     0.097706    0.009896    0.000043    0.293109    0.065809    1.000    2
   length{all}[7]     0.099175    0.009007    0.000142    0.301651    0.069094    0.999    2
   length{all}[8]     0.095372    0.008454    0.000176    0.286415    0.068510    0.998    2
   length{all}[9]     0.102548    0.010275    0.000154    0.283446    0.073405    0.998    2
   length{all}[10]    0.100800    0.009948    0.000020    0.316799    0.068708    1.000    2
   length{all}[11]    0.100488    0.010694    0.000278    0.305565    0.071206    0.998    2
   length{all}[12]    0.093257    0.007853    0.000493    0.257849    0.065765    0.999    2
   length{all}[13]    0.094873    0.009313    0.000682    0.293980    0.063276    1.000    2
   length{all}[14]    0.101118    0.011348    0.000392    0.297670    0.066391    0.998    2
   length{all}[15]    0.096901    0.009740    0.000106    0.291143    0.064346    0.998    2
   length{all}[16]    0.101935    0.011031    0.000077    0.315524    0.065230    1.001    2
   length{all}[17]    0.098799    0.009962    0.000074    0.294868    0.064527    1.003    2
   length{all}[18]    0.100241    0.010010    0.000072    0.288731    0.068571    0.998    2
   length{all}[19]    0.100955    0.011524    0.000072    0.322188    0.065953    1.002    2
   length{all}[20]    0.100914    0.012177    0.000240    0.295866    0.067785    1.004    2
   length{all}[21]    0.096725    0.011156    0.000148    0.309545    0.062171    0.997    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.008605
       Maximum standard deviation of split frequencies = 0.024026
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.004


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------------ C2 (2)
   |                                                                               
   |------------------------------------------------------------------------ C3 (3)
   +                                                                               
   |------------------------------------------------------------------------ C4 (4)
   |                                                                               
   |------------------------------------------------------------------------ C5 (5)
   |                                                                               
   \------------------------------------------------------------------------ C6 (6)
                                                                                   

   Phylogram (based on average branch lengths):

   /------------------------------------------------------------------ C1 (1)
   |                                                                               
   |----------------------------------------------------------------- C2 (2)
   |                                                                               
   |------------------------------------------------------------------- C3 (3)
   +                                                                               
   |-------------------------------------------------------------------- C4 (4)
   |                                                                               
   |------------------------------------------------------------------------ C5 (5)
   |                                                                               
   \--------------------------------------------------------------- C6 (6)
                                                                                   
   |--------| 0.010 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (105 trees sampled):
      50 % credible set contains 45 trees
      90 % credible set contains 90 trees
      95 % credible set contains 97 trees
      99 % credible set contains 104 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.9h, March 2018

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  7  8

seq file is not paml/phylip format.  Trying nexus format.ns = 6  	ls = 564
Reading sequences, sequential format..
Reading seq # 1: C1       
Reading seq # 2: C2       
Reading seq # 3: C3       
Reading seq # 4: C4       
Reading seq # 5: C5       
Reading seq # 6: C6       
Sequences read..
Counting site patterns..  0:00

Compressing,     55 patterns at    188 /    188 sites (100.0%),  0:00

Collecting fpatt[] & pose[],     55 patterns at    188 /    188 sites (100.0%),  0:00
Counting codons..

      120 bytes for distance
    53680 bytes for conP
     4840 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.011314    0.059088    0.070495    0.024184    0.063526    0.100483    0.300000    1.300000

ntime & nrate & np:     6     2     8

Bounds (np=8):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =     8
lnL0 =  -813.390671

Iterating by ming2
Initial: fx=   813.390671
x=  0.01131  0.05909  0.07049  0.02418  0.06353  0.10048  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 453.5811 ++      800.902475  m 0.0001    13 | 1/8
  2 h-m-p  0.0008 0.0431  32.5484 -----------..  | 1/8
  3 h-m-p  0.0000 0.0001 414.2317 ++      789.024156  m 0.0001    44 | 2/8
  4 h-m-p  0.0009 0.0512  27.4990 -----------..  | 2/8
  5 h-m-p  0.0000 0.0002 370.6785 +++     763.032238  m 0.0002    76 | 3/8
  6 h-m-p  0.0026 0.0618  23.3824 ------------..  | 3/8
  7 h-m-p  0.0000 0.0000 322.6030 ++      760.533422  m 0.0000   108 | 4/8
  8 h-m-p  0.0003 0.0794  19.6505 ----------..  | 4/8
  9 h-m-p  0.0000 0.0000 263.2788 ++      757.916548  m 0.0000   138 | 5/8
 10 h-m-p  0.0005 0.1198  13.0671 -----------..  | 5/8
 11 h-m-p  0.0000 0.0002 185.9191 +++     752.262252  m 0.0002   170 | 6/8
 12 h-m-p  0.8822 8.0000   0.0000 ++      752.262252  m 8.0000   181 | 6/8
 13 h-m-p  0.0754 8.0000   0.0006 ++++    752.262252  m 8.0000   196 | 6/8
 14 h-m-p  0.0022 0.1605   2.1320 ------Y   752.262252  0 0.0000   215 | 6/8
 15 h-m-p  0.5980 8.0000   0.0000 Y       752.262252  0 0.5980   226 | 6/8
 16 h-m-p  0.4059 8.0000   0.0000 ---------------..  | 6/8
 17 h-m-p  0.0160 8.0000   0.0000 +++++   752.262252  m 8.0000   268 | 6/8
 18 h-m-p  0.0010 0.4827   1.0216 --------C   752.262252  0 0.0000   289 | 6/8
 19 h-m-p  0.0160 8.0000   0.0002 +++++   752.262252  m 8.0000   303 | 6/8
 20 h-m-p  0.0037 1.8547   1.4767 +++++   752.262196  m 1.8547   319 | 7/8
 21 h-m-p  0.4121 2.0606   1.3178 ++      752.262039  m 2.0606   330 | 8/8
 22 h-m-p  0.0160 8.0000   0.0000 Y       752.262039  0 0.0160   341
Out..
lnL  =  -752.262039
342 lfun, 342 eigenQcodon, 2052 P(t)

Time used:  0:01


Model 1: NearlyNeutral

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.091906    0.109668    0.013616    0.076338    0.100230    0.097348    0.000100    0.707478    0.482612

ntime & nrate & np:     6     2     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 13.024826

np =     9
lnL0 =  -840.518230

Iterating by ming2
Initial: fx=   840.518230
x=  0.09191  0.10967  0.01362  0.07634  0.10023  0.09735  0.00011  0.70748  0.48261

  1 h-m-p  0.0000 0.0000 431.0654 ++      839.704764  m 0.0000    14 | 1/9
  2 h-m-p  0.0000 0.0001 523.3256 ++      825.820223  m 0.0001    26 | 2/9
  3 h-m-p  0.0003 0.0014 111.9846 ++      773.493049  m 0.0014    38 | 3/9
  4 h-m-p  0.0006 0.0029  88.9746 ++      755.156245  m 0.0029    50 | 4/9
  5 h-m-p  0.0000 0.0000 6709.4189 ++      754.591673  m 0.0000    62 | 5/9
  6 h-m-p  0.0001 0.0003  19.0787 ++      754.097354  m 0.0003    74 | 6/9
  7 h-m-p  0.0000 0.0000 603.9165 ++      753.882596  m 0.0000    86 | 7/9
  8 h-m-p  0.0000 0.0004 202.6004 +++     752.262192  m 0.0004    99 | 8/9
  9 h-m-p  1.6000 8.0000   0.0002 ----------------..  | 8/9
 10 h-m-p  0.0160 8.0000   0.0002 +++++   752.262192  m 8.0000   141 | 8/9
 11 h-m-p  0.0048 2.1724   0.3002 ----------C   752.262192  0 0.0000   164 | 8/9
 12 h-m-p  0.0160 8.0000   0.0000 +++++   752.262192  m 8.0000   180 | 8/9
 13 h-m-p  0.0040 1.9802   0.3293 ----------Y   752.262192  0 0.0000   203 | 8/9
 14 h-m-p  0.0160 8.0000   0.0001 +++++   752.262192  m 8.0000   219 | 8/9
 15 h-m-p  0.0043 2.1733   0.3003 --------Y   752.262192  0 0.0000   240 | 8/9
 16 h-m-p  0.0160 8.0000   0.0001 +++++   752.262192  m 8.0000   256 | 8/9
 17 h-m-p  0.0044 2.1977   0.2973 -----------N   752.262192  0 0.0000   280 | 8/9
 18 h-m-p  0.0160 8.0000   0.0000 +++++   752.262192  m 8.0000   296 | 8/9
 19 h-m-p  0.0045 2.2281   0.2933 ------------..  | 8/9
 20 h-m-p  0.0160 8.0000   0.0002 +++++   752.262191  m 8.0000   335 | 8/9
 21 h-m-p  0.0050 2.2230   0.2946 ------------..  | 8/9
 22 h-m-p  0.0160 8.0000   0.0002 +++++   752.262191  m 8.0000   374 | 8/9
 23 h-m-p  0.0049 2.1867   0.3002 ----------Y   752.262191  0 0.0000   397 | 8/9
 24 h-m-p  0.0160 8.0000   0.0000 +++++   752.262191  m 8.0000   413 | 8/9
 25 h-m-p  0.0030 1.5158   0.4331 ---------Y   752.262191  0 0.0000   435 | 8/9
 26 h-m-p  0.0160 8.0000   0.0001 --------C   752.262191  0 0.0000   456 | 8/9
 27 h-m-p  0.0160 8.0000   0.0000 -------------..  | 8/9
 28 h-m-p  0.0160 8.0000   0.0002 +++++   752.262191  m 8.0000   496 | 8/9
 29 h-m-p  0.0050 2.2529   0.2920 ---------Y   752.262191  0 0.0000   518 | 8/9
 30 h-m-p  0.0007 0.3285   2.0031 -----------..  | 8/9
 31 h-m-p  0.0160 8.0000   0.0002 +++++   752.262191  m 8.0000   555 | 8/9
 32 h-m-p  0.0057 1.2872   0.2646 ++++    752.262039  m 1.2872   570 | 9/9
 33 h-m-p  0.0160 8.0000   0.0000 N       752.262039  0 0.0160   583 | 9/9
 34 h-m-p  0.0160 8.0000   0.0000 N       752.262039  0 0.0160   595
Out..
lnL  =  -752.262039
596 lfun, 1788 eigenQcodon, 7152 P(t)

Time used:  0:03


Model 2: PositiveSelection

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
initial w for M2:NSpselection reset.

    0.035589    0.025715    0.037766    0.049226    0.035268    0.074393    0.000100    1.323498    0.353103    0.136327    2.915238

ntime & nrate & np:     6     3    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 11.115948

np =    11
lnL0 =  -794.273309

Iterating by ming2
Initial: fx=   794.273309
x=  0.03559  0.02572  0.03777  0.04923  0.03527  0.07439  0.00011  1.32350  0.35310  0.13633  2.91524

  1 h-m-p  0.0000 0.0000 351.6636 ++      793.638082  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0014 106.3169 ++++    779.800097  m 0.0014    32 | 2/11
  3 h-m-p  0.0004 0.0018  92.0348 ++      769.576458  m 0.0018    46 | 3/11
  4 h-m-p  0.0000 0.0000 12974238.3574 ++      768.537334  m 0.0000    60 | 4/11
  5 h-m-p  0.0000 0.0000 521694.2429 ++      763.928477  m 0.0000    74 | 5/11
  6 h-m-p  0.0000 0.0001 13535.2666 ++      756.953163  m 0.0001    88 | 6/11
  7 h-m-p  0.0000 0.0002 2426.8926 ++      752.995441  m 0.0002   102 | 7/11
  8 h-m-p  0.0001 0.0006 1280.0558 ++      752.262231  m 0.0006   116 | 8/11
  9 h-m-p  1.6000 8.0000   0.0005 ++      752.262231  m 8.0000   130 | 8/11
 10 h-m-p  0.0294 8.0000   0.1255 +++++   752.262226  m 8.0000   150 | 8/11
 11 h-m-p  0.2755 1.5756   3.6428 -------------C   752.262226  0 0.0000   180 | 8/11
 12 h-m-p  0.0160 8.0000   0.0022 +++++   752.262226  m 8.0000   197 | 8/11
 13 h-m-p  0.0046 1.5815   3.8390 ---------C   752.262226  0 0.0000   223 | 8/11
 14 h-m-p  0.0160 8.0000   0.0249 +++++   752.262223  m 8.0000   240 | 8/11
 15 h-m-p  0.0498 1.6173   4.0004 ------------Y   752.262223  0 0.0000   269 | 8/11
 16 h-m-p  0.0160 8.0000   0.0000 +++++   752.262223  m 8.0000   286 | 8/11
 17 h-m-p  0.0160 8.0000   0.0961 +++++   752.262194  m 8.0000   306 | 8/11
 18 h-m-p  0.1978 3.0973   3.8852 -------------Y   752.262194  0 0.0000   336 | 8/11
 19 h-m-p  0.0160 8.0000   0.0000 -Y      752.262194  0 0.0010   351 | 8/11
 20 h-m-p  0.0160 8.0000   0.0000 +++++   752.262194  m 8.0000   371 | 8/11
 21 h-m-p  0.0160 8.0000   0.2580 ---------C   752.262194  0 0.0000   397 | 8/11
 22 h-m-p  0.0160 8.0000   0.0000 ------N   752.262194  0 0.0000   420 | 8/11
 23 h-m-p  0.0160 8.0000   0.0000 --N     752.262194  0 0.0003   439
Out..
lnL  =  -752.262194
440 lfun, 1760 eigenQcodon, 7920 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -752.278159  S =  -752.259875    -0.007009
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  55 patterns   0:05
	did  20 /  55 patterns   0:05
	did  30 /  55 patterns   0:05
	did  40 /  55 patterns   0:05
	did  50 /  55 patterns   0:05
	did  55 /  55 patterns   0:05
Time used:  0:05


Model 7: beta

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.067702    0.052379    0.017927    0.052440    0.102762    0.016379    0.000100    0.321150    1.701906

ntime & nrate & np:     6     1     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 28.584896

np =     9
lnL0 =  -805.503030

Iterating by ming2
Initial: fx=   805.503030
x=  0.06770  0.05238  0.01793  0.05244  0.10276  0.01638  0.00011  0.32115  1.70191

  1 h-m-p  0.0000 0.0000 401.7169 ++      805.181248  m 0.0000    14 | 1/9
  2 h-m-p  0.0000 0.0107  31.9165 +++++   800.431557  m 0.0107    29 | 2/9
  3 h-m-p  0.0001 0.0009 1325.8103 ++      759.424301  m 0.0009    41 | 3/9
  4 h-m-p  0.0001 0.0003 1000.7503 ++      755.971262  m 0.0003    53 | 4/9
  5 h-m-p  0.0000 0.0001  80.8913 --------..  | 4/9
  6 h-m-p  0.0000 0.0000 354.5717 ++      755.778565  m 0.0000    83 | 5/9
  7 h-m-p  0.0001 0.0089   7.2394 ---------..  | 5/9
  8 h-m-p  0.0000 0.0000 307.0326 ++      752.713961  m 0.0000   114 | 6/9
  9 h-m-p  0.0125 0.1355   0.6483 -------------..  | 6/9
 10 h-m-p  0.0000 0.0000 211.6580 ++      752.709854  m 0.0000   152 | 7/9
 11 h-m-p  0.0160 8.0000   4.6746 -------------..  | 7/9
 12 h-m-p  0.0000 0.0000 180.3556 ++      752.262114  m 0.0000   187 | 8/9
 13 h-m-p  1.6000 8.0000   0.0000 ++      752.262114  m 8.0000   199 | 8/9
 14 h-m-p  0.0160 8.0000   0.0000 +++++   752.262114  m 8.0000   215 | 8/9
 15 h-m-p  0.0160 8.0000   0.0048 --------Y   752.262114  0 0.0000   236 | 8/9
 16 h-m-p  0.0160 8.0000   0.0000 -------------..  | 8/9
 17 h-m-p  0.0160 8.0000   0.0002 +++++   752.262113  m 8.0000   276 | 8/9
 18 h-m-p  0.2680 8.0000   0.0058 ----------C   752.262113  0 0.0000   299 | 8/9
 19 h-m-p  0.0160 8.0000   1.5986 +++
QuantileBeta(0.15, 0.00500, 6.61896) = 3.362904e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
+   752.262039  m 8.0000   315
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.724769e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85994) = 1.666588e-161	2000 rounds
 | 8/9
 20 h-m-p  1.6000 8.0000   0.0018 
QuantileBeta(0.15, 0.00500, 12.85710) = 1.666970e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85922) = 1.666684e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85975) = 1.666612e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85989) = 1.666595e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85992) = 1.666590e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
Y   752.262039  0 0.0000   339
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.724769e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.86026) = 1.666545e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85960) = 1.666632e-161	2000 rounds
 | 8/9
 21 h-m-p  1.6000 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds
Y       752.262039  0 1.6000   352
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

Out..
lnL  =  -752.262039
353 lfun, 3883 eigenQcodon, 21180 P(t)

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161	2000 rounds

Time used:  0:10


Model 8: beta&w>1

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
initial w for M8:NSbetaw>1 reset.

    0.102910    0.090509    0.060184    0.096975    0.013093    0.026446    0.000100    0.900000    0.534469    1.409393    2.360546

ntime & nrate & np:     6     2    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 15.749411

np =    11
lnL0 =  -813.468686

Iterating by ming2
Initial: fx=   813.468686
x=  0.10291  0.09051  0.06018  0.09698  0.01309  0.02645  0.00011  0.90000  0.53447  1.40939  2.36055

  1 h-m-p  0.0000 0.0000 336.9115 ++      813.244231  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0001 426.1349 ++      801.901414  m 0.0001    30 | 2/11
  3 h-m-p  0.0001 0.0003 138.9851 ++      792.168623  m 0.0003    44 | 3/11
  4 h-m-p  0.0004 0.0047  88.9822 ++      764.838916  m 0.0047    58 | 4/11
  5 h-m-p  0.0000 0.0000 12774.8764 ++      757.164059  m 0.0000    72 | 5/11
  6 h-m-p  0.0258 0.1290   2.5324 -------------..  | 5/11
  7 h-m-p  0.0000 0.0000 298.2112 ++      754.096860  m 0.0000   111 | 6/11
  8 h-m-p  0.0005 0.0074  15.6014 ++      752.654312  m 0.0074   125 | 7/11
  9 h-m-p  0.0000 0.0000 427.5720 ++      752.262110  m 0.0000   139 | 8/11
 10 h-m-p  1.6000 8.0000   0.0001 ++      752.262109  m 8.0000   153 | 8/11
 11 h-m-p  0.0160 8.0000   0.0646 ------------N   752.262109  0 0.0000   182 | 8/11
 12 h-m-p  0.0144 7.1886   0.0055 +++++   752.262039  m 7.1886   202 | 9/11
 13 h-m-p  1.6000 8.0000   0.0000 Y       752.262039  0 1.6000   219 | 9/11
 14 h-m-p  0.0528 8.0000   0.0003 ---Y    752.262039  0 0.0002   238 | 9/11
 15 h-m-p  0.1936 8.0000   0.0000 -----------N   752.262039  0 0.0000   265
Out..
lnL  =  -752.262039
266 lfun, 3192 eigenQcodon, 17556 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -752.321214  S =  -752.262963    -0.025875
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  55 patterns   0:15
	did  20 /  55 patterns   0:15
	did  30 /  55 patterns   0:15
	did  40 /  55 patterns   0:15
	did  50 /  55 patterns   0:16
	did  55 /  55 patterns   0:16
Time used:  0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=188 

NC_011896_1_WP_010908136_1_1159_MLBR_RS05435          VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NC_002677_1_NP_301812_1_684_ML1115                    VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295   VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945    VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970       VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090       VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
                                                      **************************************************

NC_011896_1_WP_010908136_1_1159_MLBR_RS05435          HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NC_002677_1_NP_301812_1_684_ML1115                    HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295   HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945    HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970       HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090       HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
                                                      **************************************************

NC_011896_1_WP_010908136_1_1159_MLBR_RS05435          SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NC_002677_1_NP_301812_1_684_ML1115                    SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295   SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945    SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970       SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090       SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
                                                      **************************************************

NC_011896_1_WP_010908136_1_1159_MLBR_RS05435          IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NC_002677_1_NP_301812_1_684_ML1115                    IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295   IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945    IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970       IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090       IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
                                                      **************************************



>NC_011896_1_WP_010908136_1_1159_MLBR_RS05435
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>NC_002677_1_NP_301812_1_684_ML1115
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>NC_011896_1_WP_010908136_1_1159_MLBR_RS05435
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>NC_002677_1_NP_301812_1_684_ML1115
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
#NEXUS

[ID: 5526162807]
begin taxa;
	dimensions ntax=6;
	taxlabels
		NC_011896_1_WP_010908136_1_1159_MLBR_RS05435
		NC_002677_1_NP_301812_1_684_ML1115
		NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295
		NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945
		NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970
		NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090
		;
end;
begin trees;
	translate
		1	NC_011896_1_WP_010908136_1_1159_MLBR_RS05435,
		2	NC_002677_1_NP_301812_1_684_ML1115,
		3	NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295,
		4	NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945,
		5	NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970,
		6	NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.06920348,2:0.06736484,3:0.07018251,4:0.07040715,5:0.07493683,6:0.06580895);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.06920348,2:0.06736484,3:0.07018251,4:0.07040715,5:0.07493683,6:0.06580895);
end;
      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -773.00          -777.97
2       -773.00          -776.21
--------------------------------------
TOTAL     -773.00          -777.44
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894177    0.084197    0.383995    1.461167    0.855900   1501.00   1501.00    1.001
r(A<->C){all}   0.164484    0.020497    0.000028    0.456643    0.126515    196.81    200.43    1.000
r(A<->G){all}   0.163031    0.019268    0.000001    0.432411    0.126110    110.57    258.19    1.000
r(A<->T){all}   0.162398    0.018275    0.000017    0.439707    0.132458    321.60    339.96    1.000
r(C<->G){all}   0.163441    0.020112    0.000001    0.455415    0.121497    108.00    156.71    1.001
r(C<->T){all}   0.173371    0.021721    0.000095    0.466102    0.134788    143.05    178.57    1.001
r(G<->T){all}   0.173275    0.021290    0.000048    0.463911    0.135435    202.27    223.61    1.000
pi(A){all}      0.202737    0.000278    0.171995    0.237212    0.202208   1169.20   1317.46    1.000
pi(C){all}      0.251685    0.000342    0.214565    0.286784    0.252294   1253.13   1296.60    1.000
pi(G){all}      0.328915    0.000382    0.290249    0.366322    0.328613   1320.51   1376.22    1.000
pi(T){all}      0.216663    0.000296    0.182273    0.249708    0.216129   1266.65   1273.42    1.000
alpha{1,2}      0.417422    0.217565    0.000117    1.382974    0.252048   1222.63   1333.96    1.000
alpha{3}        0.470663    0.258414    0.000127    1.473455    0.304404    752.31    957.63    1.000
pinvar{all}     0.997213    0.000010    0.990779    1.000000    0.998228   1235.41   1305.76    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018)  /data/6res/ML1115/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio, 
Codon frequency model: F3x4
Site-class models: 
ns =   6  ls = 188

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   2   2   2   2   2   2 | Ser TCT   1   1   1   1   1   1 | Tyr TAT   1   1   1   1   1   1 | Cys TGT   1   1   1   1   1   1
    TTC   6   6   6   6   6   6 |     TCC   1   1   1   1   1   1 |     TAC   0   0   0   0   0   0 |     TGC   5   5   5   5   5   5
Leu TTA   0   0   0   0   0   0 |     TCA   2   2   2   2   2   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   4   4   4   4   4   4 |     TCG  11  11  11  11  11  11 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   0   0   0   0   0   0 | Pro CCT   1   1   1   1   1   1 | His CAT   2   2   2   2   2   2 | Arg CGT   1   1   1   1   1   1
    CTC   1   1   1   1   1   1 |     CCC   1   1   1   1   1   1 |     CAC   2   2   2   2   2   2 |     CGC   3   3   3   3   3   3
    CTA   1   1   1   1   1   1 |     CCA   3   3   3   3   3   3 | Gln CAA   1   1   1   1   1   1 |     CGA   2   2   2   2   2   2
    CTG   5   5   5   5   5   5 |     CCG   5   5   5   5   5   5 |     CAG   6   6   6   6   6   6 |     CGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   4   4   4   4   4   4 | Thr ACT   1   1   1   1   1   1 | Asn AAT   4   4   4   4   4   4 | Ser AGT   1   1   1   1   1   1
    ATC   7   7   7   7   7   7 |     ACC   3   3   3   3   3   3 |     AAC   5   5   5   5   5   5 |     AGC   6   6   6   6   6   6
    ATA   3   3   3   3   3   3 |     ACA   0   0   0   0   0   0 | Lys AAA   1   1   1   1   1   1 | Arg AGA   0   0   0   0   0   0
Met ATG   4   4   4   4   4   4 |     ACG   6   6   6   6   6   6 |     AAG   5   5   5   5   5   5 |     AGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   5   5   5   5   5   5 | Ala GCT   3   3   3   3   3   3 | Asp GAT   4   4   4   4   4   4 | Gly GGT   5   5   5   5   5   5
    GTC   3   3   3   3   3   3 |     GCC   3   3   3   3   3   3 |     GAC   3   3   3   3   3   3 |     GGC   9   9   9   9   9   9
    GTA   0   0   0   0   0   0 |     GCA   1   1   1   1   1   1 | Glu GAA   4   4   4   4   4   4 |     GGA   2   2   2   2   2   2
    GTG   4   4   4   4   4   4 |     GCG   5   5   5   5   5   5 |     GAG   5   5   5   5   5   5 |     GGG   7   7   7   7   7   7
--------------------------------------------------------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435             
position  1:    T:0.19681    C:0.19681    A:0.27128    G:0.33511
position  2:    T:0.26064    C:0.25000    A:0.22872    G:0.26064
position  3:    T:0.19149    C:0.30851    A:0.10638    G:0.39362
Average         T:0.21631    C:0.25177    A:0.20213    G:0.32979

#2: NC_002677_1_NP_301812_1_684_ML1115             
position  1:    T:0.19681    C:0.19681    A:0.27128    G:0.33511
position  2:    T:0.26064    C:0.25000    A:0.22872    G:0.26064
position  3:    T:0.19149    C:0.30851    A:0.10638    G:0.39362
Average         T:0.21631    C:0.25177    A:0.20213    G:0.32979

#3: NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295             
position  1:    T:0.19681    C:0.19681    A:0.27128    G:0.33511
position  2:    T:0.26064    C:0.25000    A:0.22872    G:0.26064
position  3:    T:0.19149    C:0.30851    A:0.10638    G:0.39362
Average         T:0.21631    C:0.25177    A:0.20213    G:0.32979

#4: NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945             
position  1:    T:0.19681    C:0.19681    A:0.27128    G:0.33511
position  2:    T:0.26064    C:0.25000    A:0.22872    G:0.26064
position  3:    T:0.19149    C:0.30851    A:0.10638    G:0.39362
Average         T:0.21631    C:0.25177    A:0.20213    G:0.32979

#5: NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970             
position  1:    T:0.19681    C:0.19681    A:0.27128    G:0.33511
position  2:    T:0.26064    C:0.25000    A:0.22872    G:0.26064
position  3:    T:0.19149    C:0.30851    A:0.10638    G:0.39362
Average         T:0.21631    C:0.25177    A:0.20213    G:0.32979

#6: NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090             
position  1:    T:0.19681    C:0.19681    A:0.27128    G:0.33511
position  2:    T:0.26064    C:0.25000    A:0.22872    G:0.26064
position  3:    T:0.19149    C:0.30851    A:0.10638    G:0.39362
Average         T:0.21631    C:0.25177    A:0.20213    G:0.32979

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      12 | Ser S TCT       6 | Tyr Y TAT       6 | Cys C TGT       6
      TTC      36 |       TCC       6 |       TAC       0 |       TGC      30
Leu L TTA       0 |       TCA      12 | *** * TAA       0 | *** * TGA       0
      TTG      24 |       TCG      66 |       TAG       0 | Trp W TGG      18
------------------------------------------------------------------------------
Leu L CTT       0 | Pro P CCT       6 | His H CAT      12 | Arg R CGT       6
      CTC       6 |       CCC       6 |       CAC      12 |       CGC      18
      CTA       6 |       CCA      18 | Gln Q CAA       6 |       CGA      12
      CTG      30 |       CCG      30 |       CAG      36 |       CGG      18
------------------------------------------------------------------------------
Ile I ATT      24 | Thr T ACT       6 | Asn N AAT      24 | Ser S AGT       6
      ATC      42 |       ACC      18 |       AAC      30 |       AGC      36
      ATA      18 |       ACA       0 | Lys K AAA       6 | Arg R AGA       0
Met M ATG      24 |       ACG      36 |       AAG      30 |       AGG       6
------------------------------------------------------------------------------
Val V GTT      30 | Ala A GCT      18 | Asp D GAT      24 | Gly G GGT      30
      GTC      18 |       GCC      18 |       GAC      18 |       GGC      54
      GTA       0 |       GCA       6 | Glu E GAA      24 |       GGA      12
      GTG      24 |       GCG      30 |       GAG      30 |       GGG      42
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.19681    C:0.19681    A:0.27128    G:0.33511
position  2:    T:0.26064    C:0.25000    A:0.22872    G:0.26064
position  3:    T:0.19149    C:0.30851    A:0.10638    G:0.39362
Average         T:0.21631    C:0.25177    A:0.20213    G:0.32979

Model 0: one-ratio


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  8):   -752.262039      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

omega (dN/dS) =  0.00010

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1      0.000   453.0   111.0  0.0001  0.0000  0.0000   0.0   0.0
   7..2      0.000   453.0   111.0  0.0001  0.0000  0.0000   0.0   0.0
   7..3      0.000   453.0   111.0  0.0001  0.0000  0.0000   0.0   0.0
   7..4      0.000   453.0   111.0  0.0001  0.0000  0.0000   0.0   0.0
   7..5      0.000   453.0   111.0  0.0001  0.0000  0.0000   0.0   0.0
   7..6      0.000   453.0   111.0  0.0001  0.0000  0.0000   0.0   0.0

tree length for dN:       0.0000
tree length for dS:       0.0000


Time used:  0:01


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -752.262039      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=2)

p:   0.99999  0.00001
w:   0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0


Time used:  0:03


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -752.262194      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.933923 0.009258 0.000001 6.161205

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=3)

p:   0.93392  0.00926  0.05682
w:   0.00000  1.00000  6.16120

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    453.0    111.0   0.3593   0.0000   0.0000    0.0    0.0
   7..2       0.000    453.0    111.0   0.3593   0.0000   0.0000    0.0    0.0
   7..3       0.000    453.0    111.0   0.3593   0.0000   0.0000    0.0    0.0
   7..4       0.000    453.0    111.0   0.3593   0.0000   0.0000    0.0    0.0
   7..5       0.000    453.0    111.0   0.3593   0.0000   0.0000    0.0    0.0
   7..6       0.000    453.0    111.0   0.3593   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435)

            Pr(w>1)     post mean +- SE for w



Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
w2:   0.101  0.101  0.101  0.100  0.100  0.100  0.100  0.099  0.099  0.099

Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)

 0.010
 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010

sum of density on p0-p1 =   1.000000

Time used:  0:05


Model 7: beta (10 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -752.262039      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 12.859930

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M7 (beta):
 p =   0.00500  q =  12.85993


MLEs of dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0


Time used:  0:10


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -752.262039      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.597881 2.603304

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M8 (beta&w>1):
  p0 =   0.99999  p =   0.00500 q =   1.59788
 (p1 =   0.00001) w =   2.60330


MLEs of dN/dS (w) for site classes (K=11)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.00001
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00002  2.60330
(note that p[10] is zero)


dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    453.0    111.0   0.0000   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435)

            Pr(w>1)     post mean +- SE for w




The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.096  0.097  0.097  0.098  0.099  0.100  0.101  0.102  0.104  0.105
p :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
q :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
ws:   0.104  0.103  0.102  0.101  0.100  0.100  0.099  0.098  0.097  0.096

Time used:  0:16
Model 1: NearlyNeutral	-752.262039
Model 2: PositiveSelection	-752.262194
Model 0: one-ratio	-752.262039
Model 7: beta	-752.262039
Model 8: beta&w>1	-752.262039


Model 0 vs 1	0.0

Model 2 vs 1	3.1000000012681994E-4

Model 8 vs 7	0.0