--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:48:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1115/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -773.00 -777.97
2 -773.00 -776.21
--------------------------------------
TOTAL -773.00 -777.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894177 0.084197 0.383995 1.461167 0.855900 1501.00 1501.00 1.001
r(A<->C){all} 0.164484 0.020497 0.000028 0.456643 0.126515 196.81 200.43 1.000
r(A<->G){all} 0.163031 0.019268 0.000001 0.432411 0.126110 110.57 258.19 1.000
r(A<->T){all} 0.162398 0.018275 0.000017 0.439707 0.132458 321.60 339.96 1.000
r(C<->G){all} 0.163441 0.020112 0.000001 0.455415 0.121497 108.00 156.71 1.001
r(C<->T){all} 0.173371 0.021721 0.000095 0.466102 0.134788 143.05 178.57 1.001
r(G<->T){all} 0.173275 0.021290 0.000048 0.463911 0.135435 202.27 223.61 1.000
pi(A){all} 0.202737 0.000278 0.171995 0.237212 0.202208 1169.20 1317.46 1.000
pi(C){all} 0.251685 0.000342 0.214565 0.286784 0.252294 1253.13 1296.60 1.000
pi(G){all} 0.328915 0.000382 0.290249 0.366322 0.328613 1320.51 1376.22 1.000
pi(T){all} 0.216663 0.000296 0.182273 0.249708 0.216129 1266.65 1273.42 1.000
alpha{1,2} 0.417422 0.217565 0.000117 1.382974 0.252048 1222.63 1333.96 1.000
alpha{3} 0.470663 0.258414 0.000127 1.473455 0.304404 752.31 957.63 1.000
pinvar{all} 0.997213 0.000010 0.990779 1.000000 0.998228 1235.41 1305.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -752.262039
Model 2: PositiveSelection -752.262194
Model 0: one-ratio -752.262039
Model 7: beta -752.262039
Model 8: beta&w>1 -752.262039
Model 0 vs 1 0.0
Model 2 vs 1 3.1000000012681994E-4
Model 8 vs 7 0.0
>C1
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C2
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C3
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C4
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C5
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C6
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=188
C1 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C2 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C3 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C4 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C5 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C6 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
**************************************************
C1 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C2 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C3 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C4 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C5 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C6 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
**************************************************
C1 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C2 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C3 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C4 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C5 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C6 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
**************************************************
C1 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C2 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C3 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C4 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C5 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C6 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5640]--->[5640]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.477 Mb, Max= 30.729 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C2 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C3 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C4 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C5 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
C6 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
**************************************************
C1 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C2 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C3 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C4 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C5 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
C6 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
**************************************************
C1 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C2 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C3 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C4 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C5 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
C6 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
**************************************************
C1 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C2 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C3 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C4 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C5 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
C6 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C2 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C3 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C4 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C5 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
C6 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
**************************************************
C1 GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C2 GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C3 GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C4 GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C5 GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
C6 GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
**************************************************
C1 ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C2 ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C3 ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C4 ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C5 ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
C6 ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
**************************************************
C1 CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C2 CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C3 CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C4 CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C5 CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
C6 CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
**************************************************
C1 GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C2 GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C3 GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C4 GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C5 GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
C6 GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
**************************************************
C1 GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C2 GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C3 GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C4 GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C5 GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
C6 GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
**************************************************
C1 TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C2 TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C3 TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C4 TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C5 TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
C6 TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
**************************************************
C1 GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C2 GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C3 GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C4 GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C5 GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
C6 GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
**************************************************
C1 TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C2 TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C3 TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C4 TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C5 TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
C6 TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
**************************************************
C1 ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C2 ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C3 ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C4 ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C5 ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
C6 ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
**************************************************
C1 GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C2 GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C3 GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C4 GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C5 GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
C6 GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
**************************************************
C1 TTGCTAACTCGAAA
C2 TTGCTAACTCGAAA
C3 TTGCTAACTCGAAA
C4 TTGCTAACTCGAAA
C5 TTGCTAACTCGAAA
C6 TTGCTAACTCGAAA
**************
>C1
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C2
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C3
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C4
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C5
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C6
GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA
GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA
ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT
CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC
GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG
GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT
TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT
GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA
TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA
ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA
GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA
TTGCTAACTCGAAA
>C1
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C2
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C3
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C4
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C5
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
>C6
VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 564 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855618
Setting output file names to "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 833175045
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5526162807
Seed = 997195948
Swapseed = 1579855618
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1262.258963 -- -24.965149
Chain 2 -- -1262.258963 -- -24.965149
Chain 3 -- -1262.259036 -- -24.965149
Chain 4 -- -1262.258963 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1262.258963 -- -24.965149
Chain 2 -- -1262.259036 -- -24.965149
Chain 3 -- -1262.259036 -- -24.965149
Chain 4 -- -1262.258963 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1262.259] (-1262.259) (-1262.259) (-1262.259) * [-1262.259] (-1262.259) (-1262.259) (-1262.259)
500 -- [-777.540] (-789.212) (-780.517) (-786.977) * (-786.537) (-782.173) [-787.334] (-789.759) -- 0:00:00
1000 -- (-787.763) [-789.686] (-786.284) (-786.484) * [-786.277] (-779.201) (-782.389) (-793.156) -- 0:00:00
1500 -- (-784.267) [-777.978] (-791.055) (-787.108) * (-783.752) (-780.269) (-784.180) [-783.938] -- 0:00:00
2000 -- (-785.611) [-778.489] (-779.716) (-782.435) * [-782.135] (-778.282) (-783.261) (-786.531) -- 0:00:00
2500 -- (-779.501) (-786.815) (-779.088) [-782.609] * (-788.832) (-778.056) (-778.779) [-777.008] -- 0:00:00
3000 -- (-778.930) (-784.909) (-787.832) [-784.388] * (-779.504) (-781.623) (-778.875) [-783.032] -- 0:00:00
3500 -- (-784.642) (-787.059) [-782.569] (-784.888) * [-780.794] (-781.324) (-780.295) (-783.395) -- 0:00:00
4000 -- (-780.742) (-790.516) [-776.230] (-782.193) * (-780.323) (-781.694) (-790.007) [-780.565] -- 0:00:00
4500 -- (-787.896) (-783.469) (-783.717) [-779.741] * [-777.089] (-784.113) (-789.546) (-784.918) -- 0:00:00
5000 -- (-782.524) [-782.496] (-784.679) (-783.487) * (-780.486) (-780.343) (-777.147) [-777.480] -- 0:00:00
Average standard deviation of split frequencies: 0.068319
5500 -- [-777.801] (-788.892) (-778.688) (-780.819) * (-780.404) (-780.208) (-788.885) [-777.872] -- 0:00:00
6000 -- (-778.372) (-786.339) (-784.005) [-779.742] * (-786.042) [-778.301] (-781.537) (-789.131) -- 0:00:00
6500 -- (-781.050) [-778.980] (-785.172) (-781.462) * [-784.858] (-781.997) (-782.897) (-785.127) -- 0:00:00
7000 -- (-779.918) (-787.386) (-779.940) [-781.063] * (-782.949) (-785.764) (-786.083) [-778.480] -- 0:00:00
7500 -- (-779.979) (-787.888) (-785.475) [-781.126] * (-795.074) [-781.900] (-783.716) (-782.853) -- 0:00:00
8000 -- (-786.302) (-778.970) (-785.463) [-779.476] * (-796.808) [-783.964] (-780.255) (-786.154) -- 0:00:00
8500 -- (-784.598) (-788.877) [-778.928] (-781.377) * (-777.194) [-781.904] (-785.165) (-782.782) -- 0:00:00
9000 -- (-787.917) (-783.835) (-783.982) [-782.617] * [-773.593] (-788.551) (-783.352) (-782.035) -- 0:00:00
9500 -- (-784.320) (-786.228) [-782.403] (-779.184) * (-774.633) [-784.669] (-784.818) (-780.587) -- 0:00:00
10000 -- (-788.404) (-781.391) [-789.313] (-789.848) * (-777.682) (-784.589) [-778.311] (-789.351) -- 0:00:00
Average standard deviation of split frequencies: 0.071202
10500 -- [-777.465] (-785.640) (-784.299) (-783.871) * [-776.315] (-786.292) (-777.866) (-782.022) -- 0:00:00
11000 -- [-789.296] (-776.967) (-779.076) (-782.149) * (-774.528) (-783.603) [-798.546] (-795.668) -- 0:00:00
11500 -- (-779.558) (-781.493) [-781.366] (-777.621) * (-771.858) [-780.532] (-777.511) (-778.574) -- 0:00:00
12000 -- (-788.549) [-782.290] (-787.605) (-784.648) * [-772.302] (-783.663) (-775.313) (-786.709) -- 0:01:22
12500 -- (-794.020) (-779.054) [-779.945] (-788.059) * [-772.811] (-780.182) (-774.117) (-783.760) -- 0:01:19
13000 -- (-788.778) (-787.489) [-781.721] (-786.148) * (-772.790) [-777.038] (-775.734) (-783.647) -- 0:01:15
13500 -- (-792.637) (-784.372) (-777.989) [-786.463] * [-772.210] (-776.907) (-778.247) (-783.068) -- 0:01:13
14000 -- (-779.799) (-783.077) [-784.056] (-784.271) * (-772.344) (-787.158) [-775.358] (-788.820) -- 0:01:10
14500 -- (-783.378) (-782.424) [-779.497] (-785.033) * (-776.080) [-778.654] (-774.247) (-782.018) -- 0:01:07
15000 -- (-786.473) [-783.739] (-783.123) (-785.424) * (-779.658) [-780.529] (-773.630) (-785.603) -- 0:01:05
Average standard deviation of split frequencies: 0.048527
15500 -- (-780.787) [-779.595] (-782.920) (-788.583) * (-776.146) [-778.101] (-773.863) (-786.155) -- 0:01:03
16000 -- (-788.285) (-784.556) (-780.789) [-779.537] * [-775.271] (-780.941) (-774.530) (-783.906) -- 0:01:01
16500 -- (-783.152) (-785.440) (-781.432) [-782.619] * [-772.280] (-785.034) (-773.502) (-784.209) -- 0:00:59
17000 -- (-781.114) (-791.341) (-782.900) [-779.289] * (-772.207) (-778.889) [-774.033] (-782.010) -- 0:00:57
17500 -- (-791.710) (-779.617) (-792.305) [-783.232] * (-774.706) (-782.914) (-774.441) [-778.089] -- 0:00:56
18000 -- (-780.028) (-782.884) [-779.867] (-788.998) * (-773.223) (-781.116) (-775.129) [-780.557] -- 0:00:54
18500 -- (-780.506) [-787.483] (-792.945) (-782.614) * (-774.423) (-785.455) (-772.571) [-776.042] -- 0:00:53
19000 -- [-778.294] (-790.945) (-778.427) (-781.542) * (-772.562) (-779.128) (-773.821) [-782.054] -- 0:00:51
19500 -- (-781.381) (-780.491) (-777.987) [-785.345] * [-772.179] (-777.451) (-772.620) (-790.186) -- 0:00:50
20000 -- [-785.329] (-783.957) (-784.557) (-785.268) * [-772.245] (-777.496) (-773.399) (-783.507) -- 0:00:49
Average standard deviation of split frequencies: 0.040253
20500 -- [-782.628] (-776.678) (-781.187) (-783.885) * (-775.421) (-790.321) (-773.290) [-782.185] -- 0:00:47
21000 -- (-779.523) [-772.444] (-789.891) (-785.807) * (-773.703) (-781.659) (-776.371) [-777.753] -- 0:00:46
21500 -- (-781.896) (-775.318) [-782.618] (-780.398) * (-773.234) (-786.176) (-777.113) [-787.897] -- 0:00:45
22000 -- (-778.266) (-776.661) [-786.338] (-788.610) * [-772.853] (-783.559) (-777.546) (-783.649) -- 0:00:44
22500 -- [-782.532] (-774.432) (-781.325) (-788.401) * [-773.470] (-778.756) (-775.880) (-799.665) -- 0:00:43
23000 -- (-785.283) [-773.706] (-779.451) (-787.354) * (-775.696) [-779.521] (-773.307) (-781.926) -- 0:00:42
23500 -- (-792.180) (-772.982) [-779.415] (-789.829) * [-774.418] (-777.634) (-773.087) (-787.607) -- 0:00:41
24000 -- (-808.575) [-775.102] (-786.044) (-785.858) * (-772.805) (-786.097) (-773.372) [-782.176] -- 0:00:40
24500 -- (-776.296) [-774.773] (-786.754) (-781.828) * (-776.655) (-776.026) (-775.151) [-776.834] -- 0:00:39
25000 -- [-772.993] (-772.159) (-781.085) (-783.450) * [-773.179] (-783.476) (-772.679) (-786.986) -- 0:00:39
Average standard deviation of split frequencies: 0.037989
25500 -- (-771.674) (-772.794) (-786.600) [-780.683] * [-771.885] (-789.237) (-775.520) (-781.036) -- 0:00:38
26000 -- (-776.721) [-773.196] (-787.237) (-779.206) * [-771.610] (-785.674) (-776.945) (-783.992) -- 0:01:14
26500 -- (-776.524) (-773.362) [-779.556] (-779.898) * (-771.542) [-783.791] (-774.489) (-780.277) -- 0:01:13
27000 -- [-777.661] (-774.173) (-787.646) (-782.977) * (-772.198) (-786.143) (-773.854) [-778.521] -- 0:01:12
27500 -- (-774.144) [-774.765] (-781.184) (-785.258) * [-772.329] (-778.666) (-775.422) (-781.395) -- 0:01:10
28000 -- [-774.021] (-775.957) (-783.681) (-777.608) * (-773.383) (-779.546) [-773.030] (-782.426) -- 0:01:09
28500 -- (-775.690) (-776.224) (-792.748) [-776.933] * [-772.453] (-787.235) (-772.581) (-783.367) -- 0:01:08
29000 -- (-773.643) (-776.380) [-782.163] (-778.035) * (-776.175) (-782.396) [-773.619] (-781.618) -- 0:01:06
29500 -- (-772.637) [-778.997] (-783.822) (-783.609) * (-773.824) (-781.887) [-772.701] (-785.608) -- 0:01:05
30000 -- (-775.827) (-775.051) [-785.252] (-784.169) * (-774.750) (-799.415) (-775.504) [-781.276] -- 0:01:04
Average standard deviation of split frequencies: 0.038025
30500 -- [-773.049] (-773.077) (-781.193) (-781.186) * (-772.821) (-780.873) [-771.856] (-782.204) -- 0:01:03
31000 -- (-772.558) (-776.580) [-784.555] (-778.791) * [-774.238] (-791.740) (-775.944) (-787.410) -- 0:01:02
31500 -- (-771.576) [-774.416] (-783.146) (-785.333) * (-773.783) (-782.827) [-772.708] (-790.817) -- 0:01:01
32000 -- (-773.446) (-771.743) [-784.460] (-782.245) * (-773.575) (-781.757) (-774.302) [-777.451] -- 0:01:00
32500 -- (-773.240) (-772.159) [-779.933] (-778.496) * (-774.361) [-783.628] (-772.527) (-787.706) -- 0:00:59
33000 -- (-772.663) (-774.760) [-780.837] (-782.744) * [-773.565] (-780.728) (-774.106) (-796.658) -- 0:00:58
33500 -- (-772.291) (-772.781) [-776.828] (-778.736) * (-775.565) [-779.860] (-773.468) (-791.378) -- 0:00:57
34000 -- (-772.979) (-772.972) (-778.777) [-781.618] * (-776.285) [-781.945] (-773.367) (-780.931) -- 0:00:56
34500 -- (-773.882) (-772.058) [-779.375] (-779.781) * (-772.046) (-784.816) (-773.609) [-774.356] -- 0:00:55
35000 -- (-773.868) (-775.963) [-784.767] (-781.544) * [-772.992] (-781.192) (-773.626) (-776.027) -- 0:00:55
Average standard deviation of split frequencies: 0.041595
35500 -- (-772.392) [-773.826] (-779.747) (-792.750) * [-772.147] (-776.532) (-775.363) (-774.823) -- 0:00:54
36000 -- (-774.430) [-774.870] (-780.635) (-780.010) * [-771.853] (-777.648) (-774.181) (-777.370) -- 0:00:53
36500 -- (-772.969) (-775.775) [-781.474] (-775.162) * (-773.004) (-774.917) [-775.530] (-773.707) -- 0:00:52
37000 -- (-772.799) (-773.223) [-788.788] (-774.068) * (-772.942) (-772.416) (-776.174) [-772.726] -- 0:00:52
37500 -- (-775.515) (-773.050) (-806.363) [-771.994] * (-778.465) [-772.857] (-774.629) (-772.650) -- 0:00:51
38000 -- (-773.364) [-772.349] (-788.154) (-774.378) * (-774.672) (-775.937) (-777.866) [-773.719] -- 0:00:50
38500 -- (-772.148) [-772.499] (-789.308) (-775.914) * [-772.256] (-775.645) (-775.447) (-771.489) -- 0:00:49
39000 -- (-773.356) [-775.044] (-784.812) (-774.979) * (-772.635) (-774.574) (-773.838) [-773.255] -- 0:00:49
39500 -- (-773.387) (-772.400) (-775.991) [-772.430] * (-773.066) (-781.826) (-771.984) [-773.018] -- 0:00:48
40000 -- (-771.628) (-775.256) (-776.006) [-774.047] * (-775.129) (-779.661) (-771.826) [-774.087] -- 0:00:48
Average standard deviation of split frequencies: 0.047012
40500 -- [-772.011] (-777.235) (-772.525) (-774.760) * (-772.753) (-776.427) [-774.178] (-773.406) -- 0:01:11
41000 -- (-773.449) (-776.700) [-773.619] (-774.674) * (-772.827) [-774.117] (-779.227) (-773.740) -- 0:01:10
41500 -- [-774.275] (-777.163) (-773.431) (-771.992) * [-772.485] (-777.075) (-778.699) (-775.733) -- 0:01:09
42000 -- (-773.076) (-773.878) [-776.540] (-772.692) * (-773.499) (-779.060) [-776.552] (-773.529) -- 0:01:08
42500 -- (-773.853) [-775.358] (-772.633) (-775.162) * (-773.616) (-782.691) [-772.611] (-772.089) -- 0:01:07
43000 -- (-773.115) (-773.596) (-774.276) [-771.941] * (-776.071) (-774.787) [-771.735] (-779.530) -- 0:01:06
43500 -- (-772.615) [-776.276] (-774.847) (-774.456) * (-773.158) (-772.868) [-776.506] (-773.769) -- 0:01:05
44000 -- (-774.149) (-777.739) (-772.311) [-773.991] * (-774.511) (-772.295) (-777.359) [-773.500] -- 0:01:05
44500 -- (-773.277) [-774.411] (-772.448) (-772.451) * (-775.594) [-772.027] (-773.176) (-778.735) -- 0:01:04
45000 -- (-773.654) (-775.109) (-772.992) [-776.306] * (-777.251) (-771.919) (-774.791) [-772.812] -- 0:01:03
Average standard deviation of split frequencies: 0.040479
45500 -- [-775.879] (-773.138) (-773.976) (-775.019) * (-777.063) (-771.711) [-772.326] (-773.619) -- 0:01:02
46000 -- [-773.423] (-772.410) (-772.134) (-773.913) * (-773.158) [-771.502] (-776.266) (-775.706) -- 0:01:02
46500 -- [-773.047] (-773.271) (-774.101) (-773.415) * (-772.336) (-777.418) [-774.326] (-773.904) -- 0:01:01
47000 -- (-778.015) (-772.031) (-772.816) [-771.944] * [-772.885] (-779.997) (-774.646) (-774.529) -- 0:01:00
47500 -- [-775.167] (-775.304) (-780.932) (-773.559) * (-772.605) (-772.159) [-773.465] (-775.817) -- 0:01:00
48000 -- (-774.674) (-771.898) (-774.244) [-772.624] * (-772.439) (-775.846) (-775.374) [-773.740] -- 0:00:59
48500 -- (-775.483) (-776.904) [-775.958] (-773.658) * (-772.416) (-777.396) [-777.435] (-771.797) -- 0:00:58
49000 -- [-774.307] (-776.755) (-774.265) (-775.617) * (-772.502) (-778.499) [-772.082] (-772.181) -- 0:00:58
49500 -- (-773.934) (-777.629) [-774.260] (-772.627) * (-773.336) (-775.238) (-771.521) [-772.775] -- 0:00:57
50000 -- [-774.662] (-776.350) (-774.783) (-773.597) * (-781.786) [-772.890] (-772.725) (-773.644) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
50500 -- (-775.359) (-773.523) (-774.184) [-773.184] * (-774.859) (-774.588) (-775.266) [-773.409] -- 0:00:56
51000 -- (-774.513) (-772.820) [-775.768] (-773.200) * (-773.062) (-773.432) (-774.182) [-775.461] -- 0:00:55
51500 -- (-771.706) (-772.550) (-773.544) [-773.897] * (-771.950) [-773.436] (-774.738) (-777.189) -- 0:00:55
52000 -- (-774.289) (-773.627) [-773.380] (-775.511) * (-772.087) (-771.910) (-775.739) [-776.000] -- 0:00:54
52500 -- (-772.273) (-772.439) [-772.949] (-774.156) * (-776.666) [-774.178] (-776.436) (-779.586) -- 0:00:54
53000 -- (-774.526) (-772.719) (-772.964) [-773.282] * [-774.769] (-775.044) (-776.716) (-776.024) -- 0:00:53
53500 -- (-773.624) (-773.120) (-773.737) [-774.288] * [-775.090] (-773.169) (-772.340) (-774.094) -- 0:00:53
54000 -- (-772.114) (-774.241) [-774.880] (-775.450) * (-775.457) (-773.792) (-773.303) [-773.501] -- 0:00:52
54500 -- (-772.987) [-773.816] (-779.012) (-773.806) * (-775.531) [-772.753] (-772.647) (-772.951) -- 0:00:52
55000 -- [-771.820] (-774.220) (-773.272) (-773.201) * (-774.336) (-773.101) [-773.049] (-772.302) -- 0:00:51
Average standard deviation of split frequencies: 0.034167
55500 -- [-772.799] (-773.810) (-772.737) (-774.811) * (-774.326) [-772.874] (-772.842) (-776.153) -- 0:00:51
56000 -- (-774.201) (-778.200) [-774.815] (-775.615) * [-771.812] (-774.619) (-775.293) (-780.594) -- 0:01:07
56500 -- (-772.894) (-773.237) (-771.857) [-772.397] * [-774.597] (-778.752) (-777.233) (-775.162) -- 0:01:06
57000 -- [-774.014] (-772.398) (-772.545) (-774.505) * [-772.121] (-773.489) (-773.120) (-775.801) -- 0:01:06
57500 -- (-774.263) (-772.675) (-772.667) [-774.401] * (-772.205) (-773.051) [-772.029] (-774.993) -- 0:01:05
58000 -- [-772.166] (-776.632) (-773.555) (-771.396) * (-771.685) (-773.609) (-775.034) [-772.338] -- 0:01:04
58500 -- (-773.489) (-774.975) (-773.815) [-771.609] * (-771.899) [-773.480] (-777.698) (-773.614) -- 0:01:04
59000 -- [-772.906] (-774.336) (-776.059) (-773.456) * (-771.719) (-777.836) (-774.878) [-773.385] -- 0:01:03
59500 -- (-772.685) [-772.685] (-774.700) (-772.979) * (-772.178) (-772.895) [-774.430] (-774.197) -- 0:01:03
60000 -- (-773.220) (-774.413) (-776.879) [-775.485] * [-772.605] (-772.187) (-774.450) (-774.908) -- 0:01:02
Average standard deviation of split frequencies: 0.037557
60500 -- (-772.543) (-774.811) [-775.295] (-772.605) * (-772.528) [-772.645] (-773.531) (-775.439) -- 0:01:02
61000 -- (-774.449) (-773.365) [-773.244] (-772.985) * (-773.598) (-772.542) [-772.606] (-772.794) -- 0:01:01
61500 -- (-775.445) [-773.718] (-777.802) (-774.249) * (-772.209) (-772.454) [-777.561] (-775.060) -- 0:01:01
62000 -- [-773.743] (-772.945) (-778.545) (-774.727) * (-773.251) [-775.768] (-778.422) (-775.961) -- 0:01:00
62500 -- (-771.999) (-778.108) (-777.294) [-774.675] * [-772.661] (-775.240) (-772.502) (-774.176) -- 0:01:00
63000 -- (-773.447) (-773.426) [-776.562] (-775.889) * (-772.626) [-774.200] (-774.188) (-772.405) -- 0:00:59
63500 -- (-777.725) [-774.981] (-778.909) (-772.629) * (-771.562) [-775.943] (-773.289) (-774.646) -- 0:00:58
64000 -- (-774.672) (-774.908) (-774.826) [-773.344] * (-773.608) [-772.536] (-772.681) (-771.844) -- 0:00:58
64500 -- (-773.319) (-773.201) (-772.191) [-773.269] * (-773.014) (-776.227) [-774.381] (-774.639) -- 0:00:58
65000 -- (-774.063) [-776.857] (-775.261) (-772.961) * [-775.419] (-772.733) (-773.148) (-773.723) -- 0:00:57
Average standard deviation of split frequencies: 0.034209
65500 -- (-775.341) (-776.188) (-773.497) [-774.023] * [-773.217] (-773.373) (-773.699) (-774.287) -- 0:00:57
66000 -- (-775.973) (-775.495) [-773.379] (-774.840) * (-773.435) (-773.893) [-773.450] (-776.621) -- 0:00:56
66500 -- (-776.422) (-775.120) (-775.160) [-773.410] * (-773.738) (-772.269) [-775.524] (-772.411) -- 0:00:56
67000 -- (-772.465) (-773.970) [-773.019] (-774.228) * [-772.991] (-772.186) (-778.945) (-772.702) -- 0:00:55
67500 -- (-774.617) (-772.470) [-773.557] (-775.724) * [-772.569] (-774.463) (-777.332) (-773.884) -- 0:00:55
68000 -- (-772.956) (-772.635) [-772.848] (-775.883) * (-773.878) (-772.148) (-777.266) [-772.013] -- 0:00:54
68500 -- (-775.280) [-772.430] (-774.466) (-775.100) * (-773.387) (-773.386) (-782.391) [-779.891] -- 0:00:54
69000 -- (-773.767) (-771.913) (-772.328) [-772.374] * (-774.034) (-775.282) (-775.955) [-777.710] -- 0:00:53
69500 -- (-774.393) [-772.554] (-773.092) (-772.168) * (-779.661) [-774.778] (-773.964) (-773.623) -- 0:00:53
70000 -- [-773.763] (-772.122) (-774.175) (-771.822) * (-772.700) [-772.900] (-776.391) (-773.153) -- 0:00:53
Average standard deviation of split frequencies: 0.028439
70500 -- (-771.890) [-772.859] (-772.688) (-771.960) * (-773.760) [-775.327] (-775.532) (-771.851) -- 0:00:52
71000 -- [-772.750] (-773.241) (-773.722) (-778.177) * (-773.811) (-775.368) [-773.831] (-773.458) -- 0:01:05
71500 -- (-773.154) (-775.115) (-774.881) [-772.002] * (-778.189) (-773.713) (-771.884) [-773.049] -- 0:01:04
72000 -- (-772.936) (-777.633) (-772.459) [-771.568] * (-772.920) [-772.542] (-773.396) (-772.104) -- 0:01:04
72500 -- (-773.680) (-773.008) [-773.187] (-775.776) * [-774.727] (-777.214) (-777.258) (-776.899) -- 0:01:03
73000 -- (-778.675) [-773.131] (-774.018) (-774.461) * (-772.291) [-771.901] (-773.800) (-773.526) -- 0:01:03
73500 -- (-776.035) [-776.722] (-777.497) (-773.238) * (-774.191) (-772.346) [-774.874] (-772.773) -- 0:01:03
74000 -- (-773.910) [-772.991] (-776.198) (-774.331) * (-773.188) (-772.883) (-775.200) [-771.853] -- 0:01:02
74500 -- (-773.701) (-772.021) [-777.487] (-774.067) * (-772.911) [-772.194] (-772.992) (-776.123) -- 0:01:02
75000 -- [-774.718] (-773.249) (-785.263) (-774.297) * (-773.825) (-772.244) [-772.422] (-775.919) -- 0:01:01
Average standard deviation of split frequencies: 0.030361
75500 -- (-772.045) [-772.900] (-774.627) (-774.888) * [-772.095] (-773.129) (-774.005) (-773.596) -- 0:01:01
76000 -- [-772.754] (-774.559) (-772.988) (-774.940) * [-773.323] (-772.946) (-775.434) (-772.982) -- 0:01:00
76500 -- (-772.901) (-775.688) (-771.760) [-776.073] * [-774.132] (-775.584) (-773.373) (-772.930) -- 0:01:00
77000 -- (-775.612) (-774.336) [-772.287] (-773.468) * (-775.861) (-773.407) (-772.408) [-772.850] -- 0:00:59
77500 -- (-776.034) (-775.721) [-775.807] (-774.701) * [-773.671] (-777.090) (-772.963) (-773.728) -- 0:00:59
78000 -- (-772.758) (-775.492) (-775.342) [-773.692] * (-774.472) [-775.426] (-775.518) (-773.057) -- 0:00:59
78500 -- (-771.958) (-771.388) [-772.470] (-773.507) * [-773.587] (-772.953) (-775.796) (-772.529) -- 0:00:58
79000 -- (-773.922) (-773.888) [-772.425] (-773.865) * [-774.824] (-774.009) (-776.253) (-775.736) -- 0:00:58
79500 -- (-773.446) (-777.928) [-775.755] (-773.798) * [-774.757] (-773.111) (-776.459) (-777.860) -- 0:00:57
80000 -- (-772.558) (-773.032) (-776.184) [-776.544] * (-773.110) [-774.027] (-776.378) (-773.863) -- 0:00:57
Average standard deviation of split frequencies: 0.029219
80500 -- (-772.421) [-773.172] (-774.812) (-777.550) * (-773.303) (-773.860) [-773.917] (-774.168) -- 0:00:57
81000 -- [-773.536] (-774.785) (-778.262) (-773.323) * (-772.814) [-773.666] (-772.278) (-772.492) -- 0:00:56
81500 -- (-773.437) (-773.249) (-780.046) [-775.612] * [-772.798] (-774.561) (-772.909) (-773.323) -- 0:00:56
82000 -- [-773.666] (-773.583) (-774.160) (-772.444) * (-775.398) (-776.411) [-772.219] (-772.873) -- 0:00:55
82500 -- (-774.648) [-772.978] (-775.305) (-772.278) * (-772.284) [-774.156] (-774.880) (-773.345) -- 0:00:55
83000 -- [-773.301] (-772.365) (-775.699) (-772.961) * [-774.478] (-772.860) (-776.460) (-772.993) -- 0:00:55
83500 -- [-776.585] (-774.483) (-774.221) (-773.323) * [-774.029] (-772.123) (-771.982) (-772.946) -- 0:00:54
84000 -- (-772.901) [-772.330] (-772.396) (-773.564) * (-774.970) (-777.345) (-773.111) [-774.066] -- 0:00:54
84500 -- [-774.746] (-772.178) (-773.229) (-773.785) * [-772.879] (-775.368) (-775.394) (-771.781) -- 0:00:54
85000 -- (-774.600) (-773.484) [-773.889] (-775.097) * (-773.632) [-772.136] (-775.802) (-772.343) -- 0:00:53
Average standard deviation of split frequencies: 0.027696
85500 -- (-775.428) (-773.900) [-772.749] (-774.374) * (-774.173) [-777.627] (-780.636) (-772.720) -- 0:00:53
86000 -- (-774.353) [-774.181] (-772.766) (-772.126) * [-772.154] (-774.284) (-776.562) (-773.244) -- 0:00:53
86500 -- [-771.890] (-773.451) (-775.615) (-774.050) * (-772.810) (-776.525) [-781.587] (-775.618) -- 0:00:52
87000 -- (-773.525) (-773.279) (-772.312) [-774.378] * (-772.095) (-774.514) (-774.953) [-773.676] -- 0:01:02
87500 -- (-775.684) (-774.037) [-772.889] (-773.523) * (-777.085) (-773.189) [-775.039] (-772.772) -- 0:01:02
88000 -- (-778.526) (-773.859) [-771.654] (-775.893) * (-782.882) (-771.848) [-773.466] (-773.896) -- 0:01:02
88500 -- [-780.217] (-774.257) (-774.071) (-775.814) * (-775.777) [-772.597] (-773.461) (-772.262) -- 0:01:01
89000 -- (-776.674) [-772.411] (-774.071) (-773.093) * (-774.310) [-773.709] (-774.541) (-773.392) -- 0:01:01
89500 -- (-774.047) [-772.984] (-772.158) (-771.965) * (-777.897) (-773.004) (-772.562) [-772.203] -- 0:01:01
90000 -- (-776.715) (-773.267) [-772.164] (-775.590) * (-775.274) (-774.645) (-773.621) [-772.744] -- 0:01:00
Average standard deviation of split frequencies: 0.025997
90500 -- (-776.473) (-773.174) [-772.973] (-774.398) * [-775.088] (-775.256) (-772.740) (-777.143) -- 0:01:00
91000 -- (-771.885) (-772.642) (-772.847) [-772.811] * (-774.567) (-774.007) [-771.774] (-776.927) -- 0:00:59
91500 -- (-774.598) (-776.926) [-772.682] (-773.517) * [-774.456] (-775.826) (-774.019) (-771.900) -- 0:00:59
92000 -- [-772.407] (-775.319) (-773.934) (-772.941) * (-774.897) [-778.288] (-772.991) (-776.343) -- 0:00:59
92500 -- (-773.769) [-772.919] (-773.460) (-772.479) * [-773.129] (-773.371) (-774.760) (-776.277) -- 0:00:58
93000 -- (-774.082) (-772.224) [-773.865] (-773.684) * (-774.892) (-773.611) (-774.803) [-775.117] -- 0:00:58
93500 -- (-775.399) (-773.749) [-775.008] (-772.279) * [-775.527] (-773.431) (-775.566) (-777.640) -- 0:00:58
94000 -- (-774.788) (-773.680) (-772.061) [-772.279] * [-772.373] (-773.526) (-773.634) (-779.146) -- 0:00:57
94500 -- (-773.676) (-773.440) (-779.929) [-774.595] * (-772.918) [-771.837] (-772.359) (-778.709) -- 0:00:57
95000 -- [-772.114] (-774.649) (-774.415) (-773.344) * (-772.175) (-771.763) [-772.158] (-776.659) -- 0:00:57
Average standard deviation of split frequencies: 0.025586
95500 -- (-777.521) (-775.164) (-776.260) [-772.253] * (-772.520) (-772.244) (-773.217) [-772.452] -- 0:00:56
96000 -- (-774.479) (-777.377) [-775.375] (-772.403) * (-772.910) (-772.148) (-773.901) [-773.351] -- 0:00:56
96500 -- (-774.947) (-775.663) (-772.125) [-773.247] * [-776.560] (-772.358) (-776.980) (-774.432) -- 0:00:56
97000 -- (-772.902) [-774.398] (-774.699) (-773.620) * [-773.374] (-771.993) (-781.443) (-773.184) -- 0:00:55
97500 -- (-776.386) [-772.527] (-775.506) (-775.315) * [-773.327] (-776.568) (-780.221) (-776.389) -- 0:00:55
98000 -- [-772.578] (-773.195) (-774.852) (-773.089) * (-777.156) (-777.684) (-775.630) [-775.428] -- 0:00:55
98500 -- (-774.232) (-772.278) [-772.331] (-772.018) * [-774.514] (-775.748) (-773.296) (-776.024) -- 0:00:54
99000 -- (-776.945) [-773.067] (-772.128) (-772.018) * (-775.953) (-775.283) [-774.383] (-772.191) -- 0:00:54
99500 -- (-773.334) (-775.507) [-772.276] (-773.594) * (-779.698) (-773.672) (-775.442) [-771.517] -- 0:00:54
100000 -- [-777.273] (-772.812) (-772.079) (-771.679) * (-773.777) (-775.315) (-773.855) [-774.465] -- 0:00:54
Average standard deviation of split frequencies: 0.024791
100500 -- (-778.169) (-774.050) [-772.376] (-772.273) * (-779.371) (-773.352) (-773.501) [-775.482] -- 0:00:53
101000 -- (-772.670) (-771.467) (-773.178) [-774.394] * (-774.461) (-772.963) (-773.395) [-773.289] -- 0:00:53
101500 -- (-773.342) [-771.672] (-772.070) (-774.577) * (-776.268) [-773.179] (-772.117) (-776.510) -- 0:00:53
102000 -- [-776.862] (-772.271) (-773.053) (-776.621) * (-772.984) (-775.048) [-771.870] (-774.264) -- 0:00:52
102500 -- (-776.150) (-772.847) (-773.761) [-773.157] * (-772.459) (-777.298) (-771.754) [-773.227] -- 0:01:01
103000 -- (-775.787) (-773.861) [-772.247] (-773.466) * (-776.028) (-783.876) (-774.624) [-772.573] -- 0:01:00
103500 -- (-777.290) (-775.268) (-773.473) [-771.762] * (-776.651) (-773.452) (-773.492) [-773.131] -- 0:01:00
104000 -- (-773.060) (-774.984) [-773.344] (-773.286) * (-773.213) [-773.338] (-773.223) (-772.517) -- 0:01:00
104500 -- (-774.577) (-773.086) [-772.913] (-772.487) * (-772.651) (-774.110) [-772.748] (-779.848) -- 0:00:59
105000 -- (-773.717) (-775.182) [-775.583] (-773.537) * [-772.198] (-773.138) (-775.861) (-777.805) -- 0:00:59
Average standard deviation of split frequencies: 0.026683
105500 -- (-774.012) (-782.497) (-778.608) [-773.386] * (-772.013) [-773.728] (-775.607) (-774.051) -- 0:00:59
106000 -- (-772.939) (-774.972) [-772.380] (-775.205) * (-773.319) (-774.580) (-773.207) [-777.392] -- 0:00:59
106500 -- (-772.678) (-772.401) (-776.583) [-772.979] * (-772.474) [-772.305] (-774.989) (-775.624) -- 0:00:58
107000 -- (-775.444) [-771.962] (-776.143) (-774.701) * (-775.314) (-773.801) (-772.746) [-772.746] -- 0:00:58
107500 -- (-774.374) (-773.104) [-774.398] (-774.287) * (-774.393) (-773.423) (-772.747) [-772.203] -- 0:00:58
108000 -- (-773.208) (-774.459) (-772.788) [-773.108] * (-772.747) (-775.003) (-772.051) [-771.831] -- 0:00:57
108500 -- [-773.392] (-773.896) (-775.379) (-774.977) * [-773.209] (-779.725) (-771.918) (-771.875) -- 0:00:57
109000 -- (-775.682) [-773.434] (-776.260) (-775.906) * (-772.634) [-777.176] (-771.541) (-774.378) -- 0:00:57
109500 -- (-774.528) (-772.325) [-774.138] (-772.944) * (-772.952) (-772.698) (-772.524) [-775.735] -- 0:00:56
110000 -- [-773.829] (-773.533) (-774.408) (-772.500) * (-773.402) [-772.865] (-775.494) (-773.710) -- 0:00:56
Average standard deviation of split frequencies: 0.024305
110500 -- (-779.668) (-775.363) (-774.148) [-773.476] * (-776.281) [-773.588] (-771.486) (-776.144) -- 0:00:56
111000 -- [-781.102] (-772.278) (-772.134) (-772.863) * [-772.991] (-771.596) (-776.025) (-774.526) -- 0:00:56
111500 -- [-775.255] (-772.910) (-774.190) (-773.581) * (-773.870) (-775.624) [-772.300] (-772.959) -- 0:00:55
112000 -- (-775.066) [-774.465] (-775.644) (-777.168) * (-773.294) [-773.605] (-774.076) (-772.847) -- 0:00:55
112500 -- (-773.303) [-774.113] (-775.774) (-772.303) * (-775.246) (-772.591) (-773.451) [-772.729] -- 0:00:55
113000 -- (-775.304) (-775.134) (-773.794) [-773.234] * (-778.285) (-774.739) (-774.317) [-775.172] -- 0:00:54
113500 -- (-775.247) (-774.136) [-773.993] (-773.088) * (-775.374) (-772.475) [-775.758] (-772.170) -- 0:00:54
114000 -- (-774.827) (-775.403) [-771.998] (-774.154) * (-773.370) (-772.515) [-773.476] (-772.444) -- 0:00:54
114500 -- (-773.433) (-776.734) [-775.156] (-778.353) * (-771.501) (-776.341) [-773.746] (-773.735) -- 0:00:54
115000 -- [-772.384] (-776.417) (-771.991) (-777.137) * (-772.286) (-772.885) (-774.363) [-774.087] -- 0:00:53
Average standard deviation of split frequencies: 0.021753
115500 -- (-773.079) (-774.240) (-776.125) [-775.752] * (-772.284) (-775.157) (-774.091) [-773.021] -- 0:00:53
116000 -- (-774.155) [-774.321] (-775.241) (-773.390) * [-772.893] (-775.085) (-774.862) (-772.536) -- 0:00:53
116500 -- (-772.431) (-772.289) (-773.945) [-772.771] * [-771.705] (-773.232) (-780.023) (-774.736) -- 0:00:53
117000 -- (-775.511) [-771.557] (-774.428) (-776.739) * (-777.162) [-774.116] (-774.170) (-773.739) -- 0:00:52
117500 -- (-775.172) (-773.549) [-773.745] (-773.855) * (-777.484) (-773.726) (-772.771) [-773.120] -- 0:00:52
118000 -- (-774.365) [-773.690] (-776.665) (-773.927) * [-775.168] (-773.334) (-771.804) (-775.767) -- 0:00:52
118500 -- [-772.545] (-773.310) (-773.097) (-771.798) * (-775.994) (-773.674) (-775.533) [-772.319] -- 0:00:52
119000 -- (-773.468) (-775.308) [-773.778] (-771.917) * [-774.691] (-773.153) (-774.428) (-772.473) -- 0:00:51
119500 -- [-771.691] (-774.835) (-775.999) (-773.707) * (-774.680) (-780.748) (-777.115) [-772.288] -- 0:00:58
120000 -- [-773.460] (-772.659) (-776.292) (-775.440) * (-774.569) [-774.968] (-776.091) (-772.415) -- 0:00:58
Average standard deviation of split frequencies: 0.022061
120500 -- (-775.430) [-773.416] (-773.947) (-774.496) * (-772.739) [-773.668] (-773.763) (-772.513) -- 0:00:58
121000 -- (-775.243) [-774.161] (-774.221) (-772.266) * (-772.826) (-772.438) (-776.074) [-773.356] -- 0:00:58
121500 -- (-772.742) [-774.177] (-774.568) (-771.720) * (-774.484) (-772.479) (-772.152) [-773.396] -- 0:00:57
122000 -- (-774.581) [-773.242] (-775.487) (-777.621) * (-774.319) (-774.166) [-772.471] (-773.073) -- 0:00:57
122500 -- (-774.283) [-773.524] (-776.282) (-773.606) * (-775.445) (-773.965) [-773.869] (-775.180) -- 0:00:57
123000 -- [-775.608] (-773.295) (-785.089) (-773.017) * (-777.774) [-773.082] (-773.986) (-776.440) -- 0:00:57
123500 -- [-776.499] (-773.096) (-779.910) (-773.875) * (-777.642) [-772.138] (-773.564) (-772.944) -- 0:00:56
124000 -- (-774.310) [-772.440] (-778.680) (-773.548) * [-772.841] (-773.895) (-777.698) (-771.969) -- 0:00:56
124500 -- (-774.198) [-772.191] (-775.685) (-774.478) * (-772.302) (-775.222) [-777.871] (-772.316) -- 0:00:56
125000 -- (-774.637) [-771.764] (-775.003) (-774.842) * (-773.708) (-774.091) [-774.893] (-777.473) -- 0:00:56
Average standard deviation of split frequencies: 0.024208
125500 -- (-774.299) [-772.053] (-776.621) (-776.217) * (-774.750) (-772.074) (-773.256) [-774.269] -- 0:00:55
126000 -- (-774.575) (-773.352) [-777.669] (-773.945) * (-771.788) (-775.071) (-777.049) [-772.852] -- 0:00:55
126500 -- (-771.943) (-773.005) [-776.370] (-779.885) * (-773.636) (-774.154) [-777.849] (-772.545) -- 0:00:55
127000 -- (-775.704) (-773.292) [-777.674] (-774.843) * (-773.901) (-773.319) [-775.758] (-773.677) -- 0:00:54
127500 -- (-774.613) (-775.173) (-772.682) [-774.586] * [-775.761] (-772.365) (-774.141) (-775.098) -- 0:00:54
128000 -- [-773.071] (-775.107) (-776.010) (-774.429) * [-773.862] (-772.547) (-771.826) (-775.870) -- 0:00:54
128500 -- (-773.183) (-775.597) [-773.120] (-773.358) * (-773.840) (-773.370) (-774.940) [-773.829] -- 0:00:54
129000 -- [-774.536] (-774.424) (-776.197) (-773.235) * (-771.989) [-772.299] (-776.677) (-773.883) -- 0:00:54
129500 -- (-778.788) (-772.988) [-772.024] (-776.606) * (-773.250) [-771.790] (-777.369) (-773.279) -- 0:00:53
130000 -- (-775.283) [-775.268] (-772.938) (-780.615) * (-774.662) (-772.705) (-777.108) [-773.025] -- 0:00:53
Average standard deviation of split frequencies: 0.023768
130500 -- (-774.809) (-772.603) (-775.582) [-773.844] * (-772.664) (-774.387) (-772.023) [-772.534] -- 0:00:53
131000 -- (-773.131) (-771.946) [-772.973] (-773.406) * (-772.869) (-774.001) (-772.688) [-773.379] -- 0:00:53
131500 -- (-772.190) (-773.069) (-774.587) [-771.344] * (-776.377) (-773.632) [-774.053] (-772.875) -- 0:00:52
132000 -- (-774.352) (-775.081) (-775.715) [-771.697] * (-774.753) [-774.299] (-774.357) (-771.702) -- 0:00:52
132500 -- (-774.292) (-775.250) [-773.810] (-771.471) * [-772.947] (-774.048) (-773.635) (-773.439) -- 0:00:52
133000 -- [-772.693] (-772.510) (-773.503) (-771.764) * (-772.320) (-775.313) [-775.972] (-772.903) -- 0:00:52
133500 -- (-773.206) (-771.921) (-773.596) [-774.508] * (-772.051) [-773.252] (-772.625) (-772.614) -- 0:00:58
134000 -- [-772.961] (-774.965) (-772.160) (-772.937) * (-773.321) (-776.627) [-773.437] (-778.730) -- 0:00:58
134500 -- (-776.524) [-772.438] (-772.052) (-772.904) * (-772.396) [-774.044] (-774.859) (-774.921) -- 0:00:57
135000 -- (-773.505) (-772.145) [-771.361] (-773.714) * (-771.809) [-774.511] (-774.937) (-773.301) -- 0:00:57
Average standard deviation of split frequencies: 0.020027
135500 -- (-773.418) [-773.006] (-773.443) (-774.119) * (-776.035) [-772.561] (-771.867) (-774.415) -- 0:00:57
136000 -- (-774.006) (-774.156) [-771.726] (-776.487) * (-783.232) (-773.085) [-773.005] (-774.267) -- 0:00:57
136500 -- (-773.003) (-776.223) (-773.277) [-776.002] * (-777.462) [-772.449] (-773.489) (-773.303) -- 0:00:56
137000 -- (-775.016) [-778.389] (-774.339) (-775.211) * (-774.523) [-773.942] (-772.018) (-778.052) -- 0:00:56
137500 -- (-773.107) (-775.584) [-771.875] (-779.045) * [-774.766] (-776.129) (-773.539) (-774.228) -- 0:00:56
138000 -- [-772.790] (-775.283) (-771.955) (-771.963) * (-772.292) (-776.353) [-772.052] (-773.624) -- 0:00:56
138500 -- (-775.694) [-773.675] (-771.658) (-774.590) * (-774.034) (-776.116) [-772.618] (-773.492) -- 0:00:55
139000 -- [-772.503] (-777.424) (-772.214) (-772.695) * (-773.585) (-772.668) [-773.447] (-773.457) -- 0:00:55
139500 -- (-773.620) [-774.727] (-771.711) (-772.188) * (-773.660) [-772.319] (-773.531) (-772.612) -- 0:00:55
140000 -- (-783.294) (-773.425) [-773.943] (-775.587) * (-774.462) (-773.089) [-772.148] (-771.672) -- 0:00:55
Average standard deviation of split frequencies: 0.021290
140500 -- (-774.698) (-775.154) (-772.939) [-773.540] * (-774.856) [-772.246] (-775.323) (-772.320) -- 0:00:55
141000 -- (-775.481) (-776.817) (-773.107) [-773.113] * (-773.227) (-772.649) [-773.328] (-771.530) -- 0:00:54
141500 -- (-774.942) (-772.521) (-778.188) [-775.868] * (-772.847) [-773.390] (-772.235) (-771.888) -- 0:00:54
142000 -- (-774.544) (-773.960) (-773.433) [-774.757] * [-772.191] (-772.711) (-775.502) (-774.075) -- 0:00:54
142500 -- (-776.663) (-771.974) [-772.154] (-775.485) * (-776.473) (-773.614) [-774.301] (-774.282) -- 0:00:54
143000 -- (-779.571) (-773.711) [-771.774] (-774.603) * [-772.854] (-773.216) (-777.740) (-774.095) -- 0:00:53
143500 -- (-773.158) (-773.403) [-772.403] (-778.521) * (-775.883) (-772.943) [-773.247] (-776.793) -- 0:00:53
144000 -- (-774.345) (-772.553) (-775.107) [-771.935] * (-773.425) (-773.207) (-773.807) [-772.113] -- 0:00:53
144500 -- [-773.793] (-772.985) (-774.438) (-774.603) * (-772.934) (-773.106) [-772.785] (-775.374) -- 0:00:53
145000 -- (-775.613) (-772.343) (-775.341) [-776.177] * (-771.657) (-773.747) (-772.646) [-772.877] -- 0:00:53
Average standard deviation of split frequencies: 0.020628
145500 -- (-774.085) [-771.339] (-777.820) (-773.255) * (-771.740) (-779.917) (-774.011) [-772.862] -- 0:00:52
146000 -- [-772.131] (-771.335) (-776.424) (-774.510) * (-771.987) (-772.301) [-774.014] (-777.011) -- 0:00:52
146500 -- (-773.753) [-772.137] (-772.915) (-771.698) * (-773.204) (-772.897) [-772.472] (-773.406) -- 0:00:52
147000 -- (-773.052) (-771.993) (-773.245) [-772.120] * (-773.472) [-772.484] (-774.231) (-774.333) -- 0:00:52
147500 -- [-775.676] (-772.070) (-771.969) (-772.145) * (-774.563) (-772.467) (-775.123) [-772.656] -- 0:00:52
148000 -- [-774.964] (-772.278) (-772.436) (-781.425) * (-773.242) [-773.116] (-774.808) (-772.185) -- 0:00:51
148500 -- [-775.179] (-772.297) (-775.446) (-779.090) * (-774.626) (-776.359) [-774.355] (-772.537) -- 0:00:51
149000 -- (-775.981) [-774.532] (-775.880) (-777.916) * (-774.832) [-774.634] (-772.847) (-773.706) -- 0:00:51
149500 -- (-773.587) (-772.930) [-771.885] (-781.508) * (-774.627) (-776.504) [-774.474] (-774.824) -- 0:00:51
150000 -- (-773.386) (-773.527) (-773.228) [-774.239] * (-772.236) (-773.872) (-776.407) [-773.385] -- 0:00:56
Average standard deviation of split frequencies: 0.021717
150500 -- (-773.346) (-773.752) [-772.390] (-772.591) * (-773.008) (-776.140) (-773.918) [-772.142] -- 0:00:56
151000 -- [-773.405] (-775.437) (-776.181) (-772.276) * (-775.978) (-772.662) [-774.188] (-775.541) -- 0:00:56
151500 -- [-778.675] (-773.444) (-774.387) (-774.900) * (-773.261) [-772.355] (-775.812) (-773.773) -- 0:00:56
152000 -- (-774.138) [-778.253] (-772.201) (-775.569) * (-776.667) (-775.922) (-774.028) [-773.864] -- 0:00:55
152500 -- (-773.894) [-773.741] (-771.756) (-781.189) * (-776.072) (-777.687) (-776.407) [-775.593] -- 0:00:55
153000 -- [-771.882] (-772.155) (-772.725) (-778.705) * [-773.052] (-772.561) (-773.919) (-774.658) -- 0:00:55
153500 -- (-772.114) (-776.162) (-772.921) [-777.614] * (-772.040) [-773.605] (-774.544) (-772.768) -- 0:00:55
154000 -- (-773.818) (-776.195) (-772.075) [-771.531] * (-773.843) (-773.363) (-776.012) [-776.148] -- 0:00:54
154500 -- [-773.050] (-774.102) (-771.946) (-773.446) * (-773.866) (-776.019) [-775.624] (-778.099) -- 0:00:54
155000 -- (-772.781) (-773.877) (-775.400) [-774.390] * (-776.863) [-775.455] (-772.741) (-772.869) -- 0:00:54
Average standard deviation of split frequencies: 0.020620
155500 -- [-772.992] (-776.014) (-776.542) (-775.925) * (-773.601) (-774.086) (-772.331) [-772.961] -- 0:00:54
156000 -- [-773.228] (-774.518) (-775.597) (-773.112) * (-773.629) (-773.574) [-771.897] (-773.035) -- 0:00:54
156500 -- (-771.966) [-773.440] (-776.501) (-772.904) * (-773.870) (-776.337) [-772.176] (-774.037) -- 0:00:53
157000 -- (-775.280) [-774.070] (-775.292) (-772.445) * (-779.810) (-777.677) (-775.180) [-772.196] -- 0:00:53
157500 -- [-773.076] (-774.156) (-774.838) (-772.494) * (-772.997) [-772.711] (-772.566) (-772.801) -- 0:00:53
158000 -- [-774.390] (-774.952) (-774.557) (-775.892) * [-773.887] (-775.280) (-773.446) (-773.333) -- 0:00:53
158500 -- (-773.457) [-771.408] (-773.774) (-776.195) * [-773.799] (-773.395) (-772.677) (-773.538) -- 0:00:53
159000 -- [-771.867] (-776.754) (-773.497) (-773.063) * (-775.586) (-776.454) [-774.281] (-773.199) -- 0:00:52
159500 -- [-778.133] (-774.615) (-777.259) (-773.598) * [-773.680] (-772.641) (-775.029) (-774.430) -- 0:00:52
160000 -- (-776.207) (-772.763) (-776.479) [-774.845] * (-773.302) (-772.782) (-779.761) [-772.710] -- 0:00:52
Average standard deviation of split frequencies: 0.020355
160500 -- (-773.321) (-774.073) (-777.132) [-773.279] * (-772.323) (-771.474) (-776.060) [-776.846] -- 0:00:52
161000 -- [-774.431] (-773.208) (-776.891) (-772.552) * [-775.027] (-779.443) (-775.811) (-775.352) -- 0:00:52
161500 -- (-774.394) (-780.878) [-773.799] (-773.757) * [-772.663] (-777.415) (-775.256) (-772.761) -- 0:00:51
162000 -- (-778.811) (-774.533) (-777.925) [-775.307] * (-776.308) [-775.613] (-775.716) (-772.094) -- 0:00:51
162500 -- (-777.197) (-774.940) (-772.544) [-772.566] * (-775.286) (-773.489) [-775.668] (-773.135) -- 0:00:51
163000 -- (-773.833) (-774.739) (-772.782) [-772.612] * [-772.557] (-776.430) (-771.380) (-778.311) -- 0:00:51
163500 -- (-773.915) (-774.849) (-772.762) [-773.809] * (-772.026) (-773.680) [-771.476] (-774.682) -- 0:00:51
164000 -- (-774.729) (-771.886) [-774.059] (-774.376) * [-772.334] (-771.955) (-773.797) (-775.688) -- 0:00:50
164500 -- (-774.051) (-775.426) (-774.880) [-776.098] * (-773.901) (-772.219) [-772.297] (-772.987) -- 0:00:50
165000 -- [-774.315] (-773.333) (-773.393) (-774.183) * [-773.243] (-772.874) (-778.531) (-772.903) -- 0:00:50
Average standard deviation of split frequencies: 0.019210
165500 -- [-777.720] (-772.757) (-772.328) (-774.794) * [-774.159] (-775.626) (-775.274) (-773.034) -- 0:00:55
166000 -- (-774.978) (-774.280) (-775.544) [-772.099] * [-774.822] (-771.810) (-778.691) (-774.712) -- 0:00:55
166500 -- (-773.716) (-771.904) (-774.318) [-773.334] * (-774.512) [-774.368] (-781.740) (-773.723) -- 0:00:55
167000 -- (-773.328) [-773.438] (-772.473) (-773.482) * [-773.391] (-775.587) (-775.459) (-772.560) -- 0:00:54
167500 -- (-774.834) [-773.377] (-775.545) (-772.112) * (-773.552) (-773.423) (-778.411) [-772.867] -- 0:00:54
168000 -- (-775.786) [-772.276] (-773.710) (-772.233) * (-773.376) (-774.471) (-775.399) [-771.518] -- 0:00:54
168500 -- (-776.260) (-772.847) [-774.083] (-772.828) * (-771.863) (-778.575) [-775.038] (-771.928) -- 0:00:54
169000 -- (-774.326) [-774.015] (-774.762) (-774.097) * (-772.444) [-774.518] (-776.883) (-774.833) -- 0:00:54
169500 -- (-775.325) [-773.617] (-778.992) (-777.895) * [-773.909] (-777.754) (-777.417) (-773.115) -- 0:00:53
170000 -- (-776.897) [-772.307] (-774.819) (-777.256) * [-774.916] (-772.617) (-772.323) (-773.217) -- 0:00:53
Average standard deviation of split frequencies: 0.018035
170500 -- [-773.893] (-772.707) (-774.691) (-772.685) * [-772.685] (-774.518) (-772.146) (-777.231) -- 0:00:53
171000 -- (-775.672) (-772.697) (-773.506) [-771.980] * [-773.044] (-773.685) (-773.515) (-775.173) -- 0:00:53
171500 -- [-777.280] (-772.371) (-774.626) (-773.010) * (-773.432) [-772.196] (-775.396) (-774.531) -- 0:00:53
172000 -- (-772.071) (-775.842) (-772.727) [-772.060] * (-772.137) [-771.654] (-774.159) (-777.055) -- 0:00:52
172500 -- [-772.422] (-776.912) (-772.364) (-773.414) * (-777.713) [-773.060] (-772.221) (-774.288) -- 0:00:52
173000 -- [-773.243] (-774.732) (-775.462) (-772.151) * (-773.541) [-774.476] (-777.697) (-773.911) -- 0:00:52
173500 -- (-772.893) [-774.053] (-772.833) (-774.514) * (-771.589) [-775.302] (-778.531) (-773.713) -- 0:00:52
174000 -- (-774.829) (-772.728) [-773.897] (-775.894) * (-772.263) [-772.999] (-771.967) (-774.405) -- 0:00:52
174500 -- [-776.440] (-773.425) (-774.473) (-775.893) * (-773.053) (-771.997) [-774.131] (-772.346) -- 0:00:52
175000 -- (-777.402) (-772.817) [-772.073] (-774.063) * (-774.467) [-772.792] (-775.424) (-774.315) -- 0:00:51
Average standard deviation of split frequencies: 0.017489
175500 -- (-771.788) [-775.913] (-777.079) (-777.730) * (-775.587) (-777.184) [-775.585] (-775.138) -- 0:00:51
176000 -- (-771.566) (-774.821) (-772.797) [-772.827] * (-782.892) (-773.501) [-775.033] (-777.597) -- 0:00:51
176500 -- (-771.567) (-773.697) (-772.555) [-771.959] * (-774.004) [-773.943] (-773.911) (-776.951) -- 0:00:51
177000 -- (-774.198) (-773.506) [-776.228] (-773.697) * (-775.505) (-777.531) [-773.870] (-773.141) -- 0:00:51
177500 -- (-774.459) (-774.744) (-772.467) [-772.703] * (-778.256) (-774.412) (-774.195) [-772.465] -- 0:00:50
178000 -- (-777.224) [-774.747] (-772.643) (-774.476) * (-772.407) (-776.170) [-774.597] (-773.089) -- 0:00:50
178500 -- (-776.945) (-774.017) (-774.627) [-773.744] * (-774.507) (-774.917) (-772.866) [-772.974] -- 0:00:50
179000 -- (-776.152) [-773.631] (-775.189) (-774.338) * (-772.283) (-775.623) [-772.997] (-774.967) -- 0:00:50
179500 -- (-772.637) (-774.465) [-773.434] (-771.990) * (-773.069) (-774.092) [-772.008] (-777.232) -- 0:00:50
180000 -- (-772.990) (-773.810) (-773.211) [-773.867] * [-773.896] (-774.850) (-773.566) (-779.997) -- 0:00:50
Average standard deviation of split frequencies: 0.015329
180500 -- (-774.452) (-773.137) [-777.376] (-772.459) * (-774.116) (-775.790) [-771.539] (-774.735) -- 0:00:49
181000 -- (-772.201) (-772.591) [-774.968] (-773.051) * (-773.268) (-774.645) (-773.351) [-774.212] -- 0:00:49
181500 -- (-775.467) [-773.085] (-772.711) (-774.267) * (-774.752) [-773.044] (-779.142) (-776.693) -- 0:00:49
182000 -- [-772.470] (-773.732) (-773.331) (-775.678) * [-772.936] (-772.954) (-775.319) (-771.901) -- 0:00:53
182500 -- (-773.327) (-773.003) (-780.902) [-777.951] * (-772.724) [-771.564] (-773.309) (-773.380) -- 0:00:53
183000 -- (-775.144) [-772.248] (-779.570) (-778.302) * (-772.008) (-775.172) [-774.563] (-774.595) -- 0:00:53
183500 -- (-774.707) [-773.341] (-774.367) (-775.936) * (-771.330) (-773.807) (-773.229) [-773.500] -- 0:00:53
184000 -- [-774.310] (-773.776) (-773.880) (-773.273) * [-772.240] (-774.815) (-774.591) (-773.050) -- 0:00:53
184500 -- (-774.255) (-776.754) (-771.940) [-771.942] * (-774.852) (-773.841) (-775.805) [-773.842] -- 0:00:53
185000 -- [-774.629] (-772.997) (-776.077) (-772.730) * (-775.120) (-774.478) [-775.663] (-773.493) -- 0:00:52
Average standard deviation of split frequencies: 0.014610
185500 -- (-773.834) [-772.933] (-779.341) (-774.179) * (-773.568) (-773.618) (-773.835) [-773.370] -- 0:00:52
186000 -- (-773.322) (-773.396) (-773.800) [-773.439] * (-773.187) [-775.734] (-771.813) (-772.538) -- 0:00:52
186500 -- (-776.036) (-773.804) [-771.821] (-775.091) * (-772.888) (-773.233) [-772.472] (-772.789) -- 0:00:52
187000 -- (-773.038) [-773.820] (-771.521) (-775.522) * [-772.272] (-773.726) (-775.733) (-774.822) -- 0:00:52
187500 -- (-772.702) (-775.606) [-773.523] (-773.885) * (-774.244) (-773.750) (-772.899) [-776.429] -- 0:00:52
188000 -- (-772.987) (-777.350) [-774.544] (-774.569) * [-772.059] (-773.075) (-774.493) (-776.337) -- 0:00:51
188500 -- (-774.578) (-772.275) (-774.148) [-774.936] * (-772.342) (-772.346) [-772.953] (-777.051) -- 0:00:51
189000 -- [-776.999] (-772.854) (-774.036) (-772.376) * (-776.269) [-773.132] (-772.628) (-774.986) -- 0:00:51
189500 -- [-774.693] (-772.315) (-775.490) (-772.447) * (-771.960) [-772.311] (-774.951) (-776.940) -- 0:00:51
190000 -- (-775.296) (-773.626) [-773.049] (-774.297) * (-775.217) [-772.630] (-775.231) (-776.311) -- 0:00:51
Average standard deviation of split frequencies: 0.014680
190500 -- [-772.937] (-776.814) (-775.838) (-774.201) * (-774.890) [-774.086] (-774.203) (-772.623) -- 0:00:50
191000 -- (-773.089) (-772.733) (-774.391) [-772.148] * (-780.224) (-773.910) [-775.310] (-774.714) -- 0:00:50
191500 -- (-773.157) [-771.839] (-777.848) (-777.443) * (-774.748) (-775.018) [-773.418] (-774.931) -- 0:00:50
192000 -- [-779.214] (-771.752) (-774.397) (-773.281) * (-775.791) (-774.317) (-774.296) [-776.527] -- 0:00:50
192500 -- [-773.403] (-772.588) (-777.820) (-774.624) * (-775.020) (-774.838) [-773.301] (-772.919) -- 0:00:50
193000 -- (-775.153) [-774.268] (-779.077) (-772.345) * [-775.692] (-773.813) (-773.186) (-783.659) -- 0:00:50
193500 -- (-779.646) (-773.406) (-773.335) [-773.258] * (-773.281) [-771.409] (-774.877) (-775.145) -- 0:00:50
194000 -- (-775.308) (-773.770) [-774.260] (-772.505) * (-772.839) (-772.086) (-774.860) [-772.799] -- 0:00:49
194500 -- (-773.216) (-774.750) (-773.245) [-772.701] * (-773.260) (-771.608) (-773.924) [-773.068] -- 0:00:49
195000 -- (-772.234) (-772.534) [-777.985] (-771.792) * (-772.328) (-774.958) [-771.999] (-774.087) -- 0:00:49
Average standard deviation of split frequencies: 0.015483
195500 -- [-772.657] (-771.906) (-775.888) (-775.440) * [-774.444] (-774.622) (-771.968) (-773.036) -- 0:00:49
196000 -- (-774.625) [-772.136] (-772.913) (-777.226) * (-774.500) (-772.334) (-774.133) [-776.524] -- 0:00:49
196500 -- (-772.619) [-773.606] (-771.396) (-777.811) * (-774.081) [-773.519] (-775.292) (-773.751) -- 0:00:49
197000 -- (-773.878) (-774.563) (-773.445) [-771.849] * (-783.048) (-773.734) (-775.664) [-774.070] -- 0:00:52
197500 -- (-774.485) (-774.480) (-773.441) [-771.715] * (-782.470) (-772.134) (-775.609) [-773.177] -- 0:00:52
198000 -- [-772.973] (-772.204) (-772.540) (-772.956) * (-777.362) (-772.153) [-772.227] (-772.058) -- 0:00:52
198500 -- (-779.159) [-774.073] (-773.330) (-774.262) * [-772.890] (-773.217) (-773.115) (-773.077) -- 0:00:52
199000 -- (-774.669) (-772.102) [-774.635] (-773.643) * [-773.262] (-773.418) (-777.138) (-774.260) -- 0:00:52
199500 -- (-773.010) [-771.610] (-774.038) (-775.974) * [-774.439] (-773.873) (-773.182) (-774.862) -- 0:00:52
200000 -- (-772.832) [-772.995] (-772.670) (-775.296) * [-774.569] (-774.662) (-773.952) (-776.344) -- 0:00:51
Average standard deviation of split frequencies: 0.013508
200500 -- (-771.574) (-772.609) (-775.333) [-776.129] * [-774.070] (-772.333) (-778.977) (-772.753) -- 0:00:51
201000 -- (-774.376) (-772.152) [-775.774] (-774.832) * (-774.370) (-773.549) (-772.953) [-773.658] -- 0:00:51
201500 -- (-780.172) [-771.631] (-774.810) (-772.900) * (-773.475) (-773.390) (-775.686) [-774.106] -- 0:00:51
202000 -- (-776.482) (-771.795) [-775.478] (-771.780) * (-773.009) (-773.663) [-772.571] (-778.725) -- 0:00:51
202500 -- (-777.749) [-773.307] (-772.370) (-771.741) * (-773.462) [-772.084] (-773.008) (-773.890) -- 0:00:51
203000 -- (-778.761) (-773.295) [-773.940] (-774.252) * [-772.840] (-772.065) (-772.106) (-774.551) -- 0:00:51
203500 -- (-776.041) (-771.922) [-771.921] (-772.449) * (-773.605) [-772.152] (-775.484) (-778.428) -- 0:00:50
204000 -- (-776.490) [-772.468] (-777.608) (-772.129) * [-772.752] (-771.775) (-774.234) (-776.606) -- 0:00:50
204500 -- (-774.599) (-776.390) (-775.227) [-774.763] * (-775.279) (-774.990) [-774.136] (-773.716) -- 0:00:50
205000 -- (-774.485) (-773.276) (-775.598) [-774.275] * (-772.308) (-773.283) [-775.951] (-772.493) -- 0:00:50
Average standard deviation of split frequencies: 0.013158
205500 -- (-773.516) (-772.935) [-774.309] (-771.828) * (-772.058) (-772.553) [-772.420] (-771.639) -- 0:00:50
206000 -- [-773.526] (-774.286) (-775.069) (-773.958) * (-773.198) (-772.402) (-778.854) [-773.823] -- 0:00:50
206500 -- (-774.600) (-773.266) [-775.835] (-779.125) * (-772.099) [-775.282] (-773.317) (-775.874) -- 0:00:49
207000 -- (-774.244) (-776.326) (-779.480) [-775.777] * [-772.752] (-774.496) (-772.599) (-772.312) -- 0:00:49
207500 -- (-774.040) (-774.033) (-774.476) [-776.902] * (-773.827) (-775.462) (-772.723) [-775.025] -- 0:00:49
208000 -- (-773.140) [-775.060] (-775.824) (-776.180) * (-771.580) [-773.593] (-773.811) (-772.843) -- 0:00:49
208500 -- (-775.798) [-774.824] (-773.211) (-772.344) * (-773.147) (-774.498) (-776.961) [-772.991] -- 0:00:49
209000 -- (-777.108) (-773.901) [-772.357] (-777.719) * (-772.649) (-774.621) (-775.208) [-771.720] -- 0:00:49
209500 -- (-778.251) (-773.443) [-773.222] (-775.463) * (-775.000) (-776.177) (-775.339) [-773.139] -- 0:00:49
210000 -- (-772.766) (-774.911) (-774.946) [-776.303] * (-774.901) (-773.897) (-773.870) [-771.917] -- 0:00:48
Average standard deviation of split frequencies: 0.013007
210500 -- [-772.447] (-773.131) (-772.452) (-771.750) * (-780.055) (-774.134) (-774.108) [-773.926] -- 0:00:48
211000 -- [-772.545] (-772.084) (-772.003) (-774.207) * (-773.608) (-773.698) [-772.729] (-777.270) -- 0:00:48
211500 -- (-774.570) (-774.082) (-775.558) [-773.320] * (-771.944) (-773.144) [-773.658] (-776.859) -- 0:00:48
212000 -- (-775.605) (-774.310) (-773.486) [-773.448] * (-775.915) [-776.163] (-777.287) (-775.278) -- 0:00:48
212500 -- (-777.564) (-774.991) (-771.761) [-772.040] * (-777.093) (-773.254) [-774.628] (-774.530) -- 0:00:51
213000 -- (-772.258) [-772.818] (-772.950) (-772.438) * (-775.150) [-772.931] (-775.194) (-779.077) -- 0:00:51
213500 -- (-776.784) [-771.713] (-772.988) (-773.085) * (-776.522) [-772.665] (-772.629) (-772.968) -- 0:00:51
214000 -- (-772.889) [-772.274] (-774.581) (-780.511) * [-776.418] (-772.274) (-776.419) (-773.511) -- 0:00:51
214500 -- (-773.142) (-773.151) (-774.055) [-774.789] * (-773.094) (-777.677) [-775.903] (-775.007) -- 0:00:51
215000 -- [-776.032] (-776.043) (-774.433) (-776.092) * [-773.946] (-776.352) (-773.643) (-772.634) -- 0:00:51
Average standard deviation of split frequencies: 0.011731
215500 -- (-772.476) (-782.354) (-773.723) [-779.532] * (-776.837) (-775.617) (-772.461) [-775.318] -- 0:00:50
216000 -- [-772.617] (-775.321) (-775.405) (-772.023) * (-773.130) (-773.494) (-772.013) [-775.841] -- 0:00:50
216500 -- (-772.175) [-773.458] (-775.213) (-772.838) * (-771.458) (-774.980) [-774.810] (-776.937) -- 0:00:50
217000 -- (-773.730) [-772.192] (-773.492) (-772.691) * (-775.353) (-774.916) [-772.250] (-773.974) -- 0:00:50
217500 -- (-776.523) [-772.782] (-773.857) (-773.229) * (-778.216) [-773.691] (-774.027) (-779.679) -- 0:00:50
218000 -- [-774.874] (-774.749) (-776.110) (-775.726) * (-774.472) [-772.922] (-772.144) (-778.466) -- 0:00:50
218500 -- (-773.601) (-776.817) [-774.657] (-773.862) * (-773.633) [-772.212] (-774.589) (-773.066) -- 0:00:50
219000 -- [-777.660] (-776.749) (-774.580) (-773.994) * [-772.500] (-771.991) (-772.455) (-774.113) -- 0:00:49
219500 -- (-773.786) [-773.165] (-772.764) (-774.949) * [-771.474] (-773.736) (-772.980) (-774.784) -- 0:00:49
220000 -- (-774.859) [-773.804] (-774.059) (-773.949) * (-773.492) (-775.104) [-771.967] (-774.993) -- 0:00:49
Average standard deviation of split frequencies: 0.011251
220500 -- (-775.092) [-773.997] (-772.609) (-775.968) * (-772.443) (-773.468) (-774.753) [-773.013] -- 0:00:49
221000 -- (-772.535) (-773.856) [-774.453] (-774.797) * (-773.275) [-774.953] (-773.890) (-772.237) -- 0:00:49
221500 -- (-776.275) (-773.207) (-774.376) [-773.271] * (-772.453) (-774.648) (-772.929) [-779.345] -- 0:00:49
222000 -- (-773.197) [-773.347] (-775.756) (-774.885) * (-772.489) (-772.191) [-774.069] (-771.892) -- 0:00:49
222500 -- [-773.347] (-773.745) (-773.141) (-775.977) * (-773.463) (-772.098) [-776.178] (-772.670) -- 0:00:48
223000 -- (-777.002) (-773.309) [-772.880] (-775.365) * (-772.332) (-772.235) [-771.818] (-771.635) -- 0:00:48
223500 -- (-774.417) (-776.537) (-772.880) [-773.910] * (-773.930) [-772.588] (-771.773) (-775.825) -- 0:00:48
224000 -- (-775.775) (-773.092) [-776.678] (-772.374) * (-773.881) (-772.903) [-771.805] (-774.051) -- 0:00:48
224500 -- [-771.996] (-780.430) (-777.208) (-774.403) * (-772.088) (-775.207) [-772.972] (-774.040) -- 0:00:48
225000 -- (-771.956) [-774.617] (-775.005) (-773.412) * (-772.635) (-774.969) (-773.418) [-773.975] -- 0:00:48
Average standard deviation of split frequencies: 0.012761
225500 -- [-773.415] (-775.162) (-773.135) (-776.526) * (-771.976) (-774.410) (-773.440) [-773.732] -- 0:00:48
226000 -- (-774.216) (-773.008) [-772.267] (-774.765) * (-775.207) (-771.689) [-773.760] (-776.753) -- 0:00:47
226500 -- (-776.539) [-776.118] (-774.327) (-773.081) * (-772.499) [-772.955] (-773.194) (-772.314) -- 0:00:47
227000 -- (-778.554) (-772.486) [-773.234] (-773.780) * (-773.459) (-772.036) [-773.946] (-773.488) -- 0:00:47
227500 -- (-778.250) (-775.925) (-772.538) [-773.186] * [-773.902] (-774.580) (-776.049) (-772.339) -- 0:00:47
228000 -- [-773.703] (-772.224) (-772.791) (-776.743) * (-772.566) [-771.857] (-776.466) (-772.156) -- 0:00:47
228500 -- (-773.591) (-774.307) [-772.390] (-778.716) * (-773.685) (-776.339) [-774.492] (-777.455) -- 0:00:47
229000 -- (-773.879) (-773.183) [-772.555] (-776.401) * [-772.961] (-773.225) (-774.665) (-777.424) -- 0:00:50
229500 -- [-774.722] (-773.438) (-774.853) (-775.958) * (-772.965) (-773.235) (-773.113) [-774.974] -- 0:00:50
230000 -- (-774.208) (-775.073) (-772.069) [-776.876] * (-774.245) (-772.284) [-772.931] (-774.263) -- 0:00:50
Average standard deviation of split frequencies: 0.012645
230500 -- (-775.091) (-776.018) [-772.070] (-775.738) * (-772.580) (-771.990) [-773.580] (-774.264) -- 0:00:50
231000 -- (-773.517) [-772.398] (-772.797) (-780.339) * [-772.357] (-771.991) (-773.885) (-775.148) -- 0:00:49
231500 -- (-772.358) (-772.965) [-772.277] (-776.495) * (-775.205) [-773.741] (-774.494) (-774.300) -- 0:00:49
232000 -- (-772.170) (-773.507) (-771.881) [-778.294] * (-776.126) [-775.049] (-773.578) (-779.916) -- 0:00:49
232500 -- (-772.343) (-775.227) (-775.290) [-773.065] * (-772.118) (-773.946) [-774.232] (-781.026) -- 0:00:49
233000 -- (-772.752) (-773.190) [-776.664] (-778.028) * (-775.534) [-772.529] (-772.418) (-774.313) -- 0:00:49
233500 -- (-775.286) (-773.520) (-775.104) [-773.368] * (-774.164) (-773.617) [-773.645] (-772.409) -- 0:00:49
234000 -- (-773.440) (-774.973) [-777.327] (-774.543) * (-774.368) (-775.028) (-772.133) [-772.423] -- 0:00:49
234500 -- (-772.236) [-777.488] (-774.846) (-772.149) * [-774.251] (-774.665) (-773.064) (-775.483) -- 0:00:48
235000 -- (-772.821) (-774.260) [-773.608] (-774.239) * (-773.560) (-774.934) [-773.140] (-773.064) -- 0:00:48
Average standard deviation of split frequencies: 0.013716
235500 -- (-773.728) (-772.898) [-772.170] (-775.141) * (-772.258) (-774.417) (-775.169) [-776.231] -- 0:00:48
236000 -- [-772.855] (-774.005) (-774.597) (-772.524) * [-773.494] (-774.410) (-774.228) (-772.547) -- 0:00:48
236500 -- (-777.024) (-772.500) (-778.489) [-773.088] * [-774.867] (-776.325) (-778.478) (-772.080) -- 0:00:48
237000 -- (-772.653) (-774.374) (-775.453) [-774.542] * [-774.510] (-773.341) (-774.821) (-773.779) -- 0:00:48
237500 -- (-776.554) (-774.003) (-774.996) [-775.974] * (-771.995) [-773.057] (-773.712) (-774.532) -- 0:00:48
238000 -- (-773.245) (-774.271) (-774.074) [-774.222] * [-773.789] (-772.194) (-775.423) (-773.165) -- 0:00:48
238500 -- (-772.921) (-773.163) (-773.102) [-774.824] * [-774.372] (-774.095) (-777.473) (-772.830) -- 0:00:47
239000 -- [-774.096] (-773.124) (-772.787) (-772.848) * (-775.417) [-773.546] (-775.415) (-775.177) -- 0:00:47
239500 -- (-776.161) (-773.962) [-772.536] (-773.241) * (-773.331) [-777.373] (-783.697) (-772.762) -- 0:00:47
240000 -- [-775.580] (-771.965) (-772.480) (-775.069) * (-774.335) [-772.170] (-780.712) (-773.870) -- 0:00:47
Average standard deviation of split frequencies: 0.013450
240500 -- (-774.040) (-774.777) [-775.269] (-774.367) * [-772.625] (-773.047) (-776.558) (-773.776) -- 0:00:47
241000 -- (-773.971) (-776.182) [-775.655] (-774.831) * (-774.145) (-772.556) (-775.926) [-775.322] -- 0:00:47
241500 -- (-772.180) (-783.549) [-771.817] (-775.323) * (-773.683) [-772.522] (-773.960) (-771.691) -- 0:00:47
242000 -- (-773.081) [-772.479] (-774.783) (-772.619) * (-775.685) [-773.838] (-775.028) (-773.437) -- 0:00:46
242500 -- (-772.538) (-772.226) (-775.370) [-775.192] * (-773.093) (-775.863) [-771.373] (-773.541) -- 0:00:46
243000 -- (-772.389) (-773.240) [-776.893] (-771.755) * (-772.130) [-773.424] (-771.512) (-773.505) -- 0:00:46
243500 -- (-773.097) (-772.290) [-773.064] (-771.810) * (-776.079) (-772.791) [-771.914] (-773.610) -- 0:00:46
244000 -- [-772.520] (-773.224) (-774.232) (-772.656) * [-773.238] (-773.303) (-774.234) (-775.951) -- 0:00:46
244500 -- [-771.629] (-771.880) (-773.279) (-778.179) * (-776.010) [-773.050] (-776.531) (-777.377) -- 0:00:46
245000 -- (-773.914) (-773.561) [-779.294] (-773.365) * [-772.585] (-772.330) (-773.965) (-775.903) -- 0:00:46
Average standard deviation of split frequencies: 0.013893
245500 -- (-777.198) (-772.891) [-772.405] (-775.136) * (-773.871) [-773.196] (-781.416) (-775.579) -- 0:00:49
246000 -- (-777.836) [-771.988] (-772.605) (-773.600) * (-772.201) [-774.575] (-777.235) (-775.255) -- 0:00:49
246500 -- [-775.498] (-772.087) (-774.497) (-773.666) * (-772.916) (-773.579) (-778.965) [-772.907] -- 0:00:48
247000 -- [-776.453] (-774.294) (-774.046) (-772.248) * [-771.954] (-773.191) (-777.196) (-773.294) -- 0:00:48
247500 -- (-776.601) [-773.167] (-773.621) (-773.328) * (-771.864) (-774.810) (-772.261) [-773.123] -- 0:00:48
248000 -- (-780.473) (-772.344) (-774.472) [-773.442] * (-775.180) [-774.748] (-774.429) (-773.521) -- 0:00:48
248500 -- (-778.880) (-771.434) [-773.139] (-773.583) * (-776.456) (-776.337) [-771.560] (-773.703) -- 0:00:48
249000 -- (-773.234) [-775.797] (-775.572) (-775.573) * [-772.895] (-773.332) (-773.115) (-773.108) -- 0:00:48
249500 -- [-774.952] (-772.097) (-773.100) (-776.508) * (-771.699) (-775.759) [-773.743] (-772.261) -- 0:00:48
250000 -- (-782.049) (-772.051) (-772.538) [-773.776] * (-775.490) (-773.583) (-774.029) [-772.759] -- 0:00:48
Average standard deviation of split frequencies: 0.013290
250500 -- (-776.645) (-776.352) [-772.000] (-775.764) * (-774.859) (-778.433) [-774.247] (-775.569) -- 0:00:47
251000 -- (-776.842) (-772.314) (-774.137) [-775.035] * [-775.082] (-773.567) (-774.252) (-774.277) -- 0:00:47
251500 -- (-774.554) (-772.370) (-779.942) [-771.683] * (-772.192) (-775.367) [-775.223] (-774.932) -- 0:00:47
252000 -- (-775.348) (-773.737) (-774.998) [-771.898] * (-771.890) (-773.225) (-774.964) [-774.205] -- 0:00:47
252500 -- (-773.507) (-774.208) (-774.273) [-772.373] * (-773.069) [-772.901] (-772.257) (-776.332) -- 0:00:47
253000 -- [-772.064] (-774.060) (-775.458) (-772.933) * [-772.147] (-773.777) (-772.354) (-773.915) -- 0:00:47
253500 -- (-772.760) [-774.612] (-775.321) (-774.990) * (-778.520) [-773.507] (-773.468) (-777.631) -- 0:00:47
254000 -- (-777.291) (-772.967) [-773.821] (-775.386) * (-777.571) [-773.291] (-776.564) (-774.580) -- 0:00:46
254500 -- (-778.057) (-772.723) (-773.110) [-774.034] * (-775.205) [-771.819] (-773.903) (-776.915) -- 0:00:46
255000 -- (-776.245) (-777.327) (-772.864) [-773.485] * [-773.462] (-771.645) (-775.973) (-777.802) -- 0:00:46
Average standard deviation of split frequencies: 0.013749
255500 -- (-774.200) (-774.846) [-775.296] (-773.413) * [-772.256] (-771.998) (-772.999) (-776.950) -- 0:00:46
256000 -- (-773.770) (-777.666) (-772.668) [-772.849] * (-776.236) [-773.702] (-778.244) (-778.113) -- 0:00:46
256500 -- (-773.243) [-776.156] (-773.843) (-772.976) * (-772.174) (-772.558) [-777.321] (-774.426) -- 0:00:46
257000 -- (-773.175) (-773.843) (-773.813) [-772.255] * (-772.202) (-773.342) [-772.504] (-774.543) -- 0:00:46
257500 -- (-771.562) [-777.019] (-772.357) (-773.565) * [-771.999] (-773.150) (-772.433) (-776.016) -- 0:00:46
258000 -- (-772.358) (-777.791) (-773.310) [-771.979] * (-773.631) (-777.000) [-771.618] (-773.192) -- 0:00:46
258500 -- [-776.230] (-772.607) (-773.047) (-772.558) * (-774.417) [-771.655] (-771.634) (-774.378) -- 0:00:45
259000 -- (-777.054) (-772.421) [-771.484] (-771.691) * [-773.175] (-773.857) (-774.796) (-776.276) -- 0:00:45
259500 -- (-773.680) (-774.911) (-774.961) [-775.007] * (-774.888) (-773.291) (-773.168) [-772.597] -- 0:00:45
260000 -- (-775.050) [-774.329] (-775.823) (-774.000) * (-774.879) (-773.740) [-772.742] (-772.213) -- 0:00:45
Average standard deviation of split frequencies: 0.013021
260500 -- (-778.558) (-774.094) [-774.190] (-772.892) * (-774.731) (-774.115) (-776.132) [-772.542] -- 0:00:45
261000 -- (-776.823) [-772.786] (-772.873) (-771.815) * (-776.635) (-772.800) [-772.589] (-772.452) -- 0:00:45
261500 -- [-773.786] (-776.536) (-773.483) (-777.090) * (-773.151) [-772.129] (-776.302) (-786.530) -- 0:00:45
262000 -- (-773.150) (-775.554) (-775.946) [-774.909] * (-774.256) [-772.182] (-773.517) (-776.677) -- 0:00:47
262500 -- (-774.428) [-773.943] (-774.843) (-773.617) * (-774.227) (-774.538) [-775.154] (-773.113) -- 0:00:47
263000 -- (-773.745) (-776.485) (-776.740) [-774.054] * [-773.418] (-773.658) (-772.198) (-775.018) -- 0:00:47
263500 -- (-773.230) [-777.428] (-779.048) (-775.670) * (-777.452) (-772.782) (-774.382) [-773.595] -- 0:00:47
264000 -- (-778.531) [-774.497] (-774.838) (-773.644) * (-772.517) (-775.510) [-777.131] (-774.515) -- 0:00:47
264500 -- [-776.084] (-775.239) (-774.787) (-771.756) * (-774.151) (-773.948) [-779.863] (-772.311) -- 0:00:47
265000 -- (-776.374) [-776.091] (-780.077) (-773.136) * (-773.237) (-773.758) [-773.734] (-772.317) -- 0:00:47
Average standard deviation of split frequencies: 0.013291
265500 -- (-778.708) [-773.671] (-778.683) (-773.410) * (-773.243) (-771.945) (-773.918) [-777.676] -- 0:00:47
266000 -- (-773.186) (-773.483) (-774.080) [-772.691] * (-771.760) (-773.396) [-772.129] (-775.091) -- 0:00:46
266500 -- [-773.346] (-774.155) (-773.105) (-773.230) * (-773.180) (-777.405) [-772.648] (-780.107) -- 0:00:46
267000 -- (-773.119) [-771.831] (-773.580) (-772.772) * [-774.686] (-772.215) (-771.696) (-773.355) -- 0:00:46
267500 -- (-774.259) [-773.939] (-771.870) (-775.299) * (-772.821) [-773.218] (-772.969) (-772.216) -- 0:00:46
268000 -- (-773.995) [-773.144] (-774.101) (-773.604) * [-772.228] (-774.286) (-774.826) (-771.611) -- 0:00:46
268500 -- (-775.731) [-772.356] (-774.071) (-773.972) * (-774.113) [-772.184] (-776.483) (-772.595) -- 0:00:46
269000 -- (-772.934) [-773.420] (-774.185) (-772.724) * [-772.859] (-771.736) (-775.059) (-774.720) -- 0:00:46
269500 -- (-771.820) [-772.596] (-774.203) (-775.060) * (-780.261) (-771.776) (-773.549) [-775.136] -- 0:00:46
270000 -- (-774.294) [-773.323] (-776.235) (-777.247) * (-780.032) [-772.564] (-773.247) (-775.266) -- 0:00:45
Average standard deviation of split frequencies: 0.012909
270500 -- (-773.454) (-774.101) (-777.806) [-773.765] * (-774.548) (-771.791) [-773.804] (-772.749) -- 0:00:45
271000 -- (-772.472) (-773.144) [-777.392] (-773.296) * (-773.394) (-772.300) [-773.309] (-773.679) -- 0:00:45
271500 -- (-774.017) (-774.622) (-774.732) [-774.640] * [-773.715] (-771.568) (-773.377) (-774.764) -- 0:00:45
272000 -- (-774.377) (-774.360) (-776.865) [-772.747] * (-779.172) (-772.111) [-772.370] (-774.803) -- 0:00:45
272500 -- (-773.401) (-774.297) (-773.474) [-772.812] * (-777.411) [-772.827] (-771.752) (-774.506) -- 0:00:45
273000 -- [-777.301] (-773.154) (-775.162) (-773.095) * (-773.272) (-774.070) [-773.348] (-772.186) -- 0:00:45
273500 -- (-774.024) (-774.955) [-776.610] (-775.326) * (-774.062) [-772.081] (-772.703) (-774.999) -- 0:00:45
274000 -- (-774.310) (-772.903) [-771.730] (-775.498) * (-772.115) (-772.238) (-774.483) [-775.389] -- 0:00:45
274500 -- (-772.211) [-772.055] (-778.531) (-774.056) * (-773.352) (-771.850) (-772.082) [-774.917] -- 0:00:44
275000 -- (-775.376) [-773.588] (-773.342) (-773.510) * (-773.331) (-774.018) (-774.311) [-774.035] -- 0:00:44
Average standard deviation of split frequencies: 0.012917
275500 -- (-774.255) (-773.714) (-777.710) [-772.622] * (-774.587) (-776.345) (-777.940) [-775.463] -- 0:00:44
276000 -- (-775.568) (-776.496) [-773.088] (-774.149) * (-773.433) (-775.334) (-772.460) [-772.263] -- 0:00:44
276500 -- [-774.662] (-775.502) (-774.062) (-775.264) * (-774.220) (-775.471) [-771.985] (-775.021) -- 0:00:44
277000 -- [-773.080] (-774.773) (-775.928) (-774.416) * (-774.701) (-775.630) (-774.692) [-774.274] -- 0:00:44
277500 -- (-775.481) (-773.575) [-775.483] (-772.786) * (-772.985) (-779.757) (-775.979) [-775.147] -- 0:00:44
278000 -- (-773.543) (-774.673) [-774.212] (-773.570) * [-772.768] (-772.274) (-772.148) (-775.044) -- 0:00:44
278500 -- [-774.130] (-772.891) (-772.594) (-776.170) * (-775.287) [-773.086] (-780.531) (-775.550) -- 0:00:44
279000 -- (-774.456) (-775.021) (-772.648) [-772.977] * (-772.005) [-772.809] (-773.812) (-772.562) -- 0:00:46
279500 -- (-773.507) (-774.961) [-777.031] (-774.488) * [-776.956] (-773.735) (-775.666) (-776.725) -- 0:00:46
280000 -- (-772.921) (-773.552) (-773.619) [-775.205] * [-773.572] (-774.982) (-773.177) (-773.985) -- 0:00:46
Average standard deviation of split frequencies: 0.012282
280500 -- (-773.158) [-775.593] (-772.198) (-773.302) * (-775.706) (-774.045) [-772.028] (-774.106) -- 0:00:46
281000 -- (-771.571) (-776.171) [-773.333] (-775.766) * [-771.941] (-773.725) (-773.587) (-774.105) -- 0:00:46
281500 -- [-773.687] (-776.664) (-774.618) (-775.563) * (-774.492) [-774.614] (-773.326) (-772.188) -- 0:00:45
282000 -- (-774.884) (-776.035) (-774.018) [-774.871] * (-773.860) [-777.952] (-773.900) (-773.658) -- 0:00:45
282500 -- (-773.434) [-773.423] (-773.566) (-772.361) * (-774.438) (-772.595) [-774.608] (-772.851) -- 0:00:45
283000 -- (-773.666) (-772.190) [-776.549] (-775.996) * (-771.754) (-771.761) [-775.728] (-773.930) -- 0:00:45
283500 -- (-771.620) [-772.264] (-772.449) (-773.460) * (-772.655) (-771.802) [-772.481] (-775.073) -- 0:00:45
284000 -- (-775.011) [-774.701] (-774.791) (-778.292) * (-773.381) [-774.431] (-774.340) (-773.449) -- 0:00:45
284500 -- (-773.735) (-777.745) (-772.099) [-772.183] * (-774.440) [-772.696] (-772.040) (-773.397) -- 0:00:45
285000 -- (-772.644) [-772.057] (-774.740) (-774.275) * (-774.166) (-771.851) (-773.432) [-774.228] -- 0:00:45
Average standard deviation of split frequencies: 0.011080
285500 -- (-772.101) [-772.106] (-771.825) (-773.066) * (-774.000) (-772.103) (-775.256) [-773.483] -- 0:00:45
286000 -- (-772.531) [-776.407] (-772.165) (-773.853) * [-774.110] (-771.430) (-772.410) (-773.005) -- 0:00:44
286500 -- (-771.953) [-777.138] (-774.592) (-773.215) * [-775.065] (-773.512) (-771.826) (-773.149) -- 0:00:44
287000 -- (-775.127) (-774.469) [-773.668] (-781.902) * (-772.358) [-772.748] (-777.894) (-775.319) -- 0:00:44
287500 -- (-777.547) (-775.004) [-773.643] (-773.972) * (-776.279) (-773.199) (-776.835) [-774.134] -- 0:00:44
288000 -- (-772.150) [-772.528] (-772.025) (-774.721) * (-774.302) [-773.163] (-776.872) (-772.582) -- 0:00:44
288500 -- (-773.785) (-773.510) [-772.026] (-774.580) * (-775.212) [-776.447] (-772.086) (-774.297) -- 0:00:44
289000 -- [-773.315] (-776.137) (-773.513) (-775.499) * (-773.261) (-775.463) (-773.024) [-773.094] -- 0:00:44
289500 -- (-773.398) [-775.087] (-773.365) (-777.151) * [-772.989] (-775.155) (-772.107) (-773.025) -- 0:00:44
290000 -- (-772.268) (-774.438) (-776.468) [-775.606] * [-772.448] (-774.715) (-773.718) (-771.805) -- 0:00:44
Average standard deviation of split frequencies: 0.011623
290500 -- (-772.276) (-778.386) (-774.352) [-773.690] * (-772.708) (-773.000) [-774.065] (-771.749) -- 0:00:43
291000 -- (-772.212) (-772.105) [-773.314] (-773.957) * [-772.646] (-773.971) (-773.680) (-775.103) -- 0:00:43
291500 -- (-773.859) (-773.768) (-773.311) [-773.800] * (-772.792) (-772.358) (-772.854) [-772.252] -- 0:00:43
292000 -- (-773.431) [-772.263] (-773.800) (-772.129) * [-774.884] (-775.971) (-773.626) (-772.423) -- 0:00:43
292500 -- (-773.417) (-773.332) (-776.035) [-772.505] * [-773.272] (-774.486) (-775.179) (-774.619) -- 0:00:43
293000 -- [-772.182] (-772.876) (-772.422) (-774.472) * [-774.910] (-772.730) (-773.409) (-776.504) -- 0:00:43
293500 -- (-772.078) (-773.629) (-771.922) [-773.292] * (-772.309) [-776.040] (-772.889) (-772.860) -- 0:00:43
294000 -- (-773.440) (-772.974) (-775.225) [-772.176] * (-772.513) (-772.576) (-774.058) [-772.324] -- 0:00:43
294500 -- [-774.906] (-772.192) (-772.810) (-772.781) * [-775.015] (-773.076) (-773.240) (-776.059) -- 0:00:43
295000 -- [-774.269] (-772.739) (-772.861) (-772.057) * (-775.374) (-773.409) (-771.352) [-773.816] -- 0:00:43
Average standard deviation of split frequencies: 0.013115
295500 -- (-773.022) (-772.224) [-771.649] (-771.768) * (-775.021) (-773.182) [-774.778] (-774.268) -- 0:00:45
296000 -- (-773.775) [-774.224] (-771.621) (-772.494) * (-776.932) (-772.538) [-773.930] (-773.028) -- 0:00:45
296500 -- (-774.933) [-774.445] (-774.068) (-774.560) * (-777.584) (-777.610) [-772.232] (-772.068) -- 0:00:45
297000 -- (-778.731) (-774.234) [-773.038] (-773.099) * (-774.630) [-777.182] (-774.968) (-774.107) -- 0:00:44
297500 -- (-772.748) (-779.108) (-773.282) [-773.290] * [-772.080] (-776.508) (-774.176) (-776.305) -- 0:00:44
298000 -- (-775.760) [-772.799] (-773.225) (-773.366) * [-772.238] (-777.819) (-775.108) (-773.379) -- 0:00:44
298500 -- (-774.051) (-772.348) (-774.046) [-776.111] * (-773.415) (-774.382) [-776.306] (-773.258) -- 0:00:44
299000 -- (-774.395) [-772.784] (-775.276) (-773.883) * (-772.165) [-773.983] (-775.452) (-772.026) -- 0:00:44
299500 -- (-775.770) (-773.340) [-775.368] (-774.780) * (-772.612) (-775.280) (-774.820) [-771.975] -- 0:00:44
300000 -- [-778.917] (-771.548) (-773.475) (-774.355) * [-775.853] (-776.836) (-773.780) (-774.972) -- 0:00:44
Average standard deviation of split frequencies: 0.012445
300500 -- (-772.428) (-771.836) [-772.700] (-774.973) * (-777.497) [-776.206] (-773.821) (-774.314) -- 0:00:44
301000 -- [-771.621] (-772.994) (-774.310) (-775.017) * [-774.862] (-772.341) (-772.560) (-774.922) -- 0:00:44
301500 -- (-774.036) (-774.362) (-773.065) [-772.555] * [-774.294] (-774.817) (-777.261) (-775.322) -- 0:00:44
302000 -- (-774.576) (-772.701) (-774.117) [-771.964] * (-776.539) [-772.379] (-774.523) (-771.580) -- 0:00:43
302500 -- (-772.552) (-772.302) (-773.683) [-771.682] * [-774.731] (-774.108) (-775.135) (-772.802) -- 0:00:43
303000 -- (-774.672) [-772.024] (-774.378) (-772.214) * (-774.603) (-772.162) (-772.933) [-775.186] -- 0:00:43
303500 -- [-771.869] (-772.933) (-775.175) (-772.906) * (-774.445) (-772.456) (-775.493) [-771.532] -- 0:00:43
304000 -- (-772.986) (-774.294) [-772.648] (-774.623) * (-776.140) [-773.082] (-774.491) (-774.455) -- 0:00:43
304500 -- (-773.071) (-774.911) [-772.524] (-776.730) * [-773.728] (-776.029) (-771.869) (-773.138) -- 0:00:43
305000 -- [-772.703] (-773.227) (-777.805) (-782.720) * (-778.517) (-772.881) (-774.358) [-772.472] -- 0:00:43
Average standard deviation of split frequencies: 0.011843
305500 -- (-776.839) (-773.568) [-771.951] (-774.505) * (-775.078) (-772.690) (-773.311) [-772.714] -- 0:00:43
306000 -- (-775.520) (-772.821) [-773.692] (-775.073) * (-776.796) (-775.277) [-773.927] (-775.724) -- 0:00:43
306500 -- [-775.458] (-774.130) (-772.600) (-772.249) * [-771.858] (-772.681) (-772.814) (-771.801) -- 0:00:42
307000 -- (-772.808) (-773.369) (-772.748) [-772.225] * (-772.821) (-772.580) [-773.490] (-773.497) -- 0:00:42
307500 -- (-773.233) [-779.498] (-773.303) (-773.126) * (-773.464) (-776.958) (-772.919) [-773.511] -- 0:00:42
308000 -- [-773.569] (-774.749) (-773.899) (-775.189) * [-772.732] (-781.281) (-772.497) (-773.526) -- 0:00:42
308500 -- (-774.707) (-774.522) [-774.020] (-774.073) * (-775.395) (-774.926) (-772.038) [-772.406] -- 0:00:42
309000 -- [-774.895] (-774.753) (-775.569) (-773.552) * (-773.615) (-774.697) [-773.043] (-773.598) -- 0:00:42
309500 -- (-774.275) (-773.070) [-772.509] (-776.940) * [-772.692] (-773.316) (-776.581) (-775.719) -- 0:00:42
310000 -- [-772.468] (-775.088) (-771.698) (-773.292) * [-773.382] (-774.871) (-774.898) (-772.714) -- 0:00:42
Average standard deviation of split frequencies: 0.012050
310500 -- (-772.674) (-773.936) [-773.234] (-771.861) * [-771.999] (-774.934) (-774.837) (-776.561) -- 0:00:42
311000 -- [-774.188] (-776.784) (-772.823) (-774.622) * [-774.776] (-773.186) (-773.274) (-772.253) -- 0:00:42
311500 -- (-775.381) (-772.005) (-772.190) [-775.687] * (-772.673) [-775.953] (-774.325) (-772.562) -- 0:00:41
312000 -- (-772.684) [-773.120] (-774.048) (-772.452) * (-772.733) (-777.179) (-772.892) [-773.055] -- 0:00:41
312500 -- (-773.958) (-776.594) [-776.958] (-772.419) * [-773.021] (-775.912) (-771.771) (-776.229) -- 0:00:44
313000 -- (-773.835) (-775.204) (-773.662) [-773.218] * (-773.727) [-775.909] (-777.252) (-774.340) -- 0:00:43
313500 -- (-773.274) (-773.491) (-775.335) [-773.055] * (-774.110) (-775.063) (-772.580) [-772.317] -- 0:00:43
314000 -- (-772.480) (-773.531) [-774.416] (-772.083) * (-774.071) [-773.429] (-772.332) (-772.976) -- 0:00:43
314500 -- (-776.820) [-772.266] (-776.389) (-771.944) * (-772.816) (-772.335) (-772.270) [-773.353] -- 0:00:43
315000 -- (-776.746) [-773.872] (-776.538) (-773.236) * (-771.611) (-772.560) [-773.216] (-774.904) -- 0:00:43
Average standard deviation of split frequencies: 0.012461
315500 -- [-774.749] (-773.363) (-773.838) (-775.397) * [-774.225] (-775.904) (-773.178) (-774.853) -- 0:00:43
316000 -- (-772.604) (-773.440) [-773.003] (-773.643) * (-772.788) (-772.558) [-775.048] (-776.072) -- 0:00:43
316500 -- [-773.452] (-774.577) (-772.189) (-775.452) * (-773.144) (-776.784) (-773.805) [-776.342] -- 0:00:43
317000 -- (-773.490) [-774.035] (-771.878) (-776.134) * (-773.595) (-775.905) (-773.459) [-773.516] -- 0:00:43
317500 -- (-774.505) (-777.032) [-772.619] (-774.887) * (-776.412) [-773.565] (-773.334) (-772.431) -- 0:00:42
318000 -- [-771.939] (-773.669) (-772.519) (-773.469) * (-775.654) (-773.314) [-775.349] (-775.688) -- 0:00:42
318500 -- (-773.757) (-772.754) [-773.463] (-775.091) * (-780.880) (-773.850) [-772.478] (-778.657) -- 0:00:42
319000 -- [-774.845] (-778.235) (-781.722) (-772.563) * [-772.877] (-777.018) (-772.363) (-782.137) -- 0:00:42
319500 -- [-774.177] (-775.998) (-776.387) (-772.104) * [-772.683] (-776.083) (-777.247) (-775.797) -- 0:00:42
320000 -- (-773.346) [-771.689] (-776.703) (-776.423) * (-772.364) (-777.616) (-775.370) [-774.793] -- 0:00:42
Average standard deviation of split frequencies: 0.013317
320500 -- (-774.633) (-774.385) [-777.834] (-772.931) * [-771.665] (-775.219) (-775.994) (-775.228) -- 0:00:42
321000 -- (-773.493) (-777.009) (-777.008) [-773.949] * (-774.349) (-773.141) [-778.703] (-774.419) -- 0:00:42
321500 -- (-772.967) [-773.733] (-773.440) (-778.094) * (-776.135) (-771.990) [-781.599] (-772.682) -- 0:00:42
322000 -- (-772.682) (-774.797) (-772.494) [-773.533] * (-773.981) (-775.037) (-774.590) [-773.530] -- 0:00:42
322500 -- (-777.402) (-771.838) [-774.415] (-772.533) * [-772.383] (-774.379) (-772.428) (-773.210) -- 0:00:42
323000 -- (-772.446) (-775.162) (-774.476) [-774.481] * [-772.750] (-773.712) (-772.043) (-772.910) -- 0:00:41
323500 -- [-772.327] (-772.449) (-774.112) (-773.020) * [-774.637] (-773.992) (-771.743) (-772.680) -- 0:00:41
324000 -- (-771.928) (-773.651) (-776.865) [-773.127] * (-772.479) [-772.242] (-774.416) (-772.598) -- 0:00:41
324500 -- (-772.922) (-774.365) [-771.593] (-774.105) * (-773.697) [-772.260] (-772.506) (-774.568) -- 0:00:41
325000 -- [-772.597] (-774.653) (-774.451) (-777.656) * [-771.390] (-772.733) (-775.896) (-775.341) -- 0:00:41
Average standard deviation of split frequencies: 0.012504
325500 -- (-772.588) (-772.853) [-772.569] (-773.398) * (-773.654) (-776.880) [-773.035] (-774.681) -- 0:00:41
326000 -- [-772.667] (-771.464) (-772.363) (-773.968) * (-772.394) [-772.640] (-775.612) (-776.557) -- 0:00:41
326500 -- [-773.719] (-771.967) (-776.137) (-772.445) * (-772.582) [-771.631] (-773.070) (-771.587) -- 0:00:41
327000 -- (-774.939) (-773.104) (-778.802) [-775.731] * (-772.928) (-773.226) [-772.432] (-773.788) -- 0:00:41
327500 -- (-776.918) (-773.750) [-774.119] (-775.724) * (-773.344) [-776.674] (-774.134) (-775.147) -- 0:00:41
328000 -- [-772.675] (-775.805) (-771.506) (-776.399) * (-773.986) (-776.015) (-775.242) [-774.653] -- 0:00:40
328500 -- (-774.339) (-773.396) [-775.193] (-775.448) * (-776.153) (-775.657) (-775.807) [-771.663] -- 0:00:40
329000 -- (-772.403) (-773.627) [-774.995] (-775.166) * [-773.983] (-774.126) (-776.040) (-776.575) -- 0:00:42
329500 -- (-771.552) (-773.366) (-775.317) [-773.830] * (-774.280) [-775.504] (-774.222) (-773.700) -- 0:00:42
330000 -- [-772.695] (-775.531) (-775.504) (-776.892) * (-774.491) (-775.444) (-775.392) [-774.256] -- 0:00:42
Average standard deviation of split frequencies: 0.012593
330500 -- [-775.509] (-774.969) (-774.269) (-775.854) * (-774.751) [-773.136] (-772.824) (-772.705) -- 0:00:42
331000 -- (-775.782) (-772.001) [-773.703] (-774.810) * [-774.029] (-773.076) (-772.768) (-774.721) -- 0:00:42
331500 -- (-772.846) (-772.032) [-772.296] (-774.230) * [-772.797] (-773.064) (-773.293) (-775.645) -- 0:00:42
332000 -- (-773.553) (-777.539) [-771.705] (-774.220) * (-775.026) (-772.215) (-775.697) [-774.053] -- 0:00:42
332500 -- (-773.144) (-775.743) [-775.117] (-773.743) * [-775.975] (-771.709) (-773.015) (-773.274) -- 0:00:42
333000 -- (-778.847) (-775.813) [-774.595] (-773.229) * (-773.967) (-772.995) [-774.357] (-774.091) -- 0:00:42
333500 -- [-772.919] (-774.222) (-774.636) (-773.207) * (-773.590) [-773.373] (-772.960) (-772.037) -- 0:00:41
334000 -- [-772.869] (-773.411) (-771.908) (-773.089) * [-772.128] (-773.677) (-777.951) (-774.982) -- 0:00:41
334500 -- (-772.839) [-773.643] (-772.251) (-772.725) * [-771.864] (-774.662) (-775.070) (-779.041) -- 0:00:41
335000 -- [-774.853] (-776.606) (-772.357) (-772.490) * (-774.257) (-773.291) [-775.243] (-772.428) -- 0:00:41
Average standard deviation of split frequencies: 0.012276
335500 -- (-775.192) [-772.788] (-774.018) (-771.535) * (-773.409) (-772.047) (-772.462) [-775.024] -- 0:00:41
336000 -- [-774.353] (-775.319) (-775.087) (-771.850) * (-782.873) (-779.509) (-775.384) [-777.104] -- 0:00:41
336500 -- (-774.702) [-775.773] (-772.917) (-773.387) * (-776.320) (-773.384) (-775.335) [-774.470] -- 0:00:41
337000 -- (-772.853) [-776.856] (-775.249) (-772.248) * [-775.645] (-776.018) (-776.300) (-772.360) -- 0:00:41
337500 -- [-772.959] (-775.983) (-776.278) (-771.851) * (-774.804) (-775.837) [-775.435] (-772.589) -- 0:00:41
338000 -- (-771.620) [-773.612] (-775.735) (-773.380) * [-772.177] (-772.153) (-773.018) (-773.569) -- 0:00:41
338500 -- [-775.387] (-773.141) (-773.028) (-772.372) * (-774.640) (-779.570) (-776.044) [-774.587] -- 0:00:41
339000 -- [-774.419] (-772.674) (-777.352) (-773.385) * (-775.176) (-772.359) (-774.740) [-774.460] -- 0:00:40
339500 -- (-773.448) (-772.585) (-772.545) [-773.793] * (-772.280) [-773.039] (-772.972) (-772.878) -- 0:00:40
340000 -- (-772.859) [-772.485] (-773.417) (-773.299) * (-772.280) [-774.151] (-776.451) (-774.352) -- 0:00:40
Average standard deviation of split frequencies: 0.011676
340500 -- (-772.313) (-772.941) (-772.146) [-773.504] * (-774.356) [-773.659] (-773.513) (-773.298) -- 0:00:40
341000 -- (-777.004) [-773.282] (-772.869) (-774.262) * (-773.589) (-773.320) [-773.351] (-772.224) -- 0:00:40
341500 -- (-776.234) [-777.284] (-774.819) (-775.757) * (-774.711) (-773.075) [-772.780] (-773.892) -- 0:00:40
342000 -- (-774.434) [-775.159] (-775.165) (-772.513) * (-774.469) (-772.406) [-772.680] (-776.547) -- 0:00:40
342500 -- [-772.747] (-774.853) (-772.926) (-773.478) * (-773.415) [-775.752] (-775.209) (-771.496) -- 0:00:40
343000 -- (-775.944) (-776.102) (-771.869) [-774.128] * (-777.524) [-775.970] (-772.345) (-772.423) -- 0:00:40
343500 -- (-777.029) (-775.030) [-772.414] (-773.113) * (-776.459) (-773.984) (-771.777) [-771.906] -- 0:00:40
344000 -- (-773.986) [-774.916] (-772.851) (-775.649) * (-774.860) (-771.895) (-772.876) [-775.235] -- 0:00:40
344500 -- [-772.414] (-776.334) (-773.441) (-775.851) * [-777.109] (-773.489) (-773.887) (-773.126) -- 0:00:39
345000 -- (-773.201) [-773.886] (-772.611) (-775.412) * (-773.534) (-772.565) [-774.562] (-772.928) -- 0:00:39
Average standard deviation of split frequencies: 0.011701
345500 -- (-773.805) (-776.067) (-774.547) [-772.538] * (-773.093) [-772.791] (-777.238) (-778.379) -- 0:00:41
346000 -- [-773.387] (-773.419) (-774.922) (-773.044) * (-773.658) (-771.767) [-771.954] (-775.468) -- 0:00:41
346500 -- [-772.330] (-772.535) (-771.770) (-773.828) * (-771.918) [-771.366] (-771.994) (-774.051) -- 0:00:41
347000 -- [-775.067] (-774.347) (-772.996) (-772.303) * (-773.483) [-772.923] (-776.183) (-773.189) -- 0:00:41
347500 -- (-773.413) (-780.103) [-775.290] (-773.348) * (-776.949) (-773.746) [-773.339] (-773.644) -- 0:00:41
348000 -- (-773.219) (-773.520) [-772.902] (-773.381) * (-774.840) [-773.345] (-773.496) (-775.876) -- 0:00:41
348500 -- (-773.411) [-774.507] (-776.782) (-774.200) * (-777.579) (-774.835) [-771.728] (-773.597) -- 0:00:41
349000 -- (-774.813) (-772.763) (-776.526) [-771.844] * (-778.203) (-774.504) [-772.015] (-776.568) -- 0:00:41
349500 -- [-774.768] (-772.948) (-772.627) (-774.526) * [-773.293] (-773.045) (-775.852) (-774.075) -- 0:00:40
350000 -- (-777.477) (-773.088) (-775.203) [-777.019] * (-777.522) (-774.683) [-773.524] (-775.096) -- 0:00:40
Average standard deviation of split frequencies: 0.010517
350500 -- (-775.297) [-772.031] (-773.519) (-773.204) * [-775.729] (-775.573) (-773.966) (-775.154) -- 0:00:40
351000 -- (-774.156) (-773.789) (-783.951) [-774.004] * (-773.299) (-776.618) [-773.008] (-773.041) -- 0:00:40
351500 -- (-774.096) (-773.135) (-779.500) [-771.983] * [-776.808] (-773.271) (-775.112) (-774.729) -- 0:00:40
352000 -- (-773.483) [-772.576] (-772.818) (-773.817) * (-775.159) (-774.239) [-777.091] (-777.405) -- 0:00:40
352500 -- (-772.907) (-774.032) (-773.036) [-774.362] * [-775.940] (-772.363) (-772.474) (-772.253) -- 0:00:40
353000 -- (-773.454) (-774.292) (-775.218) [-773.735] * (-774.894) (-772.517) (-772.567) [-772.594] -- 0:00:40
353500 -- (-774.998) [-772.992] (-773.240) (-772.818) * [-772.144] (-775.813) (-773.219) (-771.719) -- 0:00:40
354000 -- (-778.608) (-772.356) [-772.995] (-777.507) * (-774.387) [-774.647] (-772.812) (-774.057) -- 0:00:40
354500 -- (-777.325) (-774.653) [-771.363] (-773.755) * (-775.828) (-772.969) [-772.601] (-771.769) -- 0:00:40
355000 -- (-778.041) [-779.030] (-773.307) (-776.343) * (-776.498) (-774.009) [-772.567] (-772.098) -- 0:00:39
Average standard deviation of split frequencies: 0.010671
355500 -- (-772.935) (-774.124) [-776.464] (-776.996) * (-780.940) [-773.987] (-772.146) (-772.247) -- 0:00:39
356000 -- (-772.838) (-774.374) [-778.143] (-777.460) * (-775.167) (-775.107) (-772.638) [-772.343] -- 0:00:39
356500 -- (-774.409) (-775.790) (-774.152) [-774.911] * [-776.054] (-777.155) (-773.488) (-775.674) -- 0:00:39
357000 -- [-774.214] (-775.821) (-772.797) (-777.142) * [-773.237] (-778.180) (-772.803) (-774.465) -- 0:00:39
357500 -- (-773.783) (-777.992) [-772.576] (-773.426) * (-776.587) (-773.108) (-774.633) [-774.768] -- 0:00:39
358000 -- (-775.742) (-776.088) (-775.839) [-773.296] * [-776.339] (-773.479) (-772.103) (-773.250) -- 0:00:39
358500 -- (-774.477) (-775.831) [-772.846] (-772.319) * (-774.224) (-772.878) [-773.687] (-772.769) -- 0:00:39
359000 -- (-772.732) (-773.212) [-771.674] (-774.267) * (-771.966) [-771.614] (-773.686) (-772.123) -- 0:00:39
359500 -- (-777.425) (-772.416) (-772.275) [-771.831] * (-772.714) [-771.793] (-772.757) (-772.802) -- 0:00:39
360000 -- (-775.789) [-774.225] (-773.098) (-772.895) * (-778.717) [-772.298] (-774.460) (-773.075) -- 0:00:39
Average standard deviation of split frequencies: 0.010764
360500 -- (-774.370) (-771.679) [-773.556] (-773.488) * (-779.230) (-773.442) [-773.655] (-774.620) -- 0:00:39
361000 -- (-773.585) (-771.684) (-772.163) [-772.320] * (-773.367) (-772.197) (-775.281) [-772.919] -- 0:00:38
361500 -- (-777.070) (-773.327) (-774.336) [-772.926] * (-772.749) (-773.137) [-775.104] (-773.980) -- 0:00:38
362000 -- [-776.039] (-775.864) (-771.922) (-774.735) * (-776.143) (-773.018) [-774.009] (-772.900) -- 0:00:38
362500 -- (-780.677) (-773.567) [-772.945] (-774.973) * [-772.273] (-776.105) (-773.273) (-772.335) -- 0:00:40
363000 -- [-773.713] (-772.884) (-772.773) (-772.727) * [-772.593] (-773.812) (-772.612) (-773.743) -- 0:00:40
363500 -- (-773.711) (-774.439) (-772.217) [-773.736] * (-772.418) (-774.026) [-771.747] (-774.494) -- 0:00:40
364000 -- (-775.844) (-776.048) [-774.751] (-774.000) * (-776.103) (-777.325) (-771.775) [-776.803] -- 0:00:40
364500 -- (-773.279) (-775.739) [-772.867] (-775.012) * (-773.465) (-777.338) (-774.859) [-772.422] -- 0:00:40
365000 -- [-772.344] (-772.648) (-773.534) (-774.952) * (-772.530) (-774.291) (-776.808) [-776.207] -- 0:00:40
Average standard deviation of split frequencies: 0.010683
365500 -- (-772.179) (-775.842) (-774.817) [-773.033] * (-771.758) [-773.649] (-772.875) (-774.425) -- 0:00:39
366000 -- [-773.794] (-777.645) (-773.350) (-773.890) * [-772.714] (-773.120) (-773.022) (-772.618) -- 0:00:39
366500 -- (-772.541) (-777.688) (-773.519) [-774.050] * (-776.011) (-775.309) (-772.374) [-774.041] -- 0:00:39
367000 -- (-772.156) (-771.864) [-772.554] (-774.542) * (-777.099) (-775.794) (-775.334) [-772.205] -- 0:00:39
367500 -- (-775.357) [-772.560] (-771.308) (-776.095) * (-771.769) (-776.099) [-776.601] (-772.221) -- 0:00:39
368000 -- (-775.945) (-772.914) [-774.592] (-775.568) * (-772.718) (-775.921) [-774.051] (-774.850) -- 0:00:39
368500 -- (-775.702) [-771.884] (-772.633) (-780.954) * (-776.871) [-772.884] (-778.149) (-773.901) -- 0:00:39
369000 -- (-771.829) [-775.086] (-772.004) (-774.610) * (-777.425) [-772.450] (-776.551) (-773.079) -- 0:00:39
369500 -- [-772.830] (-772.318) (-772.326) (-775.979) * (-773.605) (-773.152) [-778.991] (-775.746) -- 0:00:39
370000 -- (-772.966) [-772.816] (-773.884) (-773.732) * [-776.411] (-774.644) (-776.584) (-776.123) -- 0:00:39
Average standard deviation of split frequencies: 0.010399
370500 -- (-772.897) (-773.125) (-775.505) [-774.681] * [-774.674] (-774.644) (-771.776) (-774.475) -- 0:00:39
371000 -- (-772.473) [-774.919] (-773.700) (-771.775) * (-772.827) (-772.397) (-773.243) [-771.872] -- 0:00:38
371500 -- (-774.470) (-776.068) (-773.551) [-771.488] * (-772.147) (-774.360) [-771.998] (-773.698) -- 0:00:38
372000 -- [-774.013] (-778.995) (-775.304) (-771.452) * [-777.006] (-777.239) (-773.324) (-775.575) -- 0:00:38
372500 -- [-771.730] (-774.659) (-774.464) (-776.784) * (-775.879) (-773.169) [-776.087] (-775.429) -- 0:00:38
373000 -- (-772.562) [-774.010] (-773.516) (-778.828) * (-773.776) (-774.840) [-774.470] (-773.296) -- 0:00:38
373500 -- [-773.122] (-773.366) (-772.631) (-779.748) * (-773.453) [-775.343] (-773.703) (-773.825) -- 0:00:38
374000 -- (-772.050) (-780.272) [-772.924] (-776.065) * (-774.170) (-774.372) [-773.474] (-773.530) -- 0:00:38
374500 -- [-774.360] (-772.273) (-772.267) (-772.500) * (-773.896) (-773.399) (-775.841) [-772.554] -- 0:00:38
375000 -- (-773.821) [-773.412] (-774.231) (-777.113) * [-772.162] (-772.073) (-774.014) (-773.006) -- 0:00:38
Average standard deviation of split frequencies: 0.009587
375500 -- [-775.584] (-772.396) (-773.259) (-778.465) * (-772.965) [-774.116] (-773.176) (-772.030) -- 0:00:38
376000 -- (-775.358) [-772.074] (-771.810) (-772.962) * (-772.031) (-774.671) [-773.923] (-774.626) -- 0:00:38
376500 -- (-780.362) [-776.481] (-773.535) (-775.364) * (-772.628) [-774.172] (-777.633) (-772.360) -- 0:00:38
377000 -- (-771.829) (-777.571) (-771.757) [-773.922] * (-775.500) (-773.681) (-776.022) [-773.606] -- 0:00:38
377500 -- (-773.170) [-773.149] (-774.930) (-772.272) * (-775.025) (-774.660) (-772.319) [-771.480] -- 0:00:37
378000 -- (-773.709) (-775.084) (-773.904) [-772.389] * (-774.049) (-775.112) [-771.822] (-773.862) -- 0:00:37
378500 -- (-776.759) [-773.330] (-773.265) (-771.974) * (-773.562) [-773.048] (-773.888) (-772.607) -- 0:00:37
379000 -- [-774.688] (-771.705) (-775.349) (-771.739) * (-774.206) (-774.322) (-775.949) [-773.877] -- 0:00:39
379500 -- [-774.938] (-774.175) (-776.894) (-773.989) * (-772.549) (-773.054) [-775.030] (-777.627) -- 0:00:39
380000 -- [-773.836] (-774.032) (-777.063) (-776.055) * (-772.837) (-777.700) (-774.584) [-772.596] -- 0:00:39
Average standard deviation of split frequencies: 0.009834
380500 -- [-772.143] (-775.878) (-778.442) (-774.988) * (-774.611) (-771.772) (-775.726) [-772.961] -- 0:00:39
381000 -- (-771.812) [-774.665] (-774.067) (-771.863) * (-778.999) (-772.115) [-772.003] (-774.724) -- 0:00:38
381500 -- (-771.536) (-771.616) [-776.305] (-772.991) * [-773.601] (-773.139) (-774.568) (-773.895) -- 0:00:38
382000 -- (-773.668) [-772.817] (-777.810) (-772.049) * (-774.248) [-773.521] (-772.085) (-775.500) -- 0:00:38
382500 -- (-772.993) [-774.181] (-776.431) (-777.603) * [-772.979] (-779.789) (-772.943) (-773.873) -- 0:00:38
383000 -- (-773.128) (-774.189) [-773.134] (-777.851) * (-773.782) [-774.347] (-774.578) (-774.472) -- 0:00:38
383500 -- (-773.271) (-773.432) [-773.391] (-775.834) * [-771.675] (-777.291) (-774.188) (-778.241) -- 0:00:38
384000 -- (-776.378) [-773.390] (-771.837) (-776.094) * (-772.047) (-772.811) [-774.072] (-771.679) -- 0:00:38
384500 -- (-781.019) (-775.968) (-772.337) [-775.827] * (-773.342) (-773.195) (-774.738) [-775.366] -- 0:00:38
385000 -- [-772.608] (-776.318) (-771.799) (-775.543) * (-774.682) (-774.670) [-773.898] (-773.877) -- 0:00:38
Average standard deviation of split frequencies: 0.009914
385500 -- [-772.282] (-775.981) (-775.127) (-773.675) * (-776.684) [-773.480] (-774.322) (-779.361) -- 0:00:38
386000 -- [-772.083] (-776.041) (-774.103) (-772.093) * (-775.398) (-772.583) (-774.829) [-772.646] -- 0:00:38
386500 -- (-773.610) (-779.603) [-774.902] (-771.781) * [-773.160] (-773.003) (-774.641) (-772.564) -- 0:00:38
387000 -- [-773.479] (-772.378) (-778.013) (-774.709) * (-772.668) [-772.218] (-772.516) (-780.753) -- 0:00:38
387500 -- (-772.153) (-772.965) [-773.318] (-775.665) * (-772.824) (-773.939) (-777.768) [-772.306] -- 0:00:37
388000 -- (-771.873) (-774.086) [-772.252] (-775.724) * (-774.131) [-772.593] (-772.779) (-773.506) -- 0:00:37
388500 -- [-773.327] (-772.318) (-773.614) (-773.209) * (-771.844) [-773.444] (-772.784) (-773.771) -- 0:00:37
389000 -- (-774.400) (-773.149) (-774.415) [-774.868] * (-773.806) (-774.984) [-773.227] (-773.625) -- 0:00:37
389500 -- [-775.362] (-773.177) (-772.290) (-773.620) * [-774.199] (-772.911) (-774.221) (-775.890) -- 0:00:37
390000 -- (-774.170) [-772.358] (-771.851) (-773.140) * [-774.908] (-773.814) (-775.969) (-773.731) -- 0:00:37
Average standard deviation of split frequencies: 0.009795
390500 -- (-774.349) [-773.867] (-772.083) (-772.924) * (-772.590) [-778.353] (-773.242) (-775.205) -- 0:00:37
391000 -- (-773.843) (-773.766) [-772.619] (-775.134) * (-773.321) (-773.218) [-774.277] (-772.505) -- 0:00:37
391500 -- (-774.721) (-778.442) [-771.594] (-774.624) * [-773.196] (-776.289) (-772.634) (-772.265) -- 0:00:37
392000 -- [-775.021] (-775.050) (-771.596) (-773.123) * (-776.248) (-774.529) [-773.547] (-773.765) -- 0:00:37
392500 -- (-775.557) [-773.411] (-777.259) (-772.701) * (-772.612) (-773.734) (-773.603) [-772.629] -- 0:00:37
393000 -- [-771.996] (-774.008) (-772.434) (-777.273) * (-772.237) (-773.516) [-772.628] (-772.130) -- 0:00:37
393500 -- (-779.391) (-775.254) [-773.444] (-775.119) * [-773.591] (-773.258) (-772.411) (-774.343) -- 0:00:36
394000 -- (-772.729) [-772.939] (-774.078) (-773.416) * (-775.412) (-773.116) (-773.774) [-776.857] -- 0:00:36
394500 -- (-772.749) (-773.383) [-773.260] (-774.400) * (-776.018) (-776.464) (-775.179) [-776.934] -- 0:00:36
395000 -- (-773.986) (-773.116) [-773.917] (-774.006) * (-773.218) [-775.891] (-773.873) (-776.932) -- 0:00:36
Average standard deviation of split frequencies: 0.010644
395500 -- (-772.956) [-772.862] (-771.842) (-775.431) * (-771.862) (-772.811) (-774.907) [-775.000] -- 0:00:38
396000 -- [-777.605] (-773.994) (-777.342) (-772.806) * (-773.212) [-775.698] (-775.712) (-778.850) -- 0:00:38
396500 -- [-773.386] (-774.654) (-775.598) (-778.610) * (-772.467) [-776.538] (-775.388) (-780.479) -- 0:00:38
397000 -- (-772.327) [-773.437] (-774.879) (-778.985) * (-773.909) [-772.148] (-771.666) (-772.883) -- 0:00:37
397500 -- (-772.854) (-773.109) [-772.202] (-774.210) * (-772.053) (-771.654) [-773.974] (-774.428) -- 0:00:37
398000 -- (-774.413) (-777.328) (-774.358) [-776.922] * (-772.677) (-773.595) [-773.512] (-775.450) -- 0:00:37
398500 -- [-774.695] (-775.973) (-774.371) (-781.222) * (-777.326) (-775.381) [-773.844] (-774.922) -- 0:00:37
399000 -- (-774.428) (-772.757) (-774.941) [-776.212] * [-772.539] (-774.226) (-773.864) (-775.441) -- 0:00:37
399500 -- (-774.020) [-772.515] (-778.393) (-780.740) * [-771.856] (-772.636) (-776.824) (-774.484) -- 0:00:37
400000 -- [-773.033] (-772.412) (-775.745) (-779.162) * (-772.924) (-774.015) (-774.058) [-773.678] -- 0:00:37
Average standard deviation of split frequencies: 0.011143
400500 -- [-775.560] (-774.021) (-776.129) (-775.543) * [-773.054] (-772.421) (-772.823) (-778.267) -- 0:00:37
401000 -- (-774.699) [-773.443] (-773.518) (-776.450) * (-772.954) (-773.080) (-774.283) [-771.686] -- 0:00:37
401500 -- (-773.764) (-773.636) [-772.396] (-775.173) * [-774.180] (-772.682) (-772.935) (-771.453) -- 0:00:37
402000 -- (-774.543) (-772.694) (-772.555) [-774.458] * [-771.902] (-772.857) (-776.020) (-777.445) -- 0:00:37
402500 -- (-774.433) (-772.391) [-773.098] (-772.836) * (-771.830) (-772.322) [-772.086] (-775.344) -- 0:00:37
403000 -- (-775.299) [-772.695] (-772.590) (-773.332) * [-771.403] (-772.323) (-775.425) (-772.148) -- 0:00:37
403500 -- (-775.354) (-772.559) [-774.531] (-772.223) * (-773.317) (-774.300) [-773.300] (-773.590) -- 0:00:36
404000 -- (-776.687) [-773.782] (-777.095) (-773.579) * (-773.980) (-775.620) (-772.827) [-776.657] -- 0:00:36
404500 -- (-774.711) [-773.743] (-772.761) (-775.416) * (-771.973) (-773.148) [-773.743] (-778.801) -- 0:00:36
405000 -- (-772.974) (-775.069) (-775.191) [-774.075] * (-773.427) (-772.237) [-772.451] (-777.658) -- 0:00:36
Average standard deviation of split frequencies: 0.010791
405500 -- (-774.663) (-777.734) [-772.953] (-772.817) * (-772.574) (-772.671) (-773.905) [-773.607] -- 0:00:36
406000 -- (-774.820) [-773.825] (-773.619) (-774.491) * (-772.280) (-774.074) [-772.574] (-772.636) -- 0:00:36
406500 -- [-774.174] (-775.335) (-771.819) (-776.917) * (-772.024) (-772.592) [-772.312] (-774.416) -- 0:00:36
407000 -- (-775.387) (-774.274) (-772.527) [-774.998] * (-771.992) (-774.684) (-772.399) [-777.400] -- 0:00:36
407500 -- (-772.894) (-774.862) [-776.585] (-774.328) * [-775.164] (-774.625) (-773.750) (-773.416) -- 0:00:36
408000 -- (-773.697) (-773.880) [-773.395] (-773.624) * (-781.879) [-774.028] (-774.174) (-772.378) -- 0:00:36
408500 -- (-774.466) [-773.928] (-777.310) (-774.569) * (-777.428) (-774.810) (-777.655) [-772.760] -- 0:00:36
409000 -- (-772.464) (-771.787) [-774.885] (-774.137) * (-772.308) (-773.307) [-772.573] (-775.151) -- 0:00:36
409500 -- (-778.113) [-772.408] (-774.502) (-774.428) * [-773.105] (-772.615) (-773.162) (-774.387) -- 0:00:36
410000 -- (-774.115) [-772.283] (-773.564) (-773.717) * (-774.691) [-773.427] (-777.028) (-771.931) -- 0:00:35
Average standard deviation of split frequencies: 0.009656
410500 -- [-778.327] (-771.983) (-777.477) (-773.394) * (-778.312) (-775.294) (-774.074) [-771.832] -- 0:00:35
411000 -- (-781.582) [-773.095] (-777.404) (-775.844) * [-772.978] (-774.664) (-776.609) (-775.231) -- 0:00:35
411500 -- (-777.684) [-772.578] (-775.417) (-773.550) * [-773.821] (-774.801) (-774.049) (-772.609) -- 0:00:35
412000 -- [-775.821] (-772.933) (-776.178) (-774.631) * (-776.865) (-774.127) (-775.100) [-772.497] -- 0:00:35
412500 -- (-777.450) [-772.547] (-773.799) (-773.238) * (-774.495) (-774.271) [-773.169] (-776.804) -- 0:00:37
413000 -- (-776.186) [-773.793] (-772.376) (-778.452) * (-774.425) (-774.383) [-772.840] (-775.613) -- 0:00:36
413500 -- [-772.836] (-776.560) (-773.685) (-773.323) * (-772.956) (-772.458) (-773.073) [-773.137] -- 0:00:36
414000 -- (-773.418) [-775.109] (-772.401) (-773.147) * (-774.801) [-773.795] (-773.457) (-772.725) -- 0:00:36
414500 -- [-774.821] (-772.179) (-772.997) (-774.934) * (-772.171) [-773.231] (-771.663) (-773.464) -- 0:00:36
415000 -- (-777.522) (-780.605) [-776.640] (-773.484) * [-771.931] (-778.305) (-771.663) (-778.069) -- 0:00:36
Average standard deviation of split frequencies: 0.008799
415500 -- (-777.277) (-782.812) (-771.862) [-772.675] * (-772.963) (-772.860) [-772.589] (-772.593) -- 0:00:36
416000 -- (-776.234) (-773.676) (-772.465) [-772.238] * (-772.597) (-773.095) (-777.023) [-774.286] -- 0:00:36
416500 -- (-772.950) (-779.829) [-774.943] (-772.299) * (-773.084) (-774.061) (-775.044) [-772.863] -- 0:00:36
417000 -- [-774.138] (-771.871) (-775.028) (-774.862) * [-772.712] (-775.296) (-774.246) (-772.243) -- 0:00:36
417500 -- (-772.900) (-772.147) (-773.253) [-772.568] * (-772.974) (-779.236) [-775.913] (-773.133) -- 0:00:36
418000 -- (-771.741) (-772.803) [-774.672] (-772.633) * (-773.290) [-771.933] (-773.836) (-773.457) -- 0:00:36
418500 -- (-772.763) (-772.889) [-776.169] (-772.770) * [-773.040] (-773.373) (-773.213) (-775.807) -- 0:00:36
419000 -- (-773.135) [-776.613] (-774.596) (-773.859) * (-774.164) (-776.742) [-773.256] (-778.532) -- 0:00:36
419500 -- (-772.855) [-773.542] (-774.345) (-774.094) * (-774.302) (-778.222) [-773.398] (-775.615) -- 0:00:35
420000 -- [-774.913] (-774.013) (-774.833) (-772.584) * [-772.833] (-774.695) (-775.538) (-774.829) -- 0:00:35
Average standard deviation of split frequencies: 0.008833
420500 -- (-774.958) (-774.335) [-773.422] (-774.856) * (-771.739) (-773.895) [-774.533] (-777.054) -- 0:00:35
421000 -- [-774.361] (-775.673) (-778.492) (-773.789) * (-771.583) (-773.165) (-772.125) [-772.845] -- 0:00:35
421500 -- (-774.566) [-771.632] (-780.682) (-774.917) * [-776.863] (-771.868) (-772.329) (-777.334) -- 0:00:35
422000 -- (-772.903) (-773.771) [-775.532] (-776.462) * (-772.787) (-772.503) (-772.336) [-776.664] -- 0:00:35
422500 -- (-774.235) (-772.879) (-776.036) [-773.519] * [-771.772] (-771.617) (-774.170) (-772.740) -- 0:00:35
423000 -- (-771.640) [-772.171] (-775.711) (-773.806) * (-776.221) [-772.242] (-773.248) (-772.548) -- 0:00:35
423500 -- (-772.911) (-774.073) (-772.278) [-772.421] * (-776.700) [-771.886] (-778.994) (-772.050) -- 0:00:35
424000 -- (-773.271) (-775.865) (-772.537) [-771.847] * (-772.310) (-772.250) [-772.056] (-773.221) -- 0:00:35
424500 -- (-774.468) (-773.394) [-779.015] (-773.640) * (-775.748) (-774.747) [-773.011] (-772.811) -- 0:00:35
425000 -- (-773.671) (-771.854) (-776.032) [-777.221] * [-772.546] (-774.490) (-772.341) (-776.837) -- 0:00:35
Average standard deviation of split frequencies: 0.007876
425500 -- (-774.685) [-771.751] (-777.631) (-778.677) * (-775.262) (-776.870) [-772.430] (-773.071) -- 0:00:35
426000 -- (-773.435) (-775.183) [-776.417] (-773.746) * (-772.142) (-773.477) (-774.988) [-772.964] -- 0:00:35
426500 -- (-772.958) (-774.645) (-775.681) [-773.429] * (-773.031) [-772.627] (-772.916) (-773.752) -- 0:00:34
427000 -- (-772.608) (-773.772) [-774.162] (-774.706) * (-774.596) [-773.477] (-775.467) (-775.283) -- 0:00:34
427500 -- (-774.658) (-776.006) (-773.588) [-772.346] * [-772.260] (-776.337) (-777.028) (-776.681) -- 0:00:34
428000 -- [-774.497] (-771.980) (-775.572) (-776.479) * (-775.031) (-773.447) (-771.533) [-776.429] -- 0:00:34
428500 -- (-774.456) (-772.181) (-777.292) [-779.104] * (-774.920) (-774.003) [-771.603] (-775.869) -- 0:00:34
429000 -- [-773.373] (-773.381) (-772.464) (-773.471) * (-774.505) [-774.000] (-772.380) (-774.963) -- 0:00:35
429500 -- (-773.100) (-773.008) [-772.000] (-773.091) * (-775.700) (-775.771) [-772.467] (-773.960) -- 0:00:35
430000 -- [-771.888] (-772.862) (-772.346) (-773.830) * [-776.576] (-776.332) (-776.294) (-773.575) -- 0:00:35
Average standard deviation of split frequencies: 0.007662
430500 -- [-771.823] (-773.689) (-774.131) (-774.785) * (-778.020) (-773.218) [-774.980] (-774.624) -- 0:00:35
431000 -- (-774.752) (-772.916) (-772.395) [-772.155] * (-773.602) [-772.167] (-771.967) (-779.100) -- 0:00:35
431500 -- (-776.970) (-773.807) [-772.839] (-774.580) * (-775.767) [-772.573] (-772.689) (-774.552) -- 0:00:35
432000 -- [-771.565] (-773.438) (-771.722) (-774.381) * [-774.451] (-772.549) (-775.269) (-775.730) -- 0:00:35
432500 -- (-773.177) [-772.385] (-772.251) (-774.237) * (-775.084) [-771.682] (-774.369) (-778.825) -- 0:00:35
433000 -- (-773.942) (-771.911) (-777.281) [-772.496] * (-775.208) (-771.577) [-776.932] (-774.268) -- 0:00:35
433500 -- (-773.809) (-776.453) [-773.446] (-772.064) * (-772.627) (-771.669) (-776.938) [-772.787] -- 0:00:35
434000 -- [-772.466] (-772.443) (-773.036) (-772.226) * (-771.983) [-773.078] (-775.169) (-775.046) -- 0:00:35
434500 -- [-771.855] (-776.834) (-772.951) (-772.684) * [-776.696] (-774.728) (-774.901) (-774.629) -- 0:00:35
435000 -- (-772.037) [-773.395] (-774.583) (-774.039) * [-772.412] (-775.635) (-774.859) (-774.500) -- 0:00:35
Average standard deviation of split frequencies: 0.007886
435500 -- (-774.263) (-772.650) (-777.174) [-772.006] * (-774.810) (-774.104) (-773.489) [-774.754] -- 0:00:34
436000 -- (-774.561) (-772.004) [-772.721] (-775.567) * (-773.457) [-774.720] (-774.207) (-773.603) -- 0:00:34
436500 -- (-772.204) (-775.223) [-773.169] (-772.559) * (-773.190) [-773.183] (-771.800) (-772.701) -- 0:00:34
437000 -- (-773.143) (-775.921) (-773.740) [-773.104] * (-775.877) (-771.925) [-771.629] (-774.322) -- 0:00:34
437500 -- (-773.265) (-775.897) [-773.501] (-775.167) * [-774.919] (-773.048) (-772.596) (-772.573) -- 0:00:34
438000 -- [-777.406] (-773.868) (-773.833) (-776.653) * (-774.374) (-773.738) [-774.133] (-772.317) -- 0:00:34
438500 -- (-776.853) (-773.401) [-772.701] (-778.056) * (-775.231) (-774.939) (-776.785) [-778.154] -- 0:00:34
439000 -- (-772.994) [-775.640] (-775.867) (-777.369) * (-772.308) (-775.569) [-773.016] (-773.971) -- 0:00:34
439500 -- (-772.423) [-775.313] (-773.932) (-773.637) * (-772.691) (-772.937) [-774.221] (-772.925) -- 0:00:34
440000 -- [-775.413] (-773.664) (-774.392) (-775.436) * [-772.257] (-771.715) (-776.037) (-773.693) -- 0:00:34
Average standard deviation of split frequencies: 0.008432
440500 -- (-773.298) [-772.339] (-776.212) (-773.250) * (-772.882) [-772.453] (-774.216) (-771.580) -- 0:00:34
441000 -- (-772.591) (-775.874) (-776.041) [-774.535] * (-773.742) (-772.520) (-776.612) [-772.039] -- 0:00:34
441500 -- (-773.710) (-773.488) (-772.528) [-773.811] * [-774.102] (-775.296) (-775.700) (-773.256) -- 0:00:34
442000 -- [-773.586] (-774.085) (-771.832) (-774.797) * (-775.007) (-773.636) (-774.292) [-772.163] -- 0:00:34
442500 -- (-772.918) (-772.957) [-773.467] (-775.173) * (-773.322) (-771.490) [-773.050] (-773.053) -- 0:00:34
443000 -- (-771.906) (-774.442) (-772.804) [-774.752] * (-772.869) (-773.735) [-777.963] (-772.482) -- 0:00:33
443500 -- (-773.361) [-774.827] (-775.131) (-773.023) * (-772.829) (-774.183) (-774.470) [-772.970] -- 0:00:33
444000 -- (-775.655) (-771.756) [-773.438] (-771.507) * [-772.911] (-774.967) (-771.906) (-775.778) -- 0:00:33
444500 -- (-774.571) [-772.066] (-773.752) (-772.511) * (-774.987) [-774.421] (-778.445) (-773.187) -- 0:00:33
445000 -- (-774.212) (-773.426) [-775.848] (-772.776) * [-772.407] (-772.566) (-772.939) (-772.453) -- 0:00:33
Average standard deviation of split frequencies: 0.008331
445500 -- (-774.792) (-774.437) [-773.214] (-773.886) * (-773.920) (-774.891) (-772.548) [-772.294] -- 0:00:33
446000 -- (-775.045) [-776.647] (-776.052) (-774.527) * (-777.944) (-777.400) (-773.494) [-778.921] -- 0:00:34
446500 -- (-779.760) [-773.173] (-775.038) (-778.356) * (-773.002) (-777.216) [-772.023] (-773.185) -- 0:00:34
447000 -- (-773.838) (-774.212) (-773.158) [-779.954] * [-773.358] (-774.377) (-778.203) (-775.054) -- 0:00:34
447500 -- (-774.305) [-773.786] (-771.693) (-780.561) * (-771.873) (-772.359) (-772.474) [-773.625] -- 0:00:34
448000 -- (-773.282) (-776.705) [-772.655] (-777.020) * (-772.736) [-771.899] (-774.380) (-773.479) -- 0:00:34
448500 -- (-775.346) (-777.836) (-777.035) [-773.806] * [-773.455] (-773.602) (-775.279) (-775.035) -- 0:00:34
449000 -- (-772.767) (-772.883) (-775.666) [-776.293] * (-773.301) [-774.409] (-773.568) (-773.088) -- 0:00:34
449500 -- [-775.331] (-772.927) (-773.572) (-773.147) * (-774.292) [-774.658] (-773.710) (-772.885) -- 0:00:34
450000 -- (-774.664) (-772.811) (-775.579) [-773.119] * (-776.118) (-775.602) (-773.263) [-774.999] -- 0:00:34
Average standard deviation of split frequencies: 0.008307
450500 -- (-772.119) (-774.598) (-776.363) [-774.460] * [-772.893] (-775.758) (-772.113) (-771.730) -- 0:00:34
451000 -- (-772.816) (-773.113) [-772.755] (-775.520) * (-772.441) [-773.601] (-772.566) (-775.862) -- 0:00:34
451500 -- (-776.523) (-776.231) (-774.960) [-775.874] * (-772.287) (-776.143) (-772.915) [-773.528] -- 0:00:34
452000 -- (-776.095) (-773.261) (-772.582) [-772.606] * [-772.535] (-775.904) (-773.514) (-778.012) -- 0:00:33
452500 -- (-776.083) [-772.377] (-772.701) (-771.873) * (-773.284) [-775.665] (-772.653) (-774.216) -- 0:00:33
453000 -- (-773.231) [-774.806] (-776.149) (-772.988) * (-773.525) (-772.492) [-776.076] (-774.104) -- 0:00:33
453500 -- (-776.240) [-773.789] (-777.062) (-772.010) * (-772.853) (-772.238) (-776.278) [-772.440] -- 0:00:33
454000 -- (-772.634) [-773.313] (-774.908) (-778.064) * (-771.654) (-773.194) [-773.486] (-773.664) -- 0:00:33
454500 -- [-772.856] (-774.341) (-772.445) (-778.024) * (-773.209) (-772.785) (-772.646) [-779.245] -- 0:00:33
455000 -- (-774.944) (-776.391) (-774.781) [-775.340] * (-772.187) (-775.401) (-772.688) [-775.618] -- 0:00:33
Average standard deviation of split frequencies: 0.007601
455500 -- (-779.963) (-775.399) (-773.189) [-772.666] * (-772.534) (-775.188) (-773.616) [-774.751] -- 0:00:33
456000 -- [-773.358] (-776.454) (-772.766) (-772.970) * [-773.517] (-773.602) (-773.497) (-773.208) -- 0:00:33
456500 -- (-774.263) (-772.659) (-772.830) [-773.195] * [-772.855] (-774.086) (-771.536) (-774.196) -- 0:00:33
457000 -- [-773.197] (-772.467) (-773.869) (-771.752) * (-774.702) [-774.057] (-771.805) (-773.686) -- 0:00:33
457500 -- (-774.646) [-773.855] (-774.380) (-774.752) * [-777.388] (-771.754) (-772.504) (-771.520) -- 0:00:33
458000 -- (-774.370) (-774.527) [-774.301] (-774.939) * [-773.771] (-775.685) (-771.879) (-773.151) -- 0:00:33
458500 -- [-773.929] (-776.132) (-773.367) (-774.694) * (-772.131) (-773.684) (-773.165) [-773.344] -- 0:00:33
459000 -- (-774.883) [-773.609] (-774.053) (-774.007) * [-773.086] (-773.204) (-774.614) (-772.347) -- 0:00:33
459500 -- (-774.338) (-772.574) (-775.937) [-773.124] * (-772.817) (-773.847) (-777.998) [-771.983] -- 0:00:32
460000 -- (-773.994) (-775.176) (-774.781) [-774.279] * [-772.635] (-772.034) (-778.740) (-773.512) -- 0:00:32
Average standard deviation of split frequencies: 0.007355
460500 -- (-774.918) [-778.167] (-775.944) (-774.429) * (-775.195) (-774.372) [-774.637] (-774.864) -- 0:00:32
461000 -- (-774.797) (-785.235) [-776.013] (-774.265) * (-775.331) (-773.297) [-774.693] (-778.746) -- 0:00:32
461500 -- (-774.457) (-774.708) (-773.977) [-775.605] * (-772.350) (-775.132) [-773.103] (-775.116) -- 0:00:32
462000 -- (-774.911) (-772.243) (-772.477) [-774.847] * (-772.262) (-774.610) [-774.261] (-773.689) -- 0:00:32
462500 -- [-771.959] (-772.123) (-774.330) (-776.086) * (-772.387) (-775.652) (-779.877) [-772.056] -- 0:00:33
463000 -- (-774.139) [-774.305] (-775.195) (-776.158) * [-772.320] (-771.420) (-774.348) (-773.289) -- 0:00:33
463500 -- (-775.668) (-772.784) (-776.822) [-773.963] * (-772.720) (-772.705) (-775.375) [-772.871] -- 0:00:33
464000 -- (-772.894) [-774.115] (-774.081) (-773.529) * (-773.302) (-774.185) (-774.815) [-772.366] -- 0:00:33
464500 -- (-771.662) (-774.808) [-772.636] (-773.968) * (-783.860) (-773.229) [-772.426] (-771.515) -- 0:00:33
465000 -- (-773.101) (-773.613) [-773.848] (-772.741) * (-774.795) (-773.230) (-774.719) [-776.219] -- 0:00:33
Average standard deviation of split frequencies: 0.007587
465500 -- (-773.101) (-774.392) (-774.992) [-771.927] * (-772.511) (-773.187) (-773.028) [-772.925] -- 0:00:33
466000 -- (-772.319) (-775.304) [-776.033] (-771.920) * (-772.760) (-775.904) (-775.430) [-772.934] -- 0:00:33
466500 -- [-774.200] (-775.276) (-776.228) (-772.488) * (-773.113) (-774.498) (-772.147) [-772.874] -- 0:00:33
467000 -- [-772.340] (-779.259) (-776.950) (-774.406) * [-772.305] (-778.376) (-771.696) (-773.086) -- 0:00:33
467500 -- (-771.688) [-774.562] (-772.322) (-772.187) * (-772.780) (-773.300) [-772.021] (-775.690) -- 0:00:33
468000 -- (-773.315) (-772.860) [-774.212] (-775.864) * (-772.549) (-777.682) [-772.266] (-773.887) -- 0:00:32
468500 -- [-772.288] (-773.344) (-773.129) (-774.608) * (-772.513) (-774.770) [-773.346] (-778.429) -- 0:00:32
469000 -- (-772.153) (-773.777) [-772.372] (-772.872) * (-774.599) (-773.504) (-773.891) [-773.659] -- 0:00:32
469500 -- [-773.790] (-774.499) (-773.849) (-774.243) * [-775.456] (-773.107) (-771.803) (-776.738) -- 0:00:32
470000 -- (-774.080) [-774.790] (-776.008) (-778.908) * (-772.396) [-773.021] (-772.700) (-772.422) -- 0:00:32
Average standard deviation of split frequencies: 0.006477
470500 -- (-774.145) [-775.508] (-775.680) (-782.027) * (-775.663) (-771.528) [-772.733] (-772.436) -- 0:00:32
471000 -- (-771.940) [-772.340] (-772.093) (-776.544) * [-773.043] (-772.868) (-774.154) (-771.570) -- 0:00:32
471500 -- (-772.327) [-773.276] (-773.272) (-773.145) * [-774.295] (-777.539) (-773.979) (-772.307) -- 0:00:32
472000 -- (-771.854) [-772.890] (-772.229) (-773.210) * (-773.917) (-772.747) (-774.430) [-778.264] -- 0:00:32
472500 -- (-771.383) (-775.444) [-772.543] (-773.195) * (-776.460) (-772.437) (-777.762) [-774.680] -- 0:00:32
473000 -- (-774.417) [-774.102] (-776.186) (-773.151) * (-773.061) (-771.944) (-774.570) [-773.540] -- 0:00:32
473500 -- (-774.850) (-772.654) (-774.038) [-773.921] * (-773.055) (-772.047) [-774.713] (-776.385) -- 0:00:32
474000 -- [-774.083] (-775.731) (-774.437) (-774.863) * (-773.912) (-774.525) [-771.951] (-773.394) -- 0:00:32
474500 -- (-772.349) [-772.286] (-774.634) (-775.368) * (-773.430) (-774.793) (-774.572) [-776.572] -- 0:00:32
475000 -- (-772.119) (-775.007) [-773.303] (-773.211) * [-773.951] (-775.288) (-773.162) (-777.092) -- 0:00:32
Average standard deviation of split frequencies: 0.006470
475500 -- (-773.266) (-772.681) (-774.628) [-775.186] * (-775.437) [-775.154] (-773.683) (-777.402) -- 0:00:31
476000 -- [-773.846] (-775.898) (-775.837) (-775.110) * [-775.806] (-772.089) (-774.154) (-776.084) -- 0:00:31
476500 -- (-773.073) (-774.899) (-778.834) [-772.972] * (-773.045) (-772.078) [-772.735] (-779.047) -- 0:00:31
477000 -- (-773.009) (-772.636) (-771.562) [-772.566] * (-773.407) [-772.867] (-773.898) (-776.306) -- 0:00:31
477500 -- [-772.598] (-773.656) (-773.375) (-774.083) * [-773.544] (-771.517) (-774.154) (-774.104) -- 0:00:31
478000 -- (-777.732) (-774.409) [-772.762] (-774.050) * (-775.342) (-771.642) [-772.548] (-774.859) -- 0:00:31
478500 -- (-773.761) [-772.446] (-771.466) (-775.318) * [-775.239] (-773.892) (-772.743) (-773.032) -- 0:00:31
479000 -- (-774.511) (-775.159) (-773.576) [-773.521] * (-773.602) [-775.241] (-775.757) (-773.523) -- 0:00:31
479500 -- [-773.446] (-773.947) (-771.815) (-774.310) * (-774.123) [-774.060] (-773.451) (-773.044) -- 0:00:32
480000 -- (-774.078) [-781.259] (-771.782) (-773.467) * [-773.677] (-773.404) (-774.089) (-774.919) -- 0:00:32
Average standard deviation of split frequencies: 0.006342
480500 -- (-774.645) (-781.430) [-775.119] (-772.505) * (-773.300) (-772.361) (-774.057) [-774.333] -- 0:00:32
481000 -- [-773.818] (-779.186) (-775.642) (-773.307) * (-774.791) [-773.363] (-773.407) (-773.633) -- 0:00:32
481500 -- [-773.290] (-772.265) (-777.057) (-772.564) * (-774.638) [-772.285] (-772.432) (-773.336) -- 0:00:32
482000 -- (-773.955) [-772.716] (-776.659) (-773.770) * (-773.496) (-778.667) (-775.031) [-774.074] -- 0:00:32
482500 -- (-773.567) [-773.605] (-775.116) (-778.810) * (-773.591) (-777.152) (-772.906) [-774.751] -- 0:00:32
483000 -- (-772.849) (-775.592) (-774.848) [-773.524] * (-775.842) (-778.812) [-773.990] (-773.984) -- 0:00:32
483500 -- [-773.089] (-772.484) (-773.664) (-775.081) * (-784.735) (-776.971) (-772.999) [-772.906] -- 0:00:32
484000 -- (-773.274) (-772.857) [-772.859] (-773.090) * (-777.538) (-773.733) [-773.904] (-772.543) -- 0:00:31
484500 -- (-772.769) [-773.575] (-774.451) (-777.979) * [-773.626] (-775.544) (-773.203) (-772.870) -- 0:00:31
485000 -- (-771.737) (-772.300) (-778.353) [-772.809] * [-771.933] (-776.320) (-776.009) (-771.496) -- 0:00:31
Average standard deviation of split frequencies: 0.006487
485500 -- [-773.028] (-772.578) (-779.980) (-772.280) * [-780.196] (-780.418) (-772.001) (-779.456) -- 0:00:31
486000 -- [-774.307] (-772.120) (-776.189) (-772.692) * (-772.270) (-775.571) (-772.622) [-773.941] -- 0:00:31
486500 -- [-775.104] (-779.096) (-773.194) (-773.694) * (-773.216) (-775.740) (-777.773) [-774.822] -- 0:00:31
487000 -- (-774.591) (-776.103) [-773.988] (-772.582) * (-772.065) (-773.002) [-772.380] (-775.146) -- 0:00:31
487500 -- [-771.668] (-774.268) (-774.698) (-771.965) * [-774.194] (-774.598) (-774.582) (-777.955) -- 0:00:31
488000 -- (-773.136) [-773.916] (-785.499) (-771.627) * (-775.966) (-774.609) [-774.964] (-779.170) -- 0:00:31
488500 -- (-772.164) (-774.682) (-777.544) [-773.149] * [-774.131] (-774.372) (-775.812) (-776.270) -- 0:00:31
489000 -- (-773.117) (-774.860) (-777.891) [-774.504] * (-772.715) (-772.336) (-779.010) [-774.681] -- 0:00:31
489500 -- (-771.809) [-773.047] (-773.390) (-772.430) * (-774.457) (-772.766) (-773.981) [-772.861] -- 0:00:31
490000 -- [-773.090] (-779.276) (-773.676) (-773.649) * (-775.080) [-774.156] (-773.389) (-774.221) -- 0:00:31
Average standard deviation of split frequencies: 0.007926
490500 -- (-772.567) (-774.159) (-774.892) [-774.207] * (-774.644) (-773.529) [-776.069] (-773.485) -- 0:00:31
491000 -- (-773.302) (-772.231) (-773.091) [-776.895] * (-774.151) (-772.355) [-773.265] (-773.394) -- 0:00:31
491500 -- (-771.884) (-773.652) (-775.149) [-772.828] * [-774.657] (-772.741) (-774.352) (-775.485) -- 0:00:31
492000 -- (-773.797) [-773.329] (-774.825) (-777.269) * [-774.377] (-772.715) (-776.608) (-772.554) -- 0:00:30
492500 -- [-771.909] (-774.489) (-772.929) (-777.433) * (-772.540) (-772.412) [-771.719] (-772.367) -- 0:00:30
493000 -- (-771.958) (-772.706) [-772.747] (-772.045) * (-774.266) (-771.885) [-772.899] (-773.162) -- 0:00:30
493500 -- [-771.935] (-771.702) (-773.927) (-772.779) * [-772.762] (-771.954) (-773.160) (-773.042) -- 0:00:30
494000 -- [-771.729] (-774.997) (-776.371) (-772.192) * (-772.589) [-772.404] (-771.919) (-773.480) -- 0:00:30
494500 -- (-772.945) (-771.899) (-773.432) [-772.455] * [-773.198] (-771.706) (-772.689) (-773.134) -- 0:00:30
495000 -- (-776.435) (-772.956) [-775.783] (-773.515) * (-774.068) (-771.546) (-773.662) [-771.734] -- 0:00:30
Average standard deviation of split frequencies: 0.007350
495500 -- (-777.850) (-773.469) (-774.871) [-774.036] * (-773.395) [-773.223] (-773.647) (-774.109) -- 0:00:30
496000 -- (-773.203) (-771.992) (-772.434) [-774.789] * (-776.505) (-772.626) (-772.982) [-773.427] -- 0:00:31
496500 -- [-775.392] (-772.171) (-774.892) (-776.514) * (-776.602) (-773.466) (-773.304) [-773.619] -- 0:00:31
497000 -- (-776.294) (-773.882) (-773.147) [-772.930] * (-776.290) [-772.331] (-774.813) (-772.247) -- 0:00:31
497500 -- (-775.699) (-774.310) [-773.416] (-771.967) * [-773.511] (-775.746) (-774.401) (-773.320) -- 0:00:31
498000 -- (-776.434) (-774.017) [-774.305] (-775.497) * (-773.081) (-771.835) (-775.706) [-778.997] -- 0:00:31
498500 -- (-775.136) [-778.519] (-774.674) (-776.068) * (-775.004) (-772.270) [-771.684] (-773.086) -- 0:00:31
499000 -- (-774.186) (-779.013) (-774.083) [-774.226] * (-776.213) (-772.252) (-773.036) [-771.935] -- 0:00:31
499500 -- [-773.554] (-790.338) (-773.510) (-773.107) * (-776.589) (-773.600) (-776.473) [-772.399] -- 0:00:31
500000 -- (-774.445) [-772.254] (-772.070) (-775.905) * (-773.849) [-773.697] (-773.858) (-772.016) -- 0:00:31
Average standard deviation of split frequencies: 0.007846
500500 -- [-771.570] (-775.171) (-772.251) (-773.921) * [-773.398] (-773.727) (-775.333) (-775.904) -- 0:00:30
501000 -- [-774.158] (-775.343) (-773.972) (-775.081) * (-774.861) (-775.224) (-773.340) [-773.384] -- 0:00:30
501500 -- (-781.542) (-772.100) [-773.862] (-772.087) * (-773.370) (-779.158) (-773.901) [-777.634] -- 0:00:30
502000 -- (-772.522) (-772.027) (-774.602) [-774.045] * [-773.313] (-774.307) (-776.629) (-775.604) -- 0:00:30
502500 -- (-773.216) (-773.998) (-772.136) [-772.196] * (-774.077) (-773.732) (-777.835) [-772.421] -- 0:00:30
503000 -- (-772.090) (-772.555) (-772.383) [-771.704] * (-777.563) (-772.827) (-776.763) [-775.145] -- 0:00:30
503500 -- (-773.224) (-777.516) [-773.318] (-772.813) * (-772.780) (-773.547) [-771.958] (-771.884) -- 0:00:30
504000 -- [-773.093] (-773.625) (-774.700) (-773.235) * (-774.085) (-776.817) (-777.457) [-771.944] -- 0:00:30
504500 -- (-774.605) [-774.006] (-772.757) (-772.207) * (-774.488) (-774.571) [-775.568] (-774.621) -- 0:00:30
505000 -- (-774.109) (-774.589) (-772.808) [-772.836] * (-775.382) (-773.667) [-772.289] (-772.226) -- 0:00:30
Average standard deviation of split frequencies: 0.008268
505500 -- [-773.564] (-775.391) (-777.298) (-772.630) * (-773.605) [-772.130] (-772.145) (-774.506) -- 0:00:30
506000 -- (-773.229) [-773.365] (-771.683) (-771.802) * [-775.323] (-773.156) (-775.043) (-774.302) -- 0:00:30
506500 -- (-777.882) (-771.765) [-772.359] (-771.606) * [-774.009] (-774.386) (-773.459) (-773.327) -- 0:00:30
507000 -- [-776.387] (-771.829) (-775.110) (-772.427) * (-775.361) (-774.384) (-776.051) [-773.331] -- 0:00:30
507500 -- (-773.452) [-773.007] (-773.199) (-773.192) * (-773.320) (-771.741) [-772.614] (-773.174) -- 0:00:30
508000 -- [-773.271] (-774.829) (-773.037) (-773.461) * (-772.831) (-772.860) (-772.956) [-773.658] -- 0:00:30
508500 -- (-773.842) [-774.471] (-773.870) (-773.724) * (-772.962) (-773.290) [-773.540] (-775.056) -- 0:00:29
509000 -- (-780.440) [-773.002] (-776.067) (-777.267) * (-774.630) (-773.293) [-773.182] (-777.550) -- 0:00:29
509500 -- (-778.755) (-772.996) [-772.794] (-773.887) * [-773.403] (-771.908) (-772.956) (-779.271) -- 0:00:29
510000 -- [-775.095] (-773.095) (-772.210) (-773.477) * (-772.264) (-772.421) (-772.585) [-773.312] -- 0:00:29
Average standard deviation of split frequencies: 0.008654
510500 -- [-773.748] (-773.493) (-771.810) (-773.072) * (-772.901) [-774.991] (-773.570) (-773.654) -- 0:00:29
511000 -- (-773.556) [-772.247] (-777.547) (-774.337) * (-772.774) (-775.852) (-775.001) [-774.152] -- 0:00:29
511500 -- [-779.239] (-773.219) (-773.994) (-776.419) * (-773.468) (-773.166) (-772.923) [-776.114] -- 0:00:29
512000 -- (-775.977) (-776.402) [-774.768] (-774.196) * (-772.838) (-774.753) [-773.234] (-775.776) -- 0:00:29
512500 -- (-772.971) (-774.395) (-773.324) [-774.405] * [-773.696] (-776.830) (-776.326) (-771.792) -- 0:00:29
513000 -- (-772.045) (-772.670) (-774.699) [-772.433] * [-777.034] (-774.334) (-779.206) (-771.689) -- 0:00:30
513500 -- (-773.704) [-772.170] (-772.561) (-774.299) * (-775.663) [-773.927] (-772.688) (-771.964) -- 0:00:30
514000 -- (-773.155) [-773.027] (-774.837) (-775.138) * (-773.062) (-774.153) (-774.498) [-772.557] -- 0:00:30
514500 -- (-772.217) [-775.119] (-772.842) (-775.689) * (-773.027) [-773.648] (-773.664) (-776.531) -- 0:00:30
515000 -- (-776.529) [-774.586] (-772.935) (-774.613) * (-773.055) [-772.996] (-773.796) (-775.692) -- 0:00:30
Average standard deviation of split frequencies: 0.008831
515500 -- (-772.198) (-777.075) [-773.617] (-775.358) * [-772.011] (-773.947) (-774.722) (-774.710) -- 0:00:30
516000 -- [-774.080] (-773.363) (-772.675) (-772.721) * (-772.297) [-776.001] (-773.807) (-773.659) -- 0:00:30
516500 -- (-775.963) [-771.938] (-774.585) (-772.337) * (-774.435) (-773.725) (-774.344) [-772.741] -- 0:00:29
517000 -- (-772.843) (-772.771) [-777.270] (-773.461) * (-774.607) [-774.818] (-772.494) (-771.943) -- 0:00:29
517500 -- (-775.025) (-773.176) [-778.439] (-772.825) * (-771.509) [-772.948] (-776.360) (-773.519) -- 0:00:29
518000 -- [-774.737] (-772.574) (-775.387) (-776.868) * (-772.168) (-784.584) (-773.326) [-772.662] -- 0:00:29
518500 -- (-771.603) (-775.165) [-772.754] (-773.595) * (-771.881) (-778.312) (-777.072) [-773.063] -- 0:00:29
519000 -- [-774.176] (-772.045) (-773.108) (-772.216) * (-776.273) (-773.043) [-772.778] (-772.379) -- 0:00:29
519500 -- [-773.933] (-772.049) (-774.063) (-772.388) * (-776.048) [-772.958] (-772.384) (-773.316) -- 0:00:29
520000 -- [-774.750] (-777.325) (-773.203) (-773.693) * [-777.166] (-777.622) (-773.380) (-776.047) -- 0:00:29
Average standard deviation of split frequencies: 0.008631
520500 -- (-774.701) (-775.072) [-772.134] (-775.943) * [-772.352] (-774.597) (-771.910) (-773.060) -- 0:00:29
521000 -- (-778.336) (-772.233) (-774.426) [-774.611] * (-772.462) (-776.058) [-772.099] (-773.466) -- 0:00:29
521500 -- (-775.539) [-776.397] (-772.879) (-773.168) * [-773.768] (-773.229) (-771.880) (-773.449) -- 0:00:29
522000 -- (-771.607) [-772.205] (-773.608) (-772.835) * (-776.345) (-772.932) (-775.940) [-776.793] -- 0:00:29
522500 -- [-775.599] (-772.849) (-775.174) (-772.670) * [-776.422] (-773.228) (-772.885) (-776.424) -- 0:00:29
523000 -- (-776.914) (-773.496) [-772.414] (-774.155) * (-778.893) (-775.473) (-772.955) [-773.770] -- 0:00:29
523500 -- (-776.270) (-775.678) (-772.111) [-771.974] * (-773.634) (-773.503) [-773.128] (-773.019) -- 0:00:29
524000 -- (-772.482) (-772.941) (-772.724) [-772.472] * (-772.654) (-774.757) (-772.737) [-775.504] -- 0:00:29
524500 -- (-774.618) [-775.860] (-771.821) (-773.403) * (-773.750) [-774.544] (-772.616) (-774.397) -- 0:00:29
525000 -- (-775.465) (-775.221) [-774.525] (-773.529) * (-773.767) (-775.114) (-772.123) [-776.172] -- 0:00:28
Average standard deviation of split frequencies: 0.008663
525500 -- (-774.387) (-772.919) (-774.650) [-775.050] * (-776.492) [-776.144] (-772.028) (-773.476) -- 0:00:28
526000 -- [-772.084] (-773.298) (-774.253) (-775.190) * [-772.745] (-771.935) (-772.564) (-771.897) -- 0:00:28
526500 -- (-772.698) [-773.776] (-775.434) (-778.218) * (-773.856) (-774.946) (-771.974) [-772.348] -- 0:00:28
527000 -- [-773.791] (-773.427) (-775.726) (-775.767) * (-773.575) (-775.165) [-773.543] (-772.034) -- 0:00:28
527500 -- (-775.284) [-773.028] (-775.608) (-774.391) * (-776.592) (-774.696) (-772.063) [-776.116] -- 0:00:28
528000 -- (-774.572) (-774.236) (-772.983) [-772.948] * [-773.768] (-773.657) (-771.738) (-774.550) -- 0:00:28
528500 -- (-774.047) [-772.500] (-774.374) (-772.047) * (-771.771) (-772.840) (-772.517) [-773.289] -- 0:00:28
529000 -- (-772.971) [-772.288] (-771.874) (-775.336) * [-771.665] (-772.789) (-773.564) (-774.905) -- 0:00:28
529500 -- [-773.380] (-771.854) (-774.150) (-772.211) * [-771.343] (-774.301) (-774.596) (-775.920) -- 0:00:29
530000 -- (-774.115) (-773.154) (-775.904) [-772.317] * [-771.614] (-776.460) (-779.829) (-776.657) -- 0:00:29
Average standard deviation of split frequencies: 0.008173
530500 -- [-776.293] (-772.229) (-775.589) (-771.953) * (-777.847) [-776.002] (-773.517) (-773.000) -- 0:00:29
531000 -- (-775.613) (-773.579) [-772.721] (-774.724) * (-773.119) [-772.857] (-773.757) (-774.689) -- 0:00:29
531500 -- (-773.483) [-775.915] (-773.824) (-778.776) * (-774.026) (-772.878) (-773.873) [-772.851] -- 0:00:29
532000 -- (-780.414) [-772.520] (-772.218) (-776.726) * [-773.605] (-776.443) (-775.129) (-780.348) -- 0:00:29
532500 -- (-774.968) (-776.019) [-775.636] (-774.392) * (-774.077) [-772.478] (-771.890) (-773.546) -- 0:00:28
533000 -- (-773.829) (-773.083) (-778.370) [-772.658] * (-774.769) [-772.108] (-773.973) (-776.139) -- 0:00:28
533500 -- (-773.745) [-774.003] (-774.659) (-773.550) * (-774.339) (-776.636) (-774.631) [-775.651] -- 0:00:28
534000 -- (-776.223) (-775.630) (-774.460) [-773.542] * (-778.145) (-772.445) (-773.014) [-773.845] -- 0:00:28
534500 -- [-771.455] (-772.618) (-775.697) (-773.939) * (-775.695) (-774.929) (-775.848) [-774.481] -- 0:00:28
535000 -- (-773.853) (-771.555) (-774.460) [-774.461] * (-776.922) (-775.553) (-774.607) [-773.358] -- 0:00:28
Average standard deviation of split frequencies: 0.008502
535500 -- (-773.883) (-772.530) [-773.574] (-776.105) * (-776.857) [-772.610] (-774.172) (-775.041) -- 0:00:28
536000 -- [-771.900] (-776.145) (-773.782) (-772.504) * (-772.632) (-773.218) [-772.036] (-777.383) -- 0:00:28
536500 -- (-771.723) (-773.427) [-774.519] (-773.999) * (-772.597) (-773.803) [-772.243] (-780.088) -- 0:00:28
537000 -- (-772.061) (-774.533) (-773.523) [-777.595] * (-777.688) (-774.052) (-775.045) [-779.600] -- 0:00:28
537500 -- (-772.610) (-774.729) (-774.909) [-772.264] * [-773.206] (-774.788) (-771.643) (-774.027) -- 0:00:28
538000 -- [-773.644] (-773.753) (-774.661) (-772.130) * (-774.299) [-775.766] (-771.668) (-776.778) -- 0:00:28
538500 -- (-776.651) [-771.960] (-772.561) (-773.290) * [-773.563] (-775.067) (-774.699) (-776.678) -- 0:00:28
539000 -- (-779.375) (-777.240) (-772.984) [-774.716] * [-776.120] (-772.380) (-774.947) (-773.845) -- 0:00:28
539500 -- (-773.848) (-777.288) [-773.625] (-777.405) * (-772.950) (-772.540) [-774.983] (-777.130) -- 0:00:28
540000 -- (-773.011) (-777.178) (-774.307) [-777.281] * (-773.873) [-776.106] (-774.754) (-776.708) -- 0:00:28
Average standard deviation of split frequencies: 0.008370
540500 -- (-776.133) [-772.957] (-771.943) (-774.177) * (-774.558) (-774.791) [-773.403] (-772.142) -- 0:00:28
541000 -- [-774.158] (-772.472) (-775.008) (-775.895) * [-774.106] (-775.636) (-773.057) (-772.550) -- 0:00:27
541500 -- (-773.195) (-772.185) (-775.714) [-774.211] * (-775.069) (-776.364) (-774.502) [-775.446] -- 0:00:27
542000 -- [-772.563] (-774.396) (-772.188) (-771.877) * (-774.207) (-774.461) [-773.227] (-773.035) -- 0:00:27
542500 -- (-772.177) [-772.892] (-773.630) (-773.466) * (-772.596) [-772.129] (-772.884) (-772.163) -- 0:00:27
543000 -- (-775.170) [-773.783] (-774.777) (-775.084) * [-773.162] (-773.850) (-772.611) (-773.491) -- 0:00:27
543500 -- [-772.765] (-775.046) (-774.610) (-773.787) * (-773.342) (-774.162) (-775.744) [-774.994] -- 0:00:27
544000 -- [-774.661] (-773.647) (-774.707) (-774.388) * (-772.520) (-771.715) [-772.271] (-774.460) -- 0:00:27
544500 -- (-776.203) [-773.112] (-772.579) (-771.938) * (-773.738) [-773.689] (-772.814) (-777.480) -- 0:00:27
545000 -- [-773.878] (-774.771) (-774.737) (-773.330) * (-775.057) (-773.211) [-772.814] (-775.549) -- 0:00:27
Average standard deviation of split frequencies: 0.007655
545500 -- (-775.206) [-771.943] (-775.467) (-772.646) * (-775.083) (-773.417) [-771.865] (-772.566) -- 0:00:27
546000 -- (-772.155) (-771.585) [-772.915] (-772.644) * (-774.675) (-772.429) [-772.736] (-773.716) -- 0:00:28
546500 -- [-772.871] (-772.623) (-772.356) (-772.153) * [-776.379] (-774.633) (-772.632) (-774.699) -- 0:00:28
547000 -- [-771.747] (-777.784) (-772.214) (-773.462) * (-774.052) [-773.254] (-777.446) (-775.861) -- 0:00:28
547500 -- (-772.020) (-774.507) [-772.997] (-776.741) * (-773.404) (-773.329) (-775.022) [-773.322] -- 0:00:28
548000 -- (-772.089) (-773.460) (-773.899) [-778.762] * [-775.680] (-773.462) (-775.501) (-773.567) -- 0:00:28
548500 -- (-772.787) (-773.058) (-772.526) [-776.363] * (-776.539) (-780.155) (-773.749) [-774.701] -- 0:00:27
549000 -- (-772.975) (-772.344) (-774.491) [-773.980] * [-773.311] (-779.318) (-772.817) (-775.597) -- 0:00:27
549500 -- (-773.111) [-772.344] (-772.557) (-772.453) * [-771.453] (-775.541) (-773.012) (-777.813) -- 0:00:27
550000 -- (-771.895) (-774.963) (-772.437) [-773.188] * (-776.565) (-780.046) [-772.523] (-777.306) -- 0:00:27
Average standard deviation of split frequencies: 0.008161
550500 -- (-777.560) (-774.080) [-774.103] (-774.386) * (-773.878) (-776.798) [-772.558] (-772.374) -- 0:00:27
551000 -- (-776.282) [-772.196] (-774.522) (-774.729) * (-772.295) (-774.420) (-773.114) [-773.259] -- 0:00:27
551500 -- (-774.696) [-773.787] (-771.818) (-774.354) * (-774.568) [-775.308] (-772.687) (-778.195) -- 0:00:27
552000 -- (-777.739) (-777.069) [-774.795] (-773.293) * (-777.235) (-774.088) (-772.337) [-774.423] -- 0:00:27
552500 -- (-775.013) (-771.662) (-775.135) [-772.660] * [-773.582] (-771.711) (-773.576) (-771.411) -- 0:00:27
553000 -- (-777.506) (-777.123) (-774.739) [-772.946] * (-773.277) [-772.331] (-776.480) (-772.160) -- 0:00:27
553500 -- (-775.767) (-772.688) (-774.956) [-772.113] * (-773.138) [-772.701] (-773.704) (-772.845) -- 0:00:27
554000 -- (-776.001) (-773.249) [-773.934] (-777.090) * (-773.647) (-773.924) (-772.290) [-775.392] -- 0:00:27
554500 -- (-773.907) [-773.585] (-775.362) (-773.200) * (-772.820) (-776.866) (-772.924) [-776.247] -- 0:00:27
555000 -- (-773.172) (-779.654) (-772.689) [-774.586] * (-772.222) (-775.367) (-775.224) [-776.746] -- 0:00:27
Average standard deviation of split frequencies: 0.008931
555500 -- [-776.539] (-772.854) (-775.227) (-772.521) * (-773.142) [-774.744] (-773.646) (-773.317) -- 0:00:27
556000 -- (-774.670) (-776.017) (-776.902) [-773.511] * [-772.361] (-774.658) (-772.004) (-772.707) -- 0:00:27
556500 -- [-774.465] (-773.919) (-774.462) (-776.242) * (-772.579) [-772.392] (-774.289) (-772.804) -- 0:00:27
557000 -- [-772.876] (-773.179) (-774.801) (-778.068) * (-772.877) (-773.350) [-772.858] (-772.336) -- 0:00:27
557500 -- [-773.715] (-777.457) (-775.509) (-773.850) * (-773.345) (-771.579) (-774.597) [-775.066] -- 0:00:26
558000 -- (-774.966) (-772.713) (-773.998) [-778.270] * (-774.468) (-771.809) (-773.417) [-772.906] -- 0:00:26
558500 -- (-771.635) (-774.906) (-773.599) [-773.170] * (-775.642) (-771.884) [-772.488] (-776.088) -- 0:00:26
559000 -- (-772.604) [-774.141] (-774.684) (-772.562) * (-775.294) (-773.245) [-774.082] (-776.619) -- 0:00:26
559500 -- (-772.657) (-773.318) (-775.244) [-771.472] * [-773.770] (-771.395) (-773.462) (-773.868) -- 0:00:26
560000 -- (-771.623) (-774.362) (-776.311) [-773.186] * [-775.547] (-771.963) (-773.994) (-775.753) -- 0:00:26
Average standard deviation of split frequencies: 0.008968
560500 -- [-773.753] (-775.032) (-775.559) (-772.805) * (-777.313) (-775.943) [-773.537] (-775.473) -- 0:00:26
561000 -- (-774.295) [-772.624] (-774.687) (-778.098) * [-771.787] (-773.110) (-771.948) (-772.978) -- 0:00:26
561500 -- (-775.754) (-772.959) (-774.507) [-780.655] * (-774.386) (-772.876) (-773.234) [-774.636] -- 0:00:26
562000 -- (-774.960) (-773.149) [-772.904] (-777.266) * (-774.570) (-773.457) [-777.541] (-775.832) -- 0:00:26
562500 -- [-774.364] (-772.608) (-771.824) (-775.437) * (-776.136) [-775.750] (-773.545) (-773.146) -- 0:00:27
563000 -- (-774.405) [-776.187] (-773.159) (-774.014) * (-773.737) (-773.508) [-772.803] (-777.719) -- 0:00:27
563500 -- [-774.755] (-780.676) (-773.159) (-775.907) * [-772.117] (-772.502) (-773.849) (-773.269) -- 0:00:27
564000 -- [-773.469] (-773.414) (-771.560) (-775.575) * (-775.061) (-772.674) [-774.028] (-778.156) -- 0:00:27
564500 -- (-773.964) [-773.570] (-778.923) (-773.912) * (-772.206) (-772.516) [-773.643] (-774.517) -- 0:00:27
565000 -- [-773.664] (-772.288) (-776.028) (-775.009) * (-774.556) (-773.186) [-773.680] (-772.919) -- 0:00:26
Average standard deviation of split frequencies: 0.008495
565500 -- (-777.296) (-773.352) (-771.843) [-773.867] * (-773.822) (-771.942) [-773.069] (-771.953) -- 0:00:26
566000 -- (-772.689) (-774.276) [-773.574] (-777.133) * (-773.827) [-772.869] (-775.333) (-772.154) -- 0:00:26
566500 -- [-774.752] (-775.524) (-772.561) (-775.602) * [-771.758] (-778.266) (-774.044) (-775.451) -- 0:00:26
567000 -- [-775.269] (-774.242) (-773.554) (-773.133) * (-771.438) [-772.513] (-776.999) (-774.274) -- 0:00:26
567500 -- (-772.749) (-778.785) (-774.664) [-773.075] * (-777.130) [-771.906] (-777.164) (-772.850) -- 0:00:26
568000 -- [-775.520] (-774.499) (-772.385) (-772.344) * (-775.345) (-772.344) (-776.177) [-772.232] -- 0:00:26
568500 -- [-775.264] (-775.226) (-778.707) (-774.939) * (-772.642) (-778.856) (-777.649) [-772.195] -- 0:00:26
569000 -- [-772.045] (-772.971) (-772.743) (-775.388) * (-774.100) (-776.077) [-775.655] (-771.926) -- 0:00:26
569500 -- [-776.983] (-772.839) (-774.597) (-775.361) * (-773.441) [-774.014] (-776.774) (-771.920) -- 0:00:26
570000 -- (-772.441) [-772.382] (-774.454) (-778.673) * [-774.267] (-777.191) (-773.849) (-776.048) -- 0:00:26
Average standard deviation of split frequencies: 0.008977
570500 -- (-774.031) (-775.487) (-772.508) [-774.176] * (-776.036) [-774.502] (-773.208) (-775.453) -- 0:00:26
571000 -- (-773.701) (-776.283) (-772.364) [-774.069] * (-778.752) (-772.854) (-773.763) [-771.947] -- 0:00:26
571500 -- [-772.563] (-774.870) (-772.851) (-773.411) * (-776.611) (-775.359) [-773.781] (-772.107) -- 0:00:26
572000 -- (-771.977) (-771.655) [-773.289] (-783.238) * (-775.692) [-775.614] (-772.973) (-772.938) -- 0:00:26
572500 -- [-775.770] (-771.659) (-773.424) (-772.885) * [-774.254] (-774.927) (-773.343) (-774.152) -- 0:00:26
573000 -- (-773.346) (-771.660) [-773.593] (-772.166) * (-771.400) (-772.486) [-772.202] (-773.219) -- 0:00:26
573500 -- (-773.858) [-771.660] (-774.792) (-773.973) * [-772.860] (-773.483) (-772.337) (-774.591) -- 0:00:26
574000 -- [-773.104] (-772.407) (-773.615) (-774.003) * (-774.938) (-776.208) [-772.191] (-774.364) -- 0:00:25
574500 -- [-772.831] (-773.735) (-776.684) (-777.343) * (-774.174) [-772.426] (-772.223) (-773.155) -- 0:00:25
575000 -- (-772.573) (-777.768) (-772.240) [-774.893] * [-775.532] (-772.817) (-771.593) (-771.793) -- 0:00:25
Average standard deviation of split frequencies: 0.009330
575500 -- (-773.261) (-773.467) (-775.226) [-772.434] * [-774.241] (-773.264) (-775.107) (-773.127) -- 0:00:25
576000 -- (-772.810) (-773.397) (-773.356) [-773.983] * [-774.990] (-775.780) (-778.634) (-772.214) -- 0:00:25
576500 -- (-776.627) (-772.342) (-772.196) [-773.316] * [-773.162] (-773.444) (-772.035) (-776.817) -- 0:00:25
577000 -- (-777.816) [-773.258] (-772.861) (-775.591) * (-774.550) [-773.156] (-772.033) (-777.946) -- 0:00:25
577500 -- (-773.697) (-773.827) [-772.914] (-772.690) * [-774.695] (-774.085) (-771.869) (-775.402) -- 0:00:25
578000 -- [-775.454] (-774.538) (-772.569) (-772.746) * (-771.625) (-774.453) (-774.615) [-776.080] -- 0:00:25
578500 -- [-773.524] (-776.944) (-777.305) (-774.314) * [-772.400] (-772.539) (-775.138) (-775.103) -- 0:00:25
579000 -- (-776.240) (-773.656) (-774.607) [-771.977] * (-772.633) (-772.829) (-776.700) [-774.420] -- 0:00:26
579500 -- [-774.515] (-772.888) (-772.773) (-775.449) * (-773.383) (-773.485) (-772.813) [-775.999] -- 0:00:26
580000 -- [-773.862] (-773.285) (-771.814) (-771.673) * (-772.453) (-771.571) (-772.627) [-772.461] -- 0:00:26
Average standard deviation of split frequencies: 0.009580
580500 -- (-772.716) (-772.725) (-771.558) [-771.535] * (-771.900) (-774.506) [-771.686] (-772.720) -- 0:00:26
581000 -- (-773.716) (-772.133) [-772.594] (-773.432) * (-771.650) [-773.238] (-771.788) (-773.715) -- 0:00:25
581500 -- (-772.267) [-776.118] (-773.077) (-773.093) * (-773.056) (-772.085) [-773.470] (-778.286) -- 0:00:25
582000 -- (-773.005) (-772.603) [-772.742] (-773.249) * (-773.159) (-772.433) [-776.866] (-772.556) -- 0:00:25
582500 -- (-771.872) [-772.346] (-772.777) (-775.426) * (-772.467) [-773.690] (-771.834) (-774.671) -- 0:00:25
583000 -- [-772.938] (-772.671) (-776.722) (-772.840) * (-772.244) (-772.032) (-772.207) [-772.178] -- 0:00:25
583500 -- (-772.322) (-773.278) (-772.407) [-771.729] * (-775.568) (-775.273) (-776.451) [-773.352] -- 0:00:25
584000 -- (-773.853) (-773.195) (-772.277) [-771.751] * (-773.255) [-771.840] (-778.020) (-774.815) -- 0:00:25
584500 -- (-772.750) (-772.404) [-772.903] (-772.918) * (-772.012) [-775.246] (-772.054) (-773.855) -- 0:00:25
585000 -- (-772.409) (-774.146) [-774.518] (-773.643) * (-772.012) [-773.585] (-772.808) (-773.790) -- 0:00:25
Average standard deviation of split frequencies: 0.009653
585500 -- [-776.544] (-772.589) (-772.332) (-772.804) * (-777.867) (-772.993) (-771.887) [-773.164] -- 0:00:25
586000 -- (-774.131) (-773.662) (-772.156) [-776.323] * (-775.617) (-775.188) (-773.829) [-774.869] -- 0:00:25
586500 -- (-775.002) (-774.153) (-776.049) [-776.076] * (-771.426) [-772.183] (-775.324) (-776.080) -- 0:00:25
587000 -- [-772.884] (-773.996) (-772.426) (-776.333) * [-774.960] (-776.021) (-774.005) (-774.046) -- 0:00:25
587500 -- (-773.136) [-773.569] (-772.825) (-776.648) * (-772.589) [-780.738] (-772.432) (-773.987) -- 0:00:25
588000 -- [-773.879] (-771.898) (-774.723) (-773.129) * (-773.558) (-776.271) (-775.828) [-773.478] -- 0:00:25
588500 -- (-773.209) (-772.029) [-772.970] (-772.919) * (-777.489) (-777.374) (-776.320) [-775.942] -- 0:00:25
589000 -- [-778.496] (-774.246) (-778.056) (-772.465) * (-774.809) (-776.020) [-773.512] (-772.252) -- 0:00:25
589500 -- [-776.841] (-778.293) (-773.782) (-772.420) * (-775.960) [-773.205] (-773.965) (-772.158) -- 0:00:25
590000 -- (-774.191) [-776.186] (-772.081) (-774.306) * (-774.123) [-773.240] (-773.899) (-775.170) -- 0:00:25
Average standard deviation of split frequencies: 0.010109
590500 -- (-773.236) (-773.244) [-772.387] (-774.979) * (-775.882) [-780.281] (-773.380) (-775.058) -- 0:00:24
591000 -- [-771.864] (-773.230) (-772.887) (-773.098) * (-771.621) (-778.007) [-772.119] (-772.947) -- 0:00:24
591500 -- (-774.519) (-772.650) (-774.481) [-773.032] * (-772.694) [-775.446] (-772.203) (-773.710) -- 0:00:24
592000 -- [-773.589] (-773.701) (-776.513) (-773.031) * [-772.470] (-774.227) (-773.544) (-775.558) -- 0:00:24
592500 -- (-774.403) (-773.588) [-771.636] (-775.903) * [-772.282] (-772.224) (-774.278) (-773.256) -- 0:00:24
593000 -- [-773.488] (-773.723) (-772.335) (-774.466) * (-773.517) [-773.604] (-772.285) (-774.269) -- 0:00:24
593500 -- (-773.909) (-772.254) [-773.721] (-774.049) * [-771.654] (-773.018) (-778.848) (-775.157) -- 0:00:24
594000 -- (-773.332) (-776.411) [-773.103] (-773.760) * [-773.105] (-773.830) (-777.948) (-774.435) -- 0:00:24
594500 -- [-772.466] (-772.372) (-772.615) (-772.266) * (-775.039) (-776.432) (-779.260) [-772.796] -- 0:00:24
595000 -- (-776.386) (-773.708) (-775.903) [-771.911] * [-772.280] (-776.581) (-772.478) (-776.939) -- 0:00:24
Average standard deviation of split frequencies: 0.009650
595500 -- [-774.703] (-774.334) (-782.241) (-772.659) * [-772.044] (-772.540) (-772.396) (-774.540) -- 0:00:24
596000 -- [-772.742] (-774.577) (-772.909) (-773.107) * [-773.470] (-775.269) (-772.137) (-773.300) -- 0:00:25
596500 -- (-773.671) (-773.878) (-771.872) [-772.392] * (-774.809) (-774.917) [-773.452] (-776.297) -- 0:00:25
597000 -- [-775.400] (-776.994) (-772.924) (-773.882) * (-775.035) (-772.402) [-772.076] (-775.628) -- 0:00:24
597500 -- [-774.515] (-772.939) (-775.220) (-772.407) * (-772.835) (-773.210) [-771.947] (-775.502) -- 0:00:24
598000 -- [-772.324] (-771.929) (-773.940) (-773.279) * [-774.441] (-771.958) (-775.425) (-773.163) -- 0:00:24
598500 -- (-771.720) (-773.368) [-774.223] (-774.374) * (-778.081) [-776.457] (-772.213) (-772.692) -- 0:00:24
599000 -- [-771.485] (-772.323) (-773.512) (-776.526) * (-773.379) (-775.543) (-772.303) [-774.762] -- 0:00:24
599500 -- [-771.544] (-772.643) (-776.938) (-772.627) * (-776.358) [-777.324] (-775.264) (-776.406) -- 0:00:24
600000 -- [-772.786] (-773.998) (-773.216) (-775.305) * [-773.048] (-773.332) (-775.537) (-776.113) -- 0:00:24
Average standard deviation of split frequencies: 0.009614
600500 -- (-771.518) (-773.957) (-773.406) [-775.326] * (-773.260) (-773.878) (-773.228) [-774.676] -- 0:00:24
601000 -- (-774.628) [-773.235] (-773.419) (-774.118) * (-772.414) (-773.376) [-773.307] (-773.663) -- 0:00:24
601500 -- [-774.426] (-775.971) (-774.647) (-772.620) * (-773.036) (-777.037) [-772.827] (-776.897) -- 0:00:24
602000 -- (-775.109) (-775.757) (-775.575) [-772.005] * [-773.228] (-774.818) (-774.384) (-771.748) -- 0:00:24
602500 -- (-777.699) (-773.540) (-776.743) [-772.887] * (-771.614) (-774.271) [-773.944] (-772.468) -- 0:00:24
603000 -- [-776.304] (-771.998) (-775.715) (-775.781) * (-772.034) [-772.551] (-772.501) (-774.011) -- 0:00:24
603500 -- (-775.481) [-773.312] (-777.065) (-773.604) * (-774.334) (-773.831) (-773.931) [-772.509] -- 0:00:24
604000 -- (-775.215) (-776.598) (-776.708) [-773.780] * (-772.322) (-772.730) [-774.015] (-775.505) -- 0:00:24
604500 -- (-776.345) [-772.677] (-772.351) (-774.382) * (-773.863) [-776.123] (-773.238) (-773.979) -- 0:00:24
605000 -- [-771.608] (-775.008) (-772.749) (-775.868) * (-772.831) (-778.408) (-774.230) [-773.521] -- 0:00:24
Average standard deviation of split frequencies: 0.009127
605500 -- (-772.710) (-773.144) (-772.722) [-772.239] * (-774.742) [-778.615] (-773.826) (-771.752) -- 0:00:24
606000 -- (-774.384) (-774.086) (-773.463) [-773.525] * [-773.230] (-776.635) (-773.771) (-772.899) -- 0:00:24
606500 -- (-777.349) (-774.599) [-774.224] (-773.820) * [-773.601] (-774.755) (-772.436) (-772.714) -- 0:00:24
607000 -- [-773.643] (-774.078) (-773.052) (-775.058) * (-772.509) (-773.838) [-774.663] (-772.113) -- 0:00:23
607500 -- (-773.204) [-772.558] (-773.690) (-772.610) * (-772.212) (-772.017) (-773.360) [-776.686] -- 0:00:23
608000 -- (-772.256) (-772.607) [-772.633] (-775.984) * (-772.957) (-772.652) (-773.324) [-772.180] -- 0:00:23
608500 -- (-776.060) [-774.682] (-775.186) (-771.654) * (-775.482) (-774.974) (-772.243) [-771.499] -- 0:00:23
609000 -- (-774.538) (-774.159) [-774.810] (-771.575) * [-775.739] (-774.775) (-772.329) (-773.526) -- 0:00:23
609500 -- (-773.280) (-773.283) (-774.542) [-771.570] * (-771.888) (-774.639) [-773.501] (-772.489) -- 0:00:23
610000 -- (-777.569) [-772.943] (-772.177) (-775.093) * (-772.343) (-773.830) (-772.233) [-774.268] -- 0:00:23
Average standard deviation of split frequencies: 0.009058
610500 -- (-773.290) [-774.194] (-774.386) (-778.368) * [-772.945] (-778.956) (-774.091) (-773.770) -- 0:00:23
611000 -- (-774.172) (-775.368) (-775.102) [-774.646] * (-774.480) (-775.595) (-774.881) [-771.840] -- 0:00:23
611500 -- (-774.964) [-772.353] (-773.170) (-774.052) * (-773.203) (-776.634) [-772.922] (-774.873) -- 0:00:23
612000 -- (-777.837) [-771.791] (-775.303) (-775.233) * (-775.468) (-774.961) [-772.542] (-777.465) -- 0:00:23
612500 -- [-776.506] (-772.463) (-779.198) (-776.367) * (-781.156) (-774.964) [-773.047] (-774.357) -- 0:00:24
613000 -- (-775.231) (-771.890) (-772.019) [-776.258] * (-778.916) (-774.608) [-771.871] (-774.138) -- 0:00:23
613500 -- (-777.705) (-771.636) [-772.938] (-774.013) * (-778.764) (-772.094) (-771.426) [-771.658] -- 0:00:23
614000 -- (-772.379) [-771.522] (-776.431) (-773.625) * (-775.233) (-777.201) (-772.774) [-773.177] -- 0:00:23
614500 -- (-775.281) (-772.900) [-773.335] (-772.447) * (-772.616) (-774.873) (-772.613) [-775.629] -- 0:00:23
615000 -- (-774.267) (-775.857) [-775.503] (-774.574) * (-776.613) (-773.978) [-774.048] (-772.893) -- 0:00:23
Average standard deviation of split frequencies: 0.009132
615500 -- (-774.908) (-774.209) [-773.515] (-777.419) * (-774.975) (-774.281) [-780.071] (-774.960) -- 0:00:23
616000 -- (-775.627) [-775.384] (-772.159) (-772.879) * [-773.230] (-773.497) (-778.254) (-779.703) -- 0:00:23
616500 -- (-774.532) [-773.381] (-772.699) (-774.691) * (-773.210) (-772.463) [-776.086] (-774.286) -- 0:00:23
617000 -- [-776.680] (-773.734) (-775.451) (-772.903) * [-772.729] (-771.665) (-773.099) (-773.084) -- 0:00:23
617500 -- (-774.679) [-771.863] (-771.664) (-772.277) * (-772.028) (-772.342) [-773.094] (-774.571) -- 0:00:23
618000 -- (-776.916) [-771.550] (-773.700) (-772.468) * (-774.430) (-774.238) (-771.906) [-772.009] -- 0:00:23
618500 -- (-772.210) (-772.524) (-775.853) [-774.184] * (-772.734) (-775.990) [-772.735] (-771.964) -- 0:00:23
619000 -- (-771.704) (-774.231) (-773.069) [-773.756] * (-772.581) [-775.202] (-772.965) (-774.735) -- 0:00:23
619500 -- [-772.439] (-780.402) (-774.895) (-774.986) * (-773.148) (-776.537) [-773.783] (-774.901) -- 0:00:23
620000 -- (-773.135) (-780.920) [-774.083] (-773.796) * (-773.025) (-775.475) (-777.823) [-772.667] -- 0:00:23
Average standard deviation of split frequencies: 0.010127
620500 -- (-773.133) (-773.146) [-773.786] (-778.006) * [-771.582] (-772.845) (-775.635) (-771.977) -- 0:00:23
621000 -- (-773.108) (-772.077) [-775.032] (-773.745) * (-772.268) (-778.817) (-775.506) [-772.275] -- 0:00:23
621500 -- (-772.126) (-772.801) [-775.450] (-773.480) * (-774.455) (-771.851) (-775.560) [-772.041] -- 0:00:23
622000 -- (-772.686) (-775.253) [-772.239] (-773.212) * (-775.300) (-772.936) [-775.598] (-775.719) -- 0:00:23
622500 -- (-779.287) [-775.296] (-775.504) (-772.960) * (-774.698) (-773.908) [-772.578] (-778.383) -- 0:00:23
623000 -- (-780.239) [-773.709] (-771.510) (-772.036) * (-775.225) (-773.577) (-777.218) [-772.985] -- 0:00:22
623500 -- (-780.197) [-775.372] (-771.717) (-772.842) * (-776.598) [-774.304] (-773.210) (-773.004) -- 0:00:22
624000 -- [-774.317] (-773.242) (-776.267) (-776.878) * (-777.403) (-772.525) (-773.174) [-773.154] -- 0:00:22
624500 -- (-776.187) [-774.083] (-775.233) (-776.903) * [-773.050] (-778.736) (-773.183) (-771.450) -- 0:00:22
625000 -- (-774.336) (-774.096) [-773.294] (-773.419) * (-776.881) (-773.083) (-772.289) [-772.686] -- 0:00:22
Average standard deviation of split frequencies: 0.010025
625500 -- [-773.930] (-773.035) (-772.259) (-774.929) * (-771.926) [-779.333] (-771.636) (-774.353) -- 0:00:22
626000 -- (-776.816) (-775.125) [-772.557] (-777.764) * (-773.419) [-774.797] (-772.108) (-772.746) -- 0:00:22
626500 -- (-773.564) (-775.246) (-772.453) [-772.315] * (-772.089) (-774.850) (-774.013) [-772.950] -- 0:00:22
627000 -- (-774.945) (-773.387) (-773.152) [-772.313] * (-771.809) (-778.230) [-776.336] (-775.516) -- 0:00:22
627500 -- [-773.813] (-775.432) (-776.458) (-775.220) * (-772.143) (-773.437) [-773.944] (-772.712) -- 0:00:22
628000 -- (-772.633) (-774.567) (-773.112) [-774.228] * (-774.907) (-774.912) [-774.275] (-773.994) -- 0:00:22
628500 -- [-774.501] (-773.893) (-776.704) (-778.033) * [-772.022] (-775.881) (-773.957) (-780.250) -- 0:00:22
629000 -- (-778.716) (-772.488) [-774.602] (-773.447) * [-772.810] (-772.830) (-774.389) (-773.965) -- 0:00:23
629500 -- (-773.280) (-780.234) (-775.158) [-772.303] * [-772.599] (-772.353) (-773.183) (-776.737) -- 0:00:22
630000 -- (-774.810) (-776.619) [-774.557] (-773.609) * (-776.592) [-772.940] (-772.593) (-775.612) -- 0:00:22
Average standard deviation of split frequencies: 0.009904
630500 -- (-772.169) [-775.476] (-775.172) (-773.629) * (-774.151) (-773.309) [-772.060] (-774.629) -- 0:00:22
631000 -- (-774.647) (-774.531) (-776.213) [-773.391] * (-773.313) [-773.425] (-773.581) (-772.870) -- 0:00:22
631500 -- (-775.912) (-775.421) [-772.345] (-773.896) * [-773.978] (-773.953) (-773.934) (-773.167) -- 0:00:22
632000 -- (-776.430) (-775.527) (-772.070) [-778.743] * (-774.612) (-773.721) [-772.801] (-773.643) -- 0:00:22
632500 -- (-771.886) (-776.559) (-771.923) [-774.594] * [-772.966] (-775.436) (-774.416) (-774.724) -- 0:00:22
633000 -- [-771.865] (-774.483) (-775.318) (-774.003) * (-773.791) (-774.593) [-772.686] (-773.841) -- 0:00:22
633500 -- [-772.466] (-776.722) (-772.397) (-773.175) * [-775.357] (-773.814) (-772.438) (-778.235) -- 0:00:22
634000 -- (-773.537) (-774.219) [-772.261] (-773.586) * (-771.598) [-771.651] (-772.398) (-776.473) -- 0:00:22
634500 -- [-774.955] (-773.937) (-771.610) (-778.086) * (-772.900) (-772.465) (-772.085) [-778.189] -- 0:00:22
635000 -- (-774.315) [-774.177] (-775.916) (-777.331) * [-772.180] (-772.820) (-771.905) (-772.637) -- 0:00:22
Average standard deviation of split frequencies: 0.009080
635500 -- [-773.539] (-776.012) (-774.166) (-774.842) * (-772.964) [-772.480] (-771.977) (-772.159) -- 0:00:22
636000 -- (-773.718) (-774.057) (-775.435) [-772.185] * (-773.976) (-776.270) [-772.207] (-772.076) -- 0:00:22
636500 -- (-774.744) [-773.882] (-773.892) (-774.528) * (-772.799) (-773.896) (-773.510) [-773.337] -- 0:00:22
637000 -- (-772.592) (-774.337) (-772.253) [-774.034] * (-771.826) [-772.658] (-778.003) (-772.762) -- 0:00:22
637500 -- (-771.845) (-771.401) (-774.378) [-776.997] * (-772.663) (-772.310) (-780.799) [-773.899] -- 0:00:22
638000 -- [-773.788] (-772.075) (-775.030) (-774.984) * (-773.104) [-774.105] (-772.042) (-775.771) -- 0:00:22
638500 -- (-775.815) [-774.337] (-772.806) (-774.645) * (-773.913) (-773.238) [-773.188] (-774.145) -- 0:00:22
639000 -- [-773.747] (-776.964) (-772.291) (-774.971) * (-772.486) (-771.511) (-772.385) [-774.333] -- 0:00:22
639500 -- (-773.692) (-773.774) (-774.609) [-772.071] * (-772.377) (-775.385) (-772.792) [-772.163] -- 0:00:21
640000 -- [-773.096] (-772.895) (-773.543) (-774.093) * (-772.671) (-773.683) [-772.115] (-772.689) -- 0:00:21
Average standard deviation of split frequencies: 0.008784
640500 -- (-773.505) (-774.844) (-774.079) [-772.656] * (-774.981) (-776.826) (-778.865) [-774.150] -- 0:00:21
641000 -- (-773.115) (-771.919) [-771.937] (-772.739) * [-773.667] (-773.734) (-777.823) (-774.851) -- 0:00:21
641500 -- (-773.087) (-774.254) [-771.930] (-774.422) * [-774.360] (-776.535) (-775.924) (-772.647) -- 0:00:21
642000 -- (-774.819) [-775.975] (-772.873) (-774.682) * (-776.009) (-774.027) [-774.035] (-771.678) -- 0:00:21
642500 -- (-775.681) (-774.362) [-774.736] (-776.596) * [-774.673] (-774.557) (-773.955) (-771.346) -- 0:00:21
643000 -- (-773.028) (-772.858) (-775.377) [-772.916] * (-771.432) (-773.441) (-775.754) [-771.845] -- 0:00:21
643500 -- [-775.567] (-773.369) (-772.805) (-774.869) * (-771.428) [-773.328] (-783.018) (-772.816) -- 0:00:21
644000 -- (-777.444) (-774.063) (-775.508) [-772.137] * [-772.852] (-772.605) (-780.188) (-774.254) -- 0:00:21
644500 -- (-771.832) (-773.396) [-773.172] (-778.602) * (-774.335) (-771.432) (-783.433) [-772.575] -- 0:00:21
645000 -- [-775.894] (-776.084) (-772.261) (-774.897) * (-773.303) (-772.721) (-772.345) [-772.670] -- 0:00:21
Average standard deviation of split frequencies: 0.008711
645500 -- (-774.014) [-773.573] (-774.366) (-773.161) * (-772.175) (-772.616) [-772.648] (-776.778) -- 0:00:21
646000 -- (-773.062) (-777.455) (-771.775) [-772.736] * [-772.992] (-771.918) (-773.206) (-773.535) -- 0:00:21
646500 -- (-771.541) [-780.149] (-774.390) (-773.015) * (-775.281) [-772.290] (-772.624) (-773.264) -- 0:00:21
647000 -- (-775.398) (-776.069) (-773.633) [-775.553] * [-772.402] (-773.132) (-774.269) (-772.098) -- 0:00:21
647500 -- (-773.381) [-772.766] (-773.756) (-772.997) * [-773.422] (-774.077) (-773.102) (-772.940) -- 0:00:21
648000 -- (-774.672) [-771.968] (-773.496) (-772.839) * (-774.400) (-774.524) [-773.008] (-772.761) -- 0:00:21
648500 -- (-773.646) (-774.186) [-774.028] (-773.494) * (-775.328) [-772.622] (-773.363) (-771.965) -- 0:00:21
649000 -- (-774.482) (-774.323) [-773.469] (-772.657) * (-773.426) (-774.349) [-772.557] (-773.783) -- 0:00:21
649500 -- (-773.198) [-772.071] (-772.360) (-778.580) * (-773.562) [-773.101] (-771.928) (-780.560) -- 0:00:21
650000 -- (-774.175) (-775.800) [-775.170] (-775.493) * (-772.923) (-773.176) [-775.497] (-773.580) -- 0:00:21
Average standard deviation of split frequencies: 0.009192
650500 -- (-774.345) (-774.872) (-777.779) [-775.229] * (-773.954) (-774.870) [-772.647] (-776.024) -- 0:00:21
651000 -- (-773.139) [-772.603] (-773.560) (-775.161) * [-773.393] (-772.712) (-774.985) (-780.020) -- 0:00:21
651500 -- (-773.405) (-775.722) (-774.384) [-775.139] * (-773.388) (-773.748) [-774.156] (-772.244) -- 0:00:21
652000 -- (-774.264) [-774.830] (-778.038) (-774.005) * [-778.340] (-778.513) (-776.747) (-772.036) -- 0:00:21
652500 -- [-773.258] (-779.899) (-775.707) (-774.014) * [-773.257] (-776.274) (-772.562) (-774.168) -- 0:00:21
653000 -- [-774.034] (-774.932) (-777.356) (-773.118) * [-776.539] (-773.119) (-773.077) (-776.793) -- 0:00:21
653500 -- (-773.386) (-771.332) (-775.469) [-771.838] * [-774.401] (-773.425) (-771.776) (-775.365) -- 0:00:21
654000 -- [-776.538] (-772.127) (-774.707) (-772.461) * (-774.725) (-775.542) [-773.393] (-773.967) -- 0:00:21
654500 -- (-775.345) [-778.742] (-775.116) (-779.072) * [-771.985] (-775.625) (-774.201) (-773.993) -- 0:00:21
655000 -- (-773.196) [-773.683] (-772.367) (-773.102) * (-772.739) (-772.173) [-772.805] (-773.013) -- 0:00:21
Average standard deviation of split frequencies: 0.009432
655500 -- (-773.178) (-774.384) [-773.247] (-773.699) * [-773.311] (-774.333) (-772.397) (-774.405) -- 0:00:21
656000 -- (-773.630) (-775.358) [-773.037] (-775.533) * (-774.676) [-773.853] (-775.283) (-774.853) -- 0:00:20
656500 -- (-778.872) (-773.113) (-774.795) [-772.306] * (-774.797) (-775.501) (-772.963) [-774.712] -- 0:00:20
657000 -- (-773.045) (-775.467) [-774.550] (-772.411) * (-773.968) [-772.240] (-774.604) (-772.600) -- 0:00:20
657500 -- (-779.291) [-773.768] (-774.471) (-773.271) * [-771.609] (-774.432) (-774.209) (-774.027) -- 0:00:20
658000 -- [-776.316] (-772.634) (-775.600) (-772.646) * (-771.617) [-776.783] (-776.740) (-773.098) -- 0:00:20
658500 -- [-772.566] (-773.097) (-772.192) (-772.780) * (-771.625) (-778.441) [-781.356] (-776.710) -- 0:00:20
659000 -- (-771.926) (-772.123) [-775.711] (-773.662) * (-773.606) (-780.780) (-776.528) [-772.428] -- 0:00:20
659500 -- (-771.303) (-772.266) [-773.677] (-773.993) * [-773.811] (-775.114) (-774.370) (-772.417) -- 0:00:20
660000 -- [-771.611] (-772.348) (-781.546) (-773.938) * [-773.884] (-775.417) (-776.455) (-774.584) -- 0:00:20
Average standard deviation of split frequencies: 0.009894
660500 -- (-773.588) (-771.887) [-777.492] (-773.452) * [-772.537] (-773.281) (-775.451) (-774.478) -- 0:00:20
661000 -- (-773.918) [-775.019] (-779.251) (-774.921) * [-773.388] (-775.319) (-777.358) (-772.677) -- 0:00:20
661500 -- (-772.077) [-774.838] (-773.996) (-773.985) * (-772.986) (-772.450) [-776.938] (-772.994) -- 0:00:20
662000 -- (-772.340) [-772.924] (-776.285) (-774.082) * [-771.590] (-772.077) (-772.703) (-774.143) -- 0:00:20
662500 -- (-777.790) (-772.792) [-778.118] (-774.427) * (-772.222) (-778.570) [-773.479] (-775.139) -- 0:00:20
663000 -- (-771.718) [-772.020] (-772.137) (-772.591) * [-772.179] (-776.716) (-775.549) (-774.391) -- 0:00:20
663500 -- [-772.613] (-772.839) (-771.697) (-772.780) * (-772.523) (-774.550) (-774.211) [-776.949] -- 0:00:20
664000 -- (-774.793) [-773.141] (-772.021) (-774.925) * [-772.266] (-773.287) (-776.171) (-774.967) -- 0:00:20
664500 -- (-775.047) (-771.770) (-775.406) [-775.467] * [-773.570] (-774.605) (-772.236) (-772.830) -- 0:00:20
665000 -- (-775.377) [-773.071] (-774.214) (-775.123) * (-772.751) (-773.130) [-772.247] (-771.968) -- 0:00:20
Average standard deviation of split frequencies: 0.010287
665500 -- (-773.618) (-775.076) (-775.571) [-772.708] * (-771.617) (-773.308) (-772.877) [-774.409] -- 0:00:20
666000 -- [-772.176] (-774.090) (-775.687) (-775.832) * [-779.679] (-773.635) (-776.673) (-772.609) -- 0:00:20
666500 -- (-776.882) (-774.335) (-773.516) [-774.021] * (-773.654) (-776.659) (-776.597) [-773.283] -- 0:00:20
667000 -- [-774.017] (-773.958) (-777.043) (-775.105) * (-773.376) [-780.645] (-775.110) (-771.764) -- 0:00:20
667500 -- (-773.497) (-777.810) (-777.020) [-772.867] * (-775.268) [-775.287] (-774.861) (-773.674) -- 0:00:20
668000 -- (-772.068) (-773.857) [-771.937] (-772.749) * [-773.693] (-773.039) (-771.559) (-773.825) -- 0:00:20
668500 -- (-771.824) (-771.756) [-773.982] (-774.191) * (-776.658) [-772.904] (-773.880) (-773.804) -- 0:00:20
669000 -- (-774.399) (-773.523) [-774.082] (-778.955) * (-771.811) (-772.919) [-773.229] (-773.095) -- 0:00:20
669500 -- (-772.789) (-772.432) (-773.811) [-773.267] * (-775.900) (-771.992) [-773.973] (-774.221) -- 0:00:20
670000 -- (-775.654) [-775.454] (-773.329) (-773.843) * (-774.095) [-773.076] (-773.384) (-775.243) -- 0:00:20
Average standard deviation of split frequencies: 0.010309
670500 -- (-772.638) (-772.510) [-775.515] (-772.859) * (-776.277) (-771.936) (-775.316) [-776.853] -- 0:00:20
671000 -- (-773.536) (-773.235) [-772.694] (-772.318) * (-776.208) [-771.634] (-772.321) (-774.412) -- 0:00:20
671500 -- (-777.131) (-773.824) (-772.509) [-774.186] * [-772.242] (-772.209) (-772.668) (-776.420) -- 0:00:20
672000 -- (-774.110) [-771.647] (-774.312) (-774.817) * (-772.350) (-773.474) [-772.375] (-775.583) -- 0:00:20
672500 -- (-772.101) [-776.171] (-774.076) (-774.684) * [-772.118] (-773.955) (-777.443) (-772.838) -- 0:00:19
673000 -- [-773.140] (-774.536) (-774.338) (-775.093) * (-772.432) (-773.506) (-773.239) [-773.199] -- 0:00:19
673500 -- (-772.164) (-777.779) (-773.668) [-773.531] * (-772.547) [-772.968] (-773.743) (-772.891) -- 0:00:19
674000 -- (-771.970) (-774.653) (-774.693) [-778.701] * [-775.614] (-772.359) (-774.797) (-776.071) -- 0:00:19
674500 -- (-774.999) (-772.398) (-773.501) [-773.054] * (-780.934) (-771.998) [-773.882] (-774.007) -- 0:00:19
675000 -- (-773.215) (-774.340) (-775.835) [-775.169] * [-774.070] (-773.249) (-772.766) (-774.878) -- 0:00:19
Average standard deviation of split frequencies: 0.010242
675500 -- [-772.547] (-775.379) (-774.868) (-771.588) * (-774.707) (-772.779) [-772.967] (-777.059) -- 0:00:19
676000 -- [-773.166] (-779.964) (-773.121) (-776.891) * [-773.121] (-771.915) (-774.880) (-775.388) -- 0:00:19
676500 -- (-776.476) (-779.263) [-772.979] (-773.918) * (-771.767) [-772.509] (-775.876) (-772.996) -- 0:00:19
677000 -- (-772.889) [-773.158] (-773.834) (-776.420) * (-773.105) [-772.146] (-773.414) (-772.867) -- 0:00:19
677500 -- (-772.705) (-775.892) [-776.943] (-772.260) * (-776.011) (-772.005) (-772.352) [-772.950] -- 0:00:19
678000 -- (-777.223) (-774.205) [-773.156] (-774.029) * (-772.337) [-773.459] (-776.205) (-771.524) -- 0:00:19
678500 -- (-774.138) (-774.287) [-774.013] (-775.279) * [-775.798] (-776.698) (-775.234) (-774.941) -- 0:00:19
679000 -- [-772.564] (-775.004) (-773.895) (-773.769) * (-775.490) [-776.165] (-777.346) (-775.557) -- 0:00:19
679500 -- (-773.062) (-774.326) (-773.411) [-773.602] * [-773.179] (-775.001) (-776.561) (-774.860) -- 0:00:19
680000 -- (-773.762) (-776.920) (-772.611) [-772.504] * (-774.262) [-774.746] (-774.840) (-771.735) -- 0:00:19
Average standard deviation of split frequencies: 0.009826
680500 -- (-772.422) (-774.143) [-772.709] (-772.881) * (-777.694) (-774.032) (-774.746) [-772.701] -- 0:00:19
681000 -- [-775.385] (-774.887) (-775.584) (-775.724) * (-772.688) (-772.405) [-772.649] (-773.168) -- 0:00:19
681500 -- [-773.715] (-774.239) (-777.400) (-774.294) * [-772.281] (-773.888) (-772.612) (-773.291) -- 0:00:19
682000 -- [-776.685] (-772.790) (-773.740) (-773.632) * (-772.630) [-775.031] (-772.909) (-774.335) -- 0:00:19
682500 -- (-774.476) [-772.731] (-776.305) (-776.538) * (-773.088) [-774.082] (-773.166) (-772.637) -- 0:00:19
683000 -- [-774.616] (-773.366) (-776.610) (-774.206) * [-774.394] (-772.124) (-777.606) (-772.196) -- 0:00:19
683500 -- [-774.514] (-775.055) (-774.852) (-773.981) * (-775.269) [-775.776] (-773.414) (-773.509) -- 0:00:19
684000 -- [-774.236] (-776.600) (-774.190) (-778.281) * (-772.987) [-771.348] (-773.544) (-777.944) -- 0:00:19
684500 -- (-773.984) [-775.490] (-772.571) (-775.248) * (-773.757) (-776.138) (-772.099) [-774.651] -- 0:00:19
685000 -- (-778.219) [-773.860] (-775.091) (-775.143) * (-773.444) (-773.102) (-772.080) [-772.609] -- 0:00:19
Average standard deviation of split frequencies: 0.009792
685500 -- (-775.553) [-774.964] (-776.655) (-774.383) * (-775.138) (-771.880) [-774.979] (-775.274) -- 0:00:19
686000 -- (-776.079) (-776.693) [-771.982] (-775.411) * (-779.347) (-773.958) (-775.698) [-773.080] -- 0:00:19
686500 -- (-778.477) (-772.045) [-772.587] (-774.390) * (-775.091) (-773.904) (-774.853) [-772.639] -- 0:00:19
687000 -- (-771.697) (-772.091) [-771.864] (-774.059) * (-773.588) (-774.816) (-775.632) [-773.527] -- 0:00:19
687500 -- (-774.810) (-772.375) [-773.431] (-774.646) * (-773.067) [-777.119] (-773.517) (-772.005) -- 0:00:19
688000 -- (-773.823) [-772.969] (-776.969) (-776.658) * [-771.950] (-775.897) (-778.724) (-774.115) -- 0:00:19
688500 -- [-773.561] (-773.031) (-777.768) (-776.746) * (-776.303) [-772.872] (-773.847) (-774.530) -- 0:00:19
689000 -- (-774.545) [-771.647] (-777.277) (-777.946) * [-771.772] (-777.665) (-774.152) (-775.678) -- 0:00:18
689500 -- (-773.903) (-774.610) (-774.427) [-774.533] * (-775.274) (-777.080) (-774.618) [-775.595] -- 0:00:18
690000 -- (-773.667) [-773.799] (-772.228) (-772.920) * (-773.940) (-773.489) [-773.342] (-774.607) -- 0:00:18
Average standard deviation of split frequencies: 0.009769
690500 -- (-772.409) [-775.459] (-773.589) (-773.589) * (-774.710) (-771.561) (-775.300) [-774.304] -- 0:00:18
691000 -- (-776.651) [-774.222] (-773.218) (-773.774) * (-772.583) (-772.850) (-772.195) [-776.182] -- 0:00:18
691500 -- (-773.090) (-777.823) [-771.883] (-772.375) * [-772.211] (-773.265) (-773.398) (-776.870) -- 0:00:18
692000 -- (-773.441) (-775.138) [-772.746] (-773.918) * (-773.515) (-774.275) (-772.322) [-771.922] -- 0:00:18
692500 -- (-780.807) (-774.494) (-775.102) [-772.988] * [-772.364] (-774.957) (-774.468) (-773.492) -- 0:00:18
693000 -- (-774.530) (-773.527) [-772.636] (-773.384) * (-775.890) (-779.200) (-774.889) [-775.178] -- 0:00:18
693500 -- [-774.807] (-773.161) (-772.589) (-772.091) * (-778.616) (-777.260) [-774.961] (-776.359) -- 0:00:18
694000 -- [-774.280] (-773.253) (-773.095) (-772.937) * [-774.745] (-775.418) (-772.876) (-774.701) -- 0:00:18
694500 -- (-773.078) (-776.965) [-772.852] (-774.775) * (-772.892) (-774.867) [-772.819] (-772.696) -- 0:00:18
695000 -- [-777.189] (-772.104) (-776.071) (-771.877) * [-774.376] (-776.060) (-773.404) (-773.030) -- 0:00:18
Average standard deviation of split frequencies: 0.009271
695500 -- [-772.882] (-772.239) (-778.160) (-772.754) * (-777.212) [-774.879] (-771.865) (-771.709) -- 0:00:18
696000 -- (-776.047) (-774.782) [-775.444] (-773.605) * [-774.853] (-774.416) (-775.459) (-773.036) -- 0:00:18
696500 -- (-771.844) (-772.657) [-776.139] (-772.249) * (-776.500) (-776.029) (-771.810) [-774.290] -- 0:00:18
697000 -- (-774.966) [-773.211] (-775.091) (-774.025) * (-775.234) (-773.225) [-775.811] (-773.463) -- 0:00:18
697500 -- (-775.225) (-773.540) (-775.308) [-773.746] * (-775.003) [-774.754] (-774.190) (-772.625) -- 0:00:18
698000 -- (-774.662) (-776.077) [-776.783] (-773.011) * (-773.988) [-775.382] (-771.766) (-771.810) -- 0:00:18
698500 -- (-779.332) (-777.144) (-774.741) [-772.499] * [-772.033] (-773.733) (-772.273) (-774.076) -- 0:00:18
699000 -- (-773.047) [-774.393] (-773.813) (-782.551) * (-772.155) [-775.730] (-773.593) (-775.857) -- 0:00:18
699500 -- (-774.960) (-772.941) (-778.833) [-778.615] * (-772.395) (-773.356) [-775.650] (-775.370) -- 0:00:18
700000 -- [-773.454] (-773.011) (-773.945) (-772.292) * (-772.048) (-774.602) [-773.222] (-772.165) -- 0:00:18
Average standard deviation of split frequencies: 0.009195
700500 -- (-776.238) (-776.110) (-773.331) [-772.751] * (-775.044) (-772.511) (-772.811) [-773.693] -- 0:00:18
701000 -- [-772.640] (-776.402) (-776.879) (-772.817) * [-772.213] (-772.419) (-772.950) (-773.058) -- 0:00:18
701500 -- [-774.090] (-777.111) (-775.653) (-773.901) * (-774.948) [-772.515] (-773.188) (-772.104) -- 0:00:18
702000 -- (-773.876) (-772.439) (-773.003) [-773.020] * (-774.340) [-772.277] (-773.004) (-774.355) -- 0:00:18
702500 -- (-772.443) [-774.673] (-775.288) (-774.424) * [-774.528] (-773.838) (-773.492) (-772.677) -- 0:00:18
703000 -- (-772.579) (-772.815) (-775.769) [-773.130] * (-773.183) (-772.943) [-773.316] (-773.359) -- 0:00:18
703500 -- [-772.632] (-776.838) (-776.695) (-776.855) * (-773.868) [-774.562] (-773.604) (-774.185) -- 0:00:18
704000 -- [-773.291] (-774.722) (-773.409) (-775.892) * (-774.811) (-775.149) [-773.110] (-774.363) -- 0:00:18
704500 -- (-773.181) (-775.840) [-774.252] (-774.468) * (-777.486) (-772.751) (-775.420) [-772.358] -- 0:00:18
705000 -- (-773.874) [-773.394] (-773.428) (-771.848) * (-773.292) (-774.830) (-771.580) [-771.708] -- 0:00:17
Average standard deviation of split frequencies: 0.008764
705500 -- [-774.158] (-777.230) (-775.447) (-772.747) * (-773.840) [-773.950] (-772.157) (-773.859) -- 0:00:17
706000 -- (-774.094) (-778.672) [-774.354] (-775.385) * (-771.844) [-776.396] (-773.139) (-773.356) -- 0:00:17
706500 -- [-772.200] (-777.889) (-774.571) (-775.404) * (-772.719) [-772.059] (-772.889) (-781.785) -- 0:00:17
707000 -- (-773.256) [-773.583] (-773.627) (-772.151) * (-771.769) (-772.670) [-774.153] (-776.985) -- 0:00:17
707500 -- (-771.873) [-773.133] (-774.588) (-772.720) * (-774.436) (-772.392) (-775.913) [-774.548] -- 0:00:17
708000 -- (-772.571) [-774.290] (-774.620) (-773.589) * [-774.505] (-773.863) (-773.048) (-775.346) -- 0:00:17
708500 -- [-774.125] (-773.911) (-773.710) (-774.529) * (-777.092) [-772.379] (-776.133) (-773.353) -- 0:00:17
709000 -- (-774.311) [-773.210] (-773.908) (-774.382) * [-774.338] (-773.369) (-775.171) (-772.275) -- 0:00:17
709500 -- (-772.592) [-773.023] (-774.772) (-773.206) * (-775.195) (-775.256) [-773.893] (-772.122) -- 0:00:17
710000 -- (-771.887) (-773.162) (-776.560) [-773.843] * (-774.722) [-772.232] (-775.676) (-772.692) -- 0:00:17
Average standard deviation of split frequencies: 0.008889
710500 -- [-771.626] (-772.043) (-776.634) (-774.048) * [-776.572] (-773.988) (-773.843) (-772.631) -- 0:00:17
711000 -- [-774.033] (-774.385) (-772.830) (-775.089) * (-775.691) (-773.139) (-772.576) [-772.244] -- 0:00:17
711500 -- (-771.986) (-776.225) [-773.945] (-774.413) * (-774.657) [-772.810] (-772.797) (-774.421) -- 0:00:17
712000 -- (-777.309) (-778.028) (-773.888) [-772.049] * [-773.557] (-774.267) (-772.715) (-777.980) -- 0:00:17
712500 -- (-774.479) (-775.993) (-776.035) [-773.789] * (-779.866) (-772.893) (-772.291) [-776.474] -- 0:00:17
713000 -- (-774.676) (-775.295) (-773.114) [-773.394] * (-773.484) (-775.198) [-772.767] (-777.703) -- 0:00:17
713500 -- (-773.759) (-775.648) (-777.178) [-774.011] * (-773.544) (-771.671) [-775.615] (-774.558) -- 0:00:17
714000 -- (-773.085) (-775.691) [-771.918] (-773.414) * (-775.355) (-773.922) [-774.038] (-775.467) -- 0:00:17
714500 -- (-773.040) (-774.212) (-773.238) [-776.760] * [-772.474] (-772.808) (-774.303) (-773.711) -- 0:00:17
715000 -- (-777.008) [-773.055] (-773.003) (-775.344) * [-772.939] (-775.842) (-775.763) (-774.660) -- 0:00:17
Average standard deviation of split frequencies: 0.009042
715500 -- (-772.772) [-772.858] (-774.385) (-775.343) * (-775.326) [-771.758] (-773.734) (-773.776) -- 0:00:17
716000 -- (-773.583) (-774.573) (-773.820) [-775.234] * (-774.159) (-773.423) (-775.551) [-772.121] -- 0:00:17
716500 -- [-774.184] (-774.147) (-776.023) (-772.668) * (-774.900) (-772.128) (-774.885) [-773.454] -- 0:00:17
717000 -- [-772.442] (-775.249) (-776.935) (-772.206) * (-774.633) (-774.727) (-773.145) [-773.005] -- 0:00:17
717500 -- (-775.185) [-773.526] (-773.716) (-772.259) * [-773.097] (-775.060) (-772.919) (-772.480) -- 0:00:17
718000 -- (-773.142) (-777.125) [-773.603] (-774.586) * (-775.935) (-771.945) (-772.335) [-772.448] -- 0:00:17
718500 -- (-772.415) (-775.738) (-773.727) [-775.017] * (-773.466) [-774.124] (-773.058) (-771.597) -- 0:00:17
719000 -- (-773.379) (-773.305) (-778.978) [-773.711] * [-774.248] (-772.804) (-773.406) (-772.962) -- 0:00:17
719500 -- (-773.144) [-772.409] (-773.447) (-772.566) * (-777.117) (-773.454) [-773.987] (-772.828) -- 0:00:17
720000 -- (-772.517) (-773.368) [-772.476] (-772.835) * [-775.635] (-775.413) (-773.093) (-773.257) -- 0:00:17
Average standard deviation of split frequencies: 0.008852
720500 -- (-776.640) (-773.328) (-775.274) [-772.608] * [-773.146] (-774.366) (-773.115) (-772.916) -- 0:00:17
721000 -- [-775.178] (-773.802) (-772.329) (-772.041) * (-773.351) (-772.403) [-776.725] (-772.728) -- 0:00:17
721500 -- (-773.068) (-774.031) (-775.979) [-772.201] * (-774.688) (-776.115) (-773.001) [-772.541] -- 0:00:16
722000 -- (-774.052) (-780.250) [-773.374] (-773.694) * (-772.134) (-771.633) [-775.852] (-774.032) -- 0:00:16
722500 -- (-773.379) (-780.249) [-773.783] (-772.965) * (-773.992) (-774.155) (-774.662) [-776.355] -- 0:00:16
723000 -- (-773.258) (-774.394) (-773.145) [-773.474] * (-775.847) (-772.626) (-775.038) [-772.651] -- 0:00:16
723500 -- (-772.301) (-772.614) [-773.107] (-771.951) * [-774.564] (-774.812) (-777.542) (-774.432) -- 0:00:16
724000 -- (-773.221) [-772.628] (-771.981) (-773.505) * (-773.813) [-772.820] (-773.310) (-772.436) -- 0:00:16
724500 -- (-772.374) [-773.804] (-773.340) (-772.491) * (-773.543) (-773.003) [-772.155] (-774.339) -- 0:00:16
725000 -- [-772.415] (-774.311) (-775.134) (-772.210) * (-772.405) (-771.758) [-772.492] (-776.481) -- 0:00:16
Average standard deviation of split frequencies: 0.008787
725500 -- (-773.670) (-775.858) [-773.242] (-773.226) * [-773.820] (-771.753) (-775.896) (-773.721) -- 0:00:16
726000 -- (-773.326) [-772.873] (-773.841) (-774.637) * (-776.066) [-774.590] (-773.534) (-774.036) -- 0:00:16
726500 -- (-774.797) (-773.283) [-773.154] (-774.717) * (-774.934) [-774.218] (-776.488) (-776.297) -- 0:00:16
727000 -- [-772.577] (-771.627) (-773.685) (-775.462) * (-777.453) (-773.554) [-773.872] (-771.437) -- 0:00:16
727500 -- (-774.601) (-773.970) (-773.957) [-776.115] * (-773.721) [-772.718] (-773.487) (-772.977) -- 0:00:16
728000 -- (-772.748) (-771.642) [-774.573] (-774.794) * [-774.517] (-778.723) (-776.488) (-775.444) -- 0:00:16
728500 -- [-772.465] (-772.320) (-775.164) (-775.760) * (-772.767) (-774.901) (-775.176) [-772.824] -- 0:00:16
729000 -- (-777.210) (-772.347) (-775.858) [-772.712] * [-773.094] (-773.962) (-772.801) (-772.400) -- 0:00:16
729500 -- (-773.618) (-775.381) [-773.993] (-774.429) * (-775.819) (-775.318) (-771.987) [-775.488] -- 0:00:16
730000 -- (-773.464) [-774.140] (-774.174) (-772.421) * [-773.576] (-781.263) (-776.258) (-774.990) -- 0:00:16
Average standard deviation of split frequencies: 0.008344
730500 -- [-772.918] (-772.290) (-776.247) (-773.018) * [-774.812] (-778.766) (-779.434) (-773.590) -- 0:00:16
731000 -- (-773.703) (-771.733) (-775.485) [-772.449] * (-773.465) (-774.953) (-774.196) [-773.721] -- 0:00:16
731500 -- (-774.532) [-773.643] (-776.546) (-773.181) * (-774.663) [-778.549] (-775.410) (-775.657) -- 0:00:16
732000 -- [-773.282] (-773.646) (-773.612) (-775.474) * (-779.741) (-774.416) (-775.432) [-773.846] -- 0:00:16
732500 -- (-774.034) (-772.538) [-774.809] (-776.952) * (-779.855) (-772.716) [-771.581] (-774.338) -- 0:00:16
733000 -- [-771.758] (-772.254) (-773.790) (-776.399) * [-776.705] (-772.873) (-771.429) (-774.120) -- 0:00:16
733500 -- (-780.947) (-778.822) [-776.402] (-775.049) * (-774.144) (-775.598) (-772.763) [-771.842] -- 0:00:16
734000 -- (-774.488) (-774.625) [-772.132] (-776.059) * (-774.835) (-774.309) (-772.670) [-773.414] -- 0:00:16
734500 -- (-771.986) [-771.711] (-772.249) (-772.005) * (-774.661) (-777.076) [-774.246] (-775.966) -- 0:00:16
735000 -- (-781.215) [-772.459] (-773.647) (-772.441) * (-775.095) (-771.882) [-772.548] (-775.321) -- 0:00:16
Average standard deviation of split frequencies: 0.008668
735500 -- (-774.104) (-776.995) [-773.825] (-771.991) * (-775.736) (-771.371) (-774.235) [-773.059] -- 0:00:16
736000 -- [-775.773] (-777.879) (-775.660) (-776.435) * [-776.085] (-771.611) (-774.868) (-774.111) -- 0:00:16
736500 -- (-772.888) (-774.814) (-776.534) [-773.701] * (-772.919) [-773.863] (-773.042) (-772.831) -- 0:00:16
737000 -- (-773.228) (-777.314) (-776.772) [-773.277] * [-772.923] (-774.353) (-773.154) (-774.462) -- 0:00:16
737500 -- (-777.910) (-774.045) (-772.755) [-774.013] * (-774.529) [-773.013] (-774.027) (-775.028) -- 0:00:16
738000 -- (-775.779) [-777.696] (-772.018) (-772.999) * (-773.338) (-774.662) [-775.297] (-773.375) -- 0:00:15
738500 -- (-772.869) (-773.186) (-772.479) [-774.281] * (-773.120) (-773.523) [-774.107] (-776.965) -- 0:00:15
739000 -- (-772.480) (-773.187) (-775.088) [-771.726] * [-774.177] (-773.769) (-777.968) (-772.407) -- 0:00:15
739500 -- (-772.903) [-777.032] (-774.900) (-773.554) * (-774.129) (-773.179) (-775.019) [-772.825] -- 0:00:15
740000 -- [-772.010] (-776.481) (-772.411) (-773.677) * (-774.525) (-773.803) [-772.508] (-778.870) -- 0:00:15
Average standard deviation of split frequencies: 0.008444
740500 -- [-773.111] (-775.495) (-772.355) (-774.433) * (-774.007) [-772.880] (-773.657) (-772.566) -- 0:00:15
741000 -- (-774.222) (-771.943) [-772.205] (-776.456) * (-773.011) [-775.507] (-773.694) (-772.711) -- 0:00:15
741500 -- (-773.674) (-775.579) [-772.400] (-772.881) * (-772.613) (-774.534) [-772.831] (-772.484) -- 0:00:15
742000 -- (-777.047) (-775.336) [-775.219] (-773.055) * (-772.694) (-775.050) [-771.490] (-775.702) -- 0:00:15
742500 -- (-775.462) (-773.985) (-776.679) [-772.945] * [-773.061] (-776.559) (-772.738) (-776.164) -- 0:00:15
743000 -- (-772.519) (-774.402) (-775.612) [-771.986] * [-772.392] (-775.851) (-778.029) (-773.090) -- 0:00:15
743500 -- (-772.870) (-774.752) (-775.506) [-773.306] * [-775.099] (-773.244) (-775.432) (-773.505) -- 0:00:15
744000 -- (-772.973) (-778.572) [-772.174] (-773.292) * (-773.343) (-777.295) [-777.292] (-775.626) -- 0:00:15
744500 -- (-773.383) (-774.492) [-772.734] (-772.898) * (-774.864) (-776.310) [-773.654] (-772.354) -- 0:00:15
745000 -- [-776.361] (-772.811) (-772.562) (-773.354) * (-774.449) (-774.338) [-772.444] (-771.916) -- 0:00:15
Average standard deviation of split frequencies: 0.008491
745500 -- (-772.251) (-774.241) [-774.707] (-775.190) * [-774.215] (-775.130) (-772.493) (-771.860) -- 0:00:15
746000 -- (-771.555) (-772.558) [-771.796] (-778.561) * (-775.817) (-775.837) (-772.394) [-773.961] -- 0:00:15
746500 -- (-772.104) [-773.632] (-774.164) (-775.438) * [-772.979] (-779.571) (-772.199) (-772.416) -- 0:00:15
747000 -- [-772.998] (-773.028) (-773.413) (-773.503) * [-771.853] (-772.676) (-777.428) (-771.727) -- 0:00:15
747500 -- (-771.688) (-773.929) (-772.637) [-773.803] * (-772.575) (-774.363) [-772.133] (-773.658) -- 0:00:15
748000 -- (-771.965) [-773.108] (-776.791) (-773.269) * (-773.444) [-778.146] (-772.437) (-773.291) -- 0:00:15
748500 -- (-773.273) (-773.482) (-778.462) [-773.622] * (-772.610) (-780.016) (-772.950) [-773.110] -- 0:00:15
749000 -- [-774.030] (-774.869) (-775.149) (-773.770) * (-772.836) (-774.505) [-774.599] (-774.306) -- 0:00:15
749500 -- (-774.836) (-774.476) [-776.082] (-775.574) * [-774.449] (-773.926) (-774.312) (-775.302) -- 0:00:15
750000 -- (-772.329) [-777.357] (-773.368) (-772.900) * (-780.313) [-777.328] (-773.609) (-777.573) -- 0:00:15
Average standard deviation of split frequencies: 0.008399
750500 -- (-772.403) [-774.470] (-772.564) (-774.725) * (-775.723) [-773.245] (-771.740) (-773.178) -- 0:00:15
751000 -- (-775.142) (-772.488) [-771.754] (-774.951) * (-773.876) (-773.266) [-775.867] (-774.459) -- 0:00:15
751500 -- (-775.054) [-772.057] (-774.214) (-772.079) * [-773.846] (-774.125) (-774.594) (-779.720) -- 0:00:15
752000 -- (-773.445) [-772.169] (-774.214) (-773.395) * [-772.430] (-776.558) (-774.935) (-773.902) -- 0:00:15
752500 -- (-773.650) (-772.412) (-772.227) [-771.860] * [-772.717] (-773.626) (-772.055) (-775.618) -- 0:00:15
753000 -- (-776.333) [-775.735] (-772.520) (-771.711) * (-774.432) [-773.424] (-771.504) (-774.327) -- 0:00:15
753500 -- [-775.036] (-772.925) (-773.910) (-772.260) * (-773.276) [-771.809] (-772.056) (-775.641) -- 0:00:15
754000 -- (-777.411) [-774.972] (-777.582) (-780.702) * (-773.100) (-774.729) (-774.596) [-773.547] -- 0:00:15
754500 -- (-775.730) (-774.983) (-775.086) [-772.268] * (-772.722) (-777.024) [-774.429] (-772.950) -- 0:00:14
755000 -- (-777.702) (-777.951) (-773.052) [-773.067] * [-773.253] (-778.694) (-772.684) (-773.029) -- 0:00:14
Average standard deviation of split frequencies: 0.008065
755500 -- [-776.643] (-772.937) (-773.604) (-774.630) * [-774.693] (-773.352) (-772.097) (-773.720) -- 0:00:14
756000 -- (-773.713) (-773.242) [-772.178] (-772.303) * (-773.566) [-776.238] (-772.757) (-774.969) -- 0:00:14
756500 -- (-774.802) (-775.818) [-774.412] (-777.360) * (-774.828) [-776.512] (-774.950) (-775.368) -- 0:00:14
757000 -- (-771.870) (-772.946) [-772.165] (-774.294) * (-772.822) [-772.313] (-776.422) (-774.981) -- 0:00:14
757500 -- (-772.871) (-773.779) [-773.375] (-774.645) * (-773.264) [-772.187] (-776.625) (-774.166) -- 0:00:14
758000 -- (-773.658) (-771.953) [-773.713] (-775.748) * [-772.246] (-771.664) (-773.692) (-772.914) -- 0:00:14
758500 -- (-773.914) [-772.636] (-774.326) (-773.007) * (-774.236) (-773.555) [-772.023] (-772.349) -- 0:00:14
759000 -- (-771.675) [-774.555] (-774.081) (-772.596) * (-777.330) [-772.168] (-775.085) (-775.889) -- 0:00:14
759500 -- (-774.009) (-773.517) (-773.627) [-772.539] * (-774.217) (-772.638) [-773.363] (-774.333) -- 0:00:14
760000 -- [-774.837] (-772.194) (-772.669) (-774.234) * (-772.499) [-774.429] (-774.849) (-771.876) -- 0:00:14
Average standard deviation of split frequencies: 0.007519
760500 -- (-776.016) (-771.751) (-774.293) [-772.854] * (-772.936) [-776.824] (-775.333) (-774.019) -- 0:00:14
761000 -- (-773.682) [-773.449] (-774.060) (-774.356) * (-775.647) (-774.967) (-777.031) [-776.666] -- 0:00:14
761500 -- (-773.167) [-773.421] (-779.270) (-772.806) * [-774.446] (-772.935) (-773.812) (-776.483) -- 0:00:14
762000 -- (-772.636) (-771.534) [-774.832] (-773.888) * (-775.675) [-772.815] (-775.045) (-773.888) -- 0:00:14
762500 -- [-771.658] (-772.593) (-778.136) (-774.632) * [-772.982] (-771.530) (-773.840) (-772.489) -- 0:00:14
763000 -- (-771.819) (-774.811) [-773.839] (-773.362) * (-771.898) (-773.659) (-773.716) [-771.748] -- 0:00:14
763500 -- (-773.676) [-773.985] (-773.983) (-772.320) * (-773.866) (-774.951) [-777.931] (-771.425) -- 0:00:14
764000 -- (-772.333) (-774.787) (-772.814) [-772.605] * (-772.990) (-772.385) (-773.818) [-771.886] -- 0:00:14
764500 -- (-775.947) (-772.914) (-773.110) [-774.088] * (-773.264) [-773.939] (-778.389) (-773.904) -- 0:00:14
765000 -- [-779.198] (-773.365) (-773.982) (-776.429) * [-776.058] (-781.262) (-778.799) (-771.777) -- 0:00:14
Average standard deviation of split frequencies: 0.007693
765500 -- (-777.380) (-775.542) (-772.966) [-772.916] * (-771.754) (-772.568) [-776.017] (-772.977) -- 0:00:14
766000 -- (-777.066) (-775.031) (-774.262) [-774.349] * (-773.591) [-773.682] (-775.316) (-774.746) -- 0:00:14
766500 -- (-774.045) (-773.965) [-779.140] (-773.937) * (-772.149) [-774.143] (-773.815) (-774.069) -- 0:00:14
767000 -- [-773.607] (-774.057) (-773.826) (-773.306) * (-775.084) (-774.200) (-772.856) [-774.281] -- 0:00:14
767500 -- (-773.935) (-772.675) (-777.693) [-772.210] * (-773.594) (-774.231) (-772.555) [-772.774] -- 0:00:14
768000 -- (-774.123) (-773.443) [-779.527] (-777.913) * [-773.245] (-774.554) (-775.243) (-772.705) -- 0:00:14
768500 -- [-773.388] (-773.895) (-772.260) (-777.904) * (-773.774) (-777.164) [-774.950] (-776.795) -- 0:00:14
769000 -- (-775.673) (-776.046) (-771.804) [-773.019] * (-779.564) (-774.283) (-772.531) [-777.394] -- 0:00:14
769500 -- (-773.681) [-773.422] (-773.754) (-773.106) * (-776.019) (-777.565) [-772.981] (-778.417) -- 0:00:14
770000 -- (-775.280) (-772.224) (-774.320) [-772.879] * (-775.187) (-772.211) (-772.243) [-774.768] -- 0:00:14
Average standard deviation of split frequencies: 0.008156
770500 -- (-775.111) [-774.444] (-775.748) (-773.925) * [-774.460] (-772.723) (-776.070) (-772.466) -- 0:00:13
771000 -- (-772.238) (-771.635) (-775.371) [-774.198] * [-778.504] (-772.567) (-772.269) (-773.115) -- 0:00:13
771500 -- (-774.915) (-774.202) [-773.729] (-776.687) * (-777.515) (-772.010) (-773.042) [-771.482] -- 0:00:13
772000 -- (-772.580) (-774.637) [-773.660] (-773.317) * (-773.108) [-772.717] (-771.752) (-771.510) -- 0:00:13
772500 -- (-773.143) (-775.718) [-772.570] (-778.713) * [-772.875] (-773.861) (-774.205) (-775.251) -- 0:00:13
773000 -- (-776.532) (-774.244) [-772.643] (-779.217) * (-772.264) [-775.768] (-777.170) (-773.415) -- 0:00:13
773500 -- [-772.718] (-773.886) (-773.904) (-771.697) * (-773.924) (-778.975) [-772.861] (-774.235) -- 0:00:13
774000 -- (-772.274) (-775.457) [-776.993] (-774.425) * (-779.425) [-774.705] (-776.035) (-773.062) -- 0:00:13
774500 -- (-774.122) (-773.305) [-775.975] (-775.083) * [-773.094] (-775.960) (-774.359) (-772.996) -- 0:00:13
775000 -- (-772.986) (-773.106) [-772.097] (-775.658) * (-772.599) (-772.860) [-772.218] (-774.710) -- 0:00:13
Average standard deviation of split frequencies: 0.008059
775500 -- (-772.610) (-775.034) (-774.877) [-776.307] * (-773.448) [-772.488] (-772.655) (-774.511) -- 0:00:13
776000 -- [-774.513] (-773.939) (-773.506) (-776.290) * (-773.588) [-771.920] (-775.987) (-775.566) -- 0:00:13
776500 -- (-773.631) [-774.761] (-774.770) (-771.599) * (-774.896) (-773.542) (-774.875) [-772.938] -- 0:00:13
777000 -- (-773.986) [-773.496] (-775.088) (-772.895) * (-772.726) [-772.803] (-776.024) (-772.458) -- 0:00:13
777500 -- (-775.924) [-774.508] (-776.152) (-771.974) * (-772.739) (-773.017) [-773.464] (-773.203) -- 0:00:13
778000 -- (-777.771) (-772.154) (-774.128) [-771.693] * (-774.327) (-777.638) (-773.759) [-774.254] -- 0:00:13
778500 -- [-775.183] (-776.772) (-774.176) (-773.393) * (-772.616) (-771.802) (-774.889) [-772.930] -- 0:00:13
779000 -- (-772.233) [-775.524] (-774.584) (-774.814) * (-773.349) [-772.364] (-773.164) (-773.750) -- 0:00:13
779500 -- (-773.775) (-773.484) [-772.739] (-775.257) * (-778.514) [-772.884] (-773.064) (-775.075) -- 0:00:13
780000 -- (-773.616) (-773.786) [-774.112] (-772.999) * (-775.068) [-774.585] (-775.995) (-772.171) -- 0:00:13
Average standard deviation of split frequencies: 0.008333
780500 -- (-775.348) [-771.872] (-775.566) (-775.445) * [-773.508] (-776.799) (-775.139) (-772.744) -- 0:00:13
781000 -- (-776.629) (-771.752) [-775.475] (-775.517) * [-774.011] (-774.498) (-777.490) (-772.216) -- 0:00:13
781500 -- (-772.593) [-772.204] (-772.850) (-772.385) * (-772.383) (-774.739) (-775.983) [-772.452] -- 0:00:13
782000 -- (-772.211) (-772.000) [-773.148] (-771.744) * (-772.679) (-776.393) (-772.236) [-773.289] -- 0:00:13
782500 -- (-773.095) (-773.969) [-771.995] (-772.459) * (-773.245) (-773.837) [-774.905] (-772.899) -- 0:00:13
783000 -- (-772.150) [-775.088] (-773.620) (-779.104) * (-775.273) (-779.221) [-777.095] (-772.846) -- 0:00:13
783500 -- (-777.292) (-772.941) [-772.944] (-773.343) * (-774.068) (-773.459) [-774.381] (-772.064) -- 0:00:13
784000 -- (-771.763) [-775.515] (-772.599) (-774.936) * (-772.331) [-772.673] (-773.576) (-772.050) -- 0:00:13
784500 -- (-772.865) (-773.278) [-772.202] (-771.654) * (-773.303) [-776.128] (-773.761) (-771.908) -- 0:00:13
785000 -- (-772.747) [-774.442] (-772.613) (-772.345) * [-776.324] (-772.876) (-773.285) (-773.197) -- 0:00:13
Average standard deviation of split frequencies: 0.007957
785500 -- (-772.774) (-772.465) (-772.589) [-773.059] * (-772.498) (-774.981) (-773.973) [-774.472] -- 0:00:13
786000 -- (-772.483) [-774.219] (-775.149) (-772.955) * (-772.171) (-776.161) (-776.030) [-774.221] -- 0:00:13
786500 -- (-771.947) [-777.334] (-773.756) (-773.533) * (-773.884) [-772.990] (-772.345) (-772.916) -- 0:00:13
787000 -- (-775.466) (-771.699) [-775.852] (-777.937) * (-771.791) [-773.393] (-773.428) (-773.753) -- 0:00:12
787500 -- (-774.575) (-774.206) (-777.011) [-775.758] * (-773.946) (-776.342) (-774.396) [-773.596] -- 0:00:12
788000 -- (-772.731) (-780.794) [-773.469] (-773.574) * (-776.423) [-772.444] (-776.342) (-775.764) -- 0:00:12
788500 -- (-773.020) [-778.272] (-776.411) (-776.142) * (-774.710) (-776.640) [-773.973] (-777.948) -- 0:00:12
789000 -- [-772.824] (-774.109) (-772.486) (-775.074) * (-776.488) [-773.529] (-774.349) (-775.985) -- 0:00:12
789500 -- [-774.267] (-772.651) (-772.155) (-773.142) * (-775.333) [-772.114] (-773.318) (-774.697) -- 0:00:12
790000 -- (-773.111) [-771.505] (-774.203) (-772.481) * (-774.409) [-777.177] (-774.002) (-775.411) -- 0:00:12
Average standard deviation of split frequencies: 0.007473
790500 -- (-772.157) (-773.515) (-772.973) [-774.225] * [-772.832] (-774.393) (-772.159) (-774.144) -- 0:00:12
791000 -- (-773.006) (-773.790) (-774.054) [-776.490] * (-773.991) (-773.994) (-773.653) [-772.861] -- 0:00:12
791500 -- (-774.454) (-772.122) (-772.312) [-772.386] * (-774.411) (-775.506) (-777.004) [-773.035] -- 0:00:12
792000 -- [-772.939] (-774.283) (-772.640) (-772.550) * (-774.258) [-775.640] (-775.233) (-775.640) -- 0:00:12
792500 -- (-771.619) (-776.132) (-774.099) [-771.598] * [-774.833] (-772.575) (-777.750) (-774.320) -- 0:00:12
793000 -- (-773.224) (-773.226) (-772.806) [-772.784] * [-776.351] (-777.087) (-774.680) (-773.025) -- 0:00:12
793500 -- (-773.797) [-771.985] (-775.156) (-773.676) * (-773.881) (-777.853) (-773.888) [-771.888] -- 0:00:12
794000 -- (-774.838) (-774.034) [-774.112] (-773.462) * (-776.725) [-771.787] (-774.226) (-776.345) -- 0:00:12
794500 -- (-773.558) [-772.909] (-774.642) (-772.827) * (-777.527) (-772.458) [-775.719] (-775.643) -- 0:00:12
795000 -- (-771.741) (-771.644) [-773.378] (-772.867) * (-774.096) [-773.046] (-772.656) (-774.107) -- 0:00:12
Average standard deviation of split frequencies: 0.007186
795500 -- (-772.991) (-773.972) (-775.035) [-775.069] * (-773.893) (-771.580) [-772.583] (-777.226) -- 0:00:12
796000 -- (-772.659) [-772.525] (-772.620) (-773.193) * (-771.923) (-771.817) (-776.186) [-774.112] -- 0:00:12
796500 -- [-772.313] (-774.438) (-774.586) (-771.968) * (-771.717) [-779.143] (-772.839) (-777.247) -- 0:00:12
797000 -- [-777.981] (-777.489) (-773.422) (-772.756) * (-776.551) [-772.296] (-774.345) (-773.358) -- 0:00:12
797500 -- (-773.718) [-771.760] (-777.939) (-774.589) * (-773.399) (-776.995) (-771.535) [-775.041] -- 0:00:12
798000 -- [-773.097] (-776.610) (-775.582) (-773.739) * (-774.485) (-772.347) [-776.063] (-772.822) -- 0:00:12
798500 -- [-775.547] (-774.359) (-776.828) (-774.556) * [-773.843] (-772.527) (-772.290) (-775.245) -- 0:00:12
799000 -- (-774.788) (-774.746) (-774.433) [-773.286] * (-772.289) (-775.287) (-772.285) [-778.056] -- 0:00:12
799500 -- [-775.027] (-775.138) (-775.438) (-772.811) * (-772.334) (-773.832) (-772.745) [-772.811] -- 0:00:12
800000 -- [-774.487] (-773.580) (-771.778) (-772.040) * (-772.866) (-774.229) (-775.829) [-774.382] -- 0:00:12
Average standard deviation of split frequencies: 0.007458
800500 -- (-772.687) [-773.844] (-772.376) (-772.416) * (-773.140) (-773.418) (-774.403) [-774.254] -- 0:00:12
801000 -- [-773.598] (-773.606) (-772.986) (-773.073) * (-775.441) (-774.896) (-777.658) [-773.216] -- 0:00:12
801500 -- (-773.815) (-771.845) [-772.147] (-775.503) * (-775.159) (-773.171) [-774.087] (-772.020) -- 0:00:12
802000 -- (-775.955) [-774.293] (-773.883) (-772.891) * (-773.128) (-773.268) [-774.278] (-774.762) -- 0:00:12
802500 -- (-773.734) [-775.332] (-773.579) (-775.695) * (-775.040) (-775.629) [-773.152] (-773.806) -- 0:00:12
803000 -- [-774.064] (-778.685) (-773.134) (-776.548) * (-775.373) (-774.638) (-773.539) [-777.243] -- 0:00:12
803500 -- (-774.873) (-774.400) (-773.915) [-777.824] * (-776.015) [-775.640] (-773.507) (-774.754) -- 0:00:11
804000 -- (-775.986) [-772.935] (-773.751) (-774.953) * (-772.693) (-773.205) (-776.009) [-776.790] -- 0:00:11
804500 -- (-773.617) (-771.789) (-773.935) [-773.720] * (-774.630) [-775.025] (-776.486) (-775.919) -- 0:00:11
805000 -- [-773.327] (-771.857) (-773.328) (-774.612) * (-774.425) (-776.410) [-774.460] (-774.378) -- 0:00:11
Average standard deviation of split frequencies: 0.007642
805500 -- (-773.098) (-775.452) (-777.473) [-775.101] * (-775.918) (-775.191) [-773.812] (-775.410) -- 0:00:11
806000 -- (-774.899) (-772.596) (-773.301) [-773.938] * (-772.582) (-773.551) (-775.157) [-772.959] -- 0:00:11
806500 -- (-772.622) [-772.701] (-773.907) (-774.214) * (-773.155) (-774.017) [-774.584] (-773.360) -- 0:00:11
807000 -- (-774.509) (-773.159) [-773.985] (-772.566) * [-773.834] (-776.239) (-773.989) (-773.128) -- 0:00:11
807500 -- (-774.823) [-772.383] (-773.756) (-776.514) * [-775.079] (-775.455) (-772.500) (-774.490) -- 0:00:11
808000 -- (-773.930) [-771.952] (-773.166) (-775.770) * (-773.487) (-773.220) (-773.737) [-771.305] -- 0:00:11
808500 -- [-771.586] (-772.243) (-773.926) (-774.295) * (-771.627) (-774.651) [-775.477] (-774.417) -- 0:00:11
809000 -- (-773.188) (-772.810) [-774.963] (-773.074) * (-772.589) (-774.887) [-775.267] (-772.959) -- 0:00:11
809500 -- (-773.718) (-774.991) [-771.707] (-774.363) * (-782.261) (-775.528) (-773.982) [-771.758] -- 0:00:11
810000 -- [-772.670] (-774.689) (-772.028) (-773.106) * [-772.713] (-774.249) (-773.246) (-772.952) -- 0:00:11
Average standard deviation of split frequencies: 0.007443
810500 -- [-772.993] (-772.712) (-772.182) (-778.933) * [-772.234] (-774.825) (-774.884) (-774.377) -- 0:00:11
811000 -- [-777.369] (-773.344) (-775.917) (-774.634) * (-771.971) (-773.562) [-773.004] (-773.871) -- 0:00:11
811500 -- (-774.682) (-772.431) [-781.474] (-773.756) * [-773.503] (-774.228) (-774.102) (-775.103) -- 0:00:11
812000 -- (-774.273) [-775.520] (-771.995) (-775.022) * (-773.514) (-772.808) [-772.784] (-772.600) -- 0:00:11
812500 -- (-772.455) (-777.727) (-775.519) [-773.135] * [-772.636] (-774.353) (-773.154) (-772.878) -- 0:00:11
813000 -- [-773.235] (-774.580) (-779.321) (-772.839) * (-772.620) (-775.507) [-772.375] (-772.103) -- 0:00:11
813500 -- (-774.063) (-772.560) (-780.013) [-772.591] * (-775.666) (-775.075) (-775.600) [-776.135] -- 0:00:11
814000 -- (-773.150) (-773.952) [-773.659] (-775.712) * (-776.293) (-774.896) (-772.964) [-771.787] -- 0:00:11
814500 -- (-774.495) (-773.857) (-778.403) [-775.070] * (-776.801) (-779.691) (-772.786) [-773.480] -- 0:00:11
815000 -- (-775.101) (-772.528) (-773.771) [-773.386] * (-781.353) [-776.852] (-773.206) (-773.671) -- 0:00:11
Average standard deviation of split frequencies: 0.007164
815500 -- (-774.426) (-773.027) (-773.289) [-772.513] * (-774.311) [-772.447] (-776.744) (-773.241) -- 0:00:11
816000 -- (-774.460) (-775.389) [-773.325] (-773.186) * (-773.511) (-772.407) [-775.659] (-773.433) -- 0:00:11
816500 -- [-772.388] (-773.500) (-772.727) (-774.954) * (-772.135) (-777.272) [-776.594] (-771.813) -- 0:00:11
817000 -- (-771.779) (-772.690) (-774.288) [-772.189] * [-772.672] (-773.602) (-778.912) (-771.745) -- 0:00:11
817500 -- [-773.414] (-773.645) (-772.623) (-772.136) * (-771.832) [-773.250] (-771.821) (-772.779) -- 0:00:11
818000 -- [-774.059] (-772.969) (-772.488) (-772.826) * (-774.020) (-773.057) (-773.871) [-772.196] -- 0:00:11
818500 -- (-773.113) [-772.017] (-772.814) (-777.064) * (-773.243) (-773.713) (-771.881) [-772.704] -- 0:00:11
819000 -- (-773.535) [-773.943] (-772.779) (-774.584) * (-772.405) (-775.102) [-772.687] (-775.559) -- 0:00:11
819500 -- (-773.292) [-775.973] (-774.034) (-779.227) * (-776.984) [-772.997] (-775.755) (-774.166) -- 0:00:11
820000 -- (-772.198) (-774.892) [-773.884] (-776.179) * (-774.571) (-773.702) (-777.228) [-772.522] -- 0:00:10
Average standard deviation of split frequencies: 0.007084
820500 -- (-773.141) (-774.419) (-778.310) [-775.839] * (-773.412) [-771.846] (-773.504) (-773.765) -- 0:00:10
821000 -- (-772.363) (-773.167) (-775.992) [-773.750] * (-774.187) [-774.897] (-773.621) (-773.404) -- 0:00:10
821500 -- (-775.169) (-772.867) (-772.917) [-771.827] * (-781.623) [-773.927] (-779.043) (-773.494) -- 0:00:10
822000 -- (-773.318) [-773.783] (-773.235) (-775.742) * [-773.676] (-771.997) (-775.669) (-774.899) -- 0:00:10
822500 -- (-774.871) (-771.907) (-773.840) [-774.269] * (-774.916) (-774.127) [-773.398] (-775.350) -- 0:00:10
823000 -- (-772.909) (-771.877) [-772.080] (-778.173) * (-776.593) (-774.071) (-772.748) [-772.956] -- 0:00:10
823500 -- (-775.223) (-772.763) (-772.332) [-772.131] * (-773.773) [-771.370] (-776.331) (-772.743) -- 0:00:10
824000 -- [-774.886] (-774.838) (-771.887) (-773.921) * (-776.130) (-773.596) (-775.082) [-773.421] -- 0:00:10
824500 -- (-777.994) (-774.515) [-771.626] (-775.797) * (-777.643) (-774.498) [-771.887] (-773.421) -- 0:00:10
825000 -- (-775.129) (-774.176) (-774.041) [-775.367] * (-773.193) (-774.260) (-775.425) [-772.457] -- 0:00:10
Average standard deviation of split frequencies: 0.007457
825500 -- (-778.343) [-774.551] (-773.096) (-773.688) * (-774.985) [-775.672] (-771.695) (-772.255) -- 0:00:10
826000 -- (-773.850) (-774.711) [-772.793] (-777.382) * (-774.461) (-776.989) (-773.859) [-772.263] -- 0:00:10
826500 -- (-773.449) [-773.516] (-772.554) (-774.185) * (-775.939) (-773.916) [-775.405] (-772.232) -- 0:00:10
827000 -- (-776.717) (-779.594) (-772.250) [-775.166] * (-774.398) (-773.138) (-773.059) [-773.267] -- 0:00:10
827500 -- [-775.916] (-774.971) (-772.761) (-776.370) * (-774.785) (-772.469) (-775.611) [-772.488] -- 0:00:10
828000 -- (-772.380) (-777.026) (-772.260) [-773.806] * (-773.690) (-773.536) (-774.958) [-772.460] -- 0:00:10
828500 -- (-773.801) (-778.119) [-772.531] (-775.663) * (-773.552) [-773.434] (-775.149) (-772.801) -- 0:00:10
829000 -- (-773.913) [-774.168] (-771.977) (-776.462) * (-772.327) [-776.753] (-780.922) (-783.542) -- 0:00:10
829500 -- (-773.149) [-775.234] (-774.629) (-773.777) * (-773.999) (-774.221) (-778.194) [-780.002] -- 0:00:10
830000 -- (-773.128) (-773.237) (-773.959) [-771.830] * (-776.432) (-772.673) [-775.969] (-778.886) -- 0:00:10
Average standard deviation of split frequencies: 0.007945
830500 -- (-773.156) (-775.410) (-773.602) [-772.789] * (-772.830) (-773.710) [-773.954] (-781.832) -- 0:00:10
831000 -- [-774.666] (-773.656) (-776.101) (-772.661) * (-772.813) (-775.642) (-775.694) [-774.599] -- 0:00:10
831500 -- (-774.554) (-776.095) (-773.183) [-774.328] * [-772.746] (-778.621) (-776.363) (-774.343) -- 0:00:10
832000 -- (-774.495) (-778.789) (-773.051) [-776.895] * (-771.991) (-772.456) (-773.681) [-774.465] -- 0:00:10
832500 -- (-773.390) [-776.705] (-772.195) (-779.297) * (-773.620) (-773.213) (-777.811) [-773.064] -- 0:00:10
833000 -- [-775.450] (-772.613) (-773.584) (-777.788) * (-775.710) (-773.205) (-772.026) [-773.705] -- 0:00:10
833500 -- (-774.124) [-772.198] (-774.022) (-773.901) * (-774.030) (-773.106) (-772.389) [-773.504] -- 0:00:10
834000 -- (-772.847) (-772.588) (-772.803) [-772.633] * (-772.377) (-775.289) (-771.538) [-773.182] -- 0:00:10
834500 -- (-771.765) [-775.669] (-773.393) (-772.204) * [-775.889] (-774.104) (-772.606) (-773.673) -- 0:00:10
835000 -- [-774.090] (-775.545) (-778.487) (-774.104) * (-778.307) (-779.844) [-775.031] (-772.969) -- 0:00:10
Average standard deviation of split frequencies: 0.007970
835500 -- (-772.349) (-773.128) (-780.262) [-772.999] * [-774.924] (-775.932) (-773.500) (-773.638) -- 0:00:10
836000 -- (-772.906) (-773.589) [-772.711] (-772.117) * [-773.272] (-772.747) (-774.114) (-772.655) -- 0:00:10
836500 -- (-772.642) (-772.635) (-772.729) [-772.776] * (-772.893) [-774.904] (-773.163) (-773.868) -- 0:00:09
837000 -- (-771.928) [-773.181] (-773.117) (-772.357) * (-773.148) (-777.354) [-771.765] (-774.634) -- 0:00:09
837500 -- (-772.829) [-773.369] (-772.332) (-777.041) * [-773.012] (-773.459) (-771.763) (-775.927) -- 0:00:09
838000 -- (-773.476) [-773.381] (-776.098) (-776.948) * (-773.165) [-772.403] (-774.463) (-776.780) -- 0:00:09
838500 -- (-773.556) [-776.597] (-776.445) (-775.046) * (-771.485) (-774.141) [-774.192] (-776.142) -- 0:00:09
839000 -- [-774.271] (-775.263) (-775.035) (-775.902) * [-771.485] (-772.414) (-775.741) (-772.056) -- 0:00:09
839500 -- (-771.951) (-772.504) [-772.281] (-781.130) * (-774.019) (-773.616) (-775.316) [-774.730] -- 0:00:09
840000 -- (-774.690) (-776.302) [-771.380] (-773.756) * [-772.818] (-773.037) (-773.078) (-775.832) -- 0:00:09
Average standard deviation of split frequencies: 0.007439
840500 -- (-772.031) (-771.958) (-773.074) [-773.601] * (-773.314) [-775.226] (-777.447) (-773.967) -- 0:00:09
841000 -- (-771.622) (-773.070) [-771.834] (-773.253) * [-772.887] (-773.155) (-774.744) (-772.461) -- 0:00:09
841500 -- [-771.468] (-773.266) (-777.252) (-772.939) * (-772.458) (-773.018) [-776.115] (-774.176) -- 0:00:09
842000 -- (-771.371) [-772.981] (-779.634) (-773.122) * (-772.346) (-773.001) (-775.764) [-772.341] -- 0:00:09
842500 -- [-771.646] (-774.421) (-777.969) (-773.684) * (-774.119) [-772.676] (-773.006) (-772.442) -- 0:00:09
843000 -- (-775.190) (-773.953) (-771.744) [-773.354] * (-773.017) (-774.910) [-776.438] (-773.803) -- 0:00:09
843500 -- [-772.932] (-774.897) (-772.816) (-775.019) * (-773.035) (-773.226) (-772.902) [-773.007] -- 0:00:09
844000 -- (-772.838) (-773.558) [-771.270] (-772.088) * (-773.564) (-774.017) (-774.716) [-773.236] -- 0:00:09
844500 -- (-772.802) [-773.734] (-773.076) (-774.076) * [-774.809] (-773.099) (-777.449) (-773.262) -- 0:00:09
845000 -- [-772.951] (-773.073) (-774.539) (-771.499) * [-774.336] (-773.850) (-778.735) (-772.843) -- 0:00:09
Average standard deviation of split frequencies: 0.007504
845500 -- (-772.463) [-777.368] (-771.814) (-772.475) * (-773.252) (-777.832) (-774.469) [-775.712] -- 0:00:09
846000 -- (-771.704) [-772.989] (-774.160) (-772.883) * (-772.096) [-773.899] (-772.876) (-776.469) -- 0:00:09
846500 -- (-775.281) (-773.680) (-777.902) [-773.106] * (-775.326) [-772.719] (-772.616) (-773.841) -- 0:00:09
847000 -- (-776.414) [-772.718] (-774.634) (-772.976) * (-775.121) (-775.805) [-774.126] (-772.580) -- 0:00:09
847500 -- (-775.720) [-772.335] (-773.071) (-773.149) * (-775.660) (-780.433) (-776.925) [-772.755] -- 0:00:09
848000 -- (-778.722) (-774.113) (-774.355) [-773.009] * [-773.392] (-772.846) (-773.040) (-773.327) -- 0:00:09
848500 -- (-772.701) (-773.381) [-772.739] (-773.523) * [-772.430] (-772.509) (-773.518) (-776.169) -- 0:00:09
849000 -- (-772.004) [-772.983] (-776.010) (-771.904) * (-773.465) (-775.085) [-773.948] (-774.692) -- 0:00:09
849500 -- (-774.315) (-773.186) (-776.872) [-771.661] * [-772.654] (-775.986) (-772.791) (-772.339) -- 0:00:09
850000 -- (-775.129) (-772.069) [-776.427] (-772.474) * (-772.681) (-772.731) [-776.807] (-772.526) -- 0:00:09
Average standard deviation of split frequencies: 0.007574
850500 -- [-772.924] (-773.635) (-772.447) (-773.560) * (-774.000) [-772.737] (-774.672) (-776.650) -- 0:00:09
851000 -- [-772.452] (-777.558) (-776.489) (-775.369) * (-775.878) [-771.912] (-772.226) (-776.014) -- 0:00:09
851500 -- (-772.195) [-773.083] (-774.623) (-772.051) * (-774.912) [-774.403] (-772.509) (-771.656) -- 0:00:09
852000 -- (-772.850) [-774.994] (-775.128) (-773.978) * [-776.231] (-773.485) (-772.087) (-773.204) -- 0:00:09
852500 -- (-773.153) (-774.849) [-772.712] (-773.055) * (-773.471) (-772.187) [-775.671] (-773.789) -- 0:00:08
853000 -- (-773.317) (-773.206) [-771.895] (-775.983) * (-775.431) (-772.850) (-773.499) [-773.023] -- 0:00:08
853500 -- (-773.450) [-772.591] (-772.201) (-771.781) * [-772.999] (-774.570) (-774.143) (-772.290) -- 0:00:08
854000 -- (-775.066) (-775.019) (-775.177) [-773.857] * (-772.279) (-774.123) (-773.886) [-773.517] -- 0:00:08
854500 -- [-772.132] (-775.762) (-774.788) (-773.124) * [-773.247] (-772.208) (-776.005) (-777.415) -- 0:00:08
855000 -- [-771.957] (-774.746) (-775.457) (-775.417) * (-772.052) (-772.818) [-773.548] (-776.124) -- 0:00:08
Average standard deviation of split frequencies: 0.007710
855500 -- (-776.037) [-776.176] (-773.530) (-773.883) * [-772.791] (-771.892) (-774.594) (-776.964) -- 0:00:08
856000 -- [-772.950] (-775.164) (-774.047) (-772.144) * (-772.669) (-775.354) [-773.035] (-773.327) -- 0:00:08
856500 -- [-773.785] (-775.291) (-772.253) (-772.275) * (-777.394) (-775.880) [-774.742] (-772.388) -- 0:00:08
857000 -- [-773.146] (-775.268) (-773.904) (-773.396) * (-774.004) (-775.214) [-773.389] (-772.916) -- 0:00:08
857500 -- (-773.046) (-776.546) [-772.000] (-773.460) * (-775.380) (-774.831) [-772.737] (-773.416) -- 0:00:08
858000 -- [-772.930] (-776.682) (-773.072) (-777.555) * (-774.330) (-774.424) [-773.022] (-773.576) -- 0:00:08
858500 -- [-774.959] (-776.003) (-777.482) (-773.645) * (-772.286) (-773.495) [-773.544] (-771.552) -- 0:00:08
859000 -- (-771.997) [-774.933] (-776.462) (-775.008) * (-772.745) (-774.884) [-772.571] (-771.834) -- 0:00:08
859500 -- (-776.687) (-775.047) [-775.778] (-772.443) * [-773.515] (-775.841) (-775.496) (-780.642) -- 0:00:08
860000 -- (-776.094) [-771.694] (-774.033) (-775.595) * (-774.615) [-774.140] (-776.916) (-774.918) -- 0:00:08
Average standard deviation of split frequencies: 0.008289
860500 -- [-772.719] (-771.982) (-772.973) (-780.539) * (-774.795) (-775.021) (-773.670) [-772.330] -- 0:00:08
861000 -- (-775.148) (-772.234) [-771.389] (-773.823) * (-772.649) (-774.082) [-772.984] (-773.132) -- 0:00:08
861500 -- [-775.834] (-771.656) (-772.015) (-773.235) * (-771.907) (-774.567) [-774.409] (-772.189) -- 0:00:08
862000 -- (-773.855) [-774.256] (-773.603) (-773.952) * (-773.456) (-775.019) [-772.686] (-774.798) -- 0:00:08
862500 -- (-772.495) (-776.511) [-772.962] (-771.568) * [-773.862] (-776.910) (-772.718) (-772.931) -- 0:00:08
863000 -- (-773.271) (-774.925) [-773.207] (-772.298) * (-772.259) (-772.775) [-773.506] (-771.781) -- 0:00:08
863500 -- [-771.978] (-780.180) (-776.889) (-773.429) * (-774.085) (-773.085) [-772.381] (-771.828) -- 0:00:08
864000 -- (-772.648) (-774.308) (-773.094) [-771.792] * [-773.234] (-772.121) (-771.923) (-774.557) -- 0:00:08
864500 -- (-773.162) (-775.946) (-772.977) [-773.961] * (-774.333) (-772.643) [-775.556] (-775.685) -- 0:00:08
865000 -- (-773.458) [-772.291] (-773.155) (-776.378) * (-774.294) (-773.179) (-772.682) [-774.009] -- 0:00:08
Average standard deviation of split frequencies: 0.007947
865500 -- (-774.100) (-773.793) (-772.264) [-774.429] * (-773.915) (-774.263) (-771.877) [-772.851] -- 0:00:08
866000 -- [-772.274] (-771.710) (-773.024) (-775.901) * (-772.653) [-774.230] (-771.877) (-772.151) -- 0:00:08
866500 -- [-774.460] (-771.978) (-774.211) (-772.982) * (-775.498) (-774.944) (-773.290) [-772.503] -- 0:00:08
867000 -- (-774.009) (-771.938) [-772.131] (-772.739) * (-774.468) [-773.543] (-771.445) (-772.617) -- 0:00:08
867500 -- [-772.030] (-774.790) (-772.233) (-771.749) * (-774.100) [-775.359] (-772.657) (-773.274) -- 0:00:08
868000 -- (-772.574) (-771.865) [-772.315] (-773.229) * (-777.001) (-772.321) (-773.449) [-775.139] -- 0:00:08
868500 -- (-771.840) (-774.613) (-775.647) [-777.546] * (-773.465) (-777.096) [-772.838] (-773.376) -- 0:00:08
869000 -- (-773.268) (-773.640) (-773.068) [-772.123] * (-774.357) (-773.035) [-774.827] (-776.315) -- 0:00:07
869500 -- [-774.096] (-772.445) (-772.443) (-773.997) * (-772.124) (-773.623) [-773.912] (-771.832) -- 0:00:07
870000 -- (-773.351) [-772.369] (-772.608) (-776.504) * [-771.992] (-772.025) (-772.810) (-774.493) -- 0:00:07
Average standard deviation of split frequencies: 0.007724
870500 -- [-774.350] (-771.835) (-772.267) (-775.701) * [-773.505] (-773.965) (-776.173) (-773.817) -- 0:00:07
871000 -- (-772.149) (-773.816) (-772.739) [-775.946] * (-773.558) (-773.592) (-774.792) [-774.005] -- 0:00:07
871500 -- (-771.664) (-772.783) (-774.856) [-776.523] * (-774.524) [-772.116] (-774.995) (-775.350) -- 0:00:07
872000 -- (-772.693) (-774.492) (-776.674) [-773.113] * (-773.711) (-773.868) [-773.040] (-772.505) -- 0:00:07
872500 -- [-774.157] (-772.782) (-773.396) (-773.142) * (-772.965) (-773.135) (-772.013) [-773.130] -- 0:00:07
873000 -- (-773.539) (-771.909) (-773.096) [-774.072] * (-773.885) (-775.510) [-774.579] (-772.903) -- 0:00:07
873500 -- (-773.539) (-772.988) [-777.495] (-771.899) * (-779.529) [-773.325] (-777.872) (-773.360) -- 0:00:07
874000 -- (-773.635) [-772.364] (-773.230) (-774.991) * (-779.013) (-773.297) (-773.421) [-772.942] -- 0:00:07
874500 -- (-772.521) (-773.579) (-776.084) [-771.947] * (-774.955) [-774.475] (-772.846) (-776.867) -- 0:00:07
875000 -- (-773.757) (-775.920) [-775.451] (-773.246) * (-775.051) (-773.801) [-772.399] (-772.698) -- 0:00:07
Average standard deviation of split frequencies: 0.007893
875500 -- (-774.192) (-774.616) [-779.419] (-772.243) * [-774.206] (-772.723) (-775.370) (-772.164) -- 0:00:07
876000 -- (-778.328) (-777.170) (-776.073) [-772.608] * [-772.625] (-774.219) (-773.682) (-774.611) -- 0:00:07
876500 -- [-773.401] (-774.682) (-775.605) (-773.536) * (-773.707) (-775.520) [-772.640] (-772.542) -- 0:00:07
877000 -- (-772.312) (-772.998) [-772.142] (-777.492) * (-773.933) (-772.814) [-773.076] (-773.528) -- 0:00:07
877500 -- (-772.638) [-775.231] (-771.634) (-774.191) * (-773.172) [-774.273] (-778.475) (-772.616) -- 0:00:07
878000 -- (-775.722) (-776.113) [-774.441] (-773.443) * [-775.787] (-773.203) (-777.246) (-771.847) -- 0:00:07
878500 -- (-774.708) (-775.082) (-778.688) [-776.295] * (-771.891) (-774.127) (-776.704) [-771.847] -- 0:00:07
879000 -- (-772.252) (-777.133) [-774.455] (-776.261) * (-774.860) [-771.613] (-773.657) (-779.694) -- 0:00:07
879500 -- (-772.286) [-778.159] (-774.650) (-774.274) * (-774.874) [-774.441] (-775.521) (-773.296) -- 0:00:07
880000 -- (-773.507) (-774.449) [-772.841] (-773.354) * (-773.778) [-774.440] (-771.539) (-777.656) -- 0:00:07
Average standard deviation of split frequencies: 0.008101
880500 -- (-773.739) (-774.208) [-774.367] (-774.187) * (-773.156) (-775.583) (-771.572) [-773.466] -- 0:00:07
881000 -- [-774.519] (-772.599) (-772.270) (-773.659) * (-773.642) (-774.812) (-777.183) [-772.317] -- 0:00:07
881500 -- (-773.486) (-773.045) (-772.297) [-775.585] * (-779.166) (-773.662) [-775.578] (-775.255) -- 0:00:07
882000 -- [-772.824] (-774.685) (-774.638) (-775.764) * [-775.462] (-772.199) (-773.109) (-773.513) -- 0:00:07
882500 -- (-772.705) (-773.193) [-774.563] (-772.164) * (-773.679) [-772.905] (-773.194) (-772.643) -- 0:00:07
883000 -- [-772.721] (-777.471) (-775.562) (-772.300) * [-773.874] (-772.238) (-771.479) (-775.152) -- 0:00:07
883500 -- (-774.237) (-773.019) [-771.694] (-772.936) * (-773.635) (-772.949) [-773.566] (-777.585) -- 0:00:07
884000 -- (-773.182) (-775.713) (-775.333) [-776.090] * (-772.497) (-774.420) [-774.201] (-774.438) -- 0:00:07
884500 -- (-774.586) (-779.342) (-773.528) [-774.056] * (-773.651) (-773.369) [-775.330] (-773.144) -- 0:00:07
885000 -- (-774.894) (-774.775) (-772.102) [-773.054] * (-774.680) [-773.404] (-775.795) (-777.526) -- 0:00:07
Average standard deviation of split frequencies: 0.008655
885500 -- [-772.528] (-772.538) (-773.826) (-775.271) * (-773.016) [-772.244] (-774.100) (-777.529) -- 0:00:06
886000 -- (-772.040) (-778.507) (-772.562) [-772.825] * (-773.664) (-773.389) (-774.106) [-776.205] -- 0:00:06
886500 -- (-776.682) [-774.080] (-774.143) (-771.960) * [-772.853] (-772.867) (-772.788) (-777.935) -- 0:00:06
887000 -- [-773.770] (-775.459) (-774.756) (-772.406) * (-773.235) (-772.840) [-773.670] (-774.586) -- 0:00:06
887500 -- (-772.574) (-775.258) [-774.036] (-773.537) * (-773.013) (-777.345) [-771.668] (-775.536) -- 0:00:06
888000 -- (-772.084) [-773.402] (-775.324) (-772.633) * (-776.593) (-777.865) (-773.119) [-772.627] -- 0:00:06
888500 -- (-778.652) (-776.328) (-774.584) [-771.986] * (-772.944) (-779.416) (-772.289) [-774.500] -- 0:00:06
889000 -- (-779.363) [-772.639] (-772.432) (-772.887) * (-773.222) (-772.543) (-771.957) [-773.707] -- 0:00:06
889500 -- (-776.657) (-774.903) [-773.014] (-773.148) * (-776.304) [-775.019] (-773.517) (-773.783) -- 0:00:06
890000 -- (-774.145) [-775.352] (-774.029) (-775.404) * (-772.859) (-774.461) (-774.287) [-773.783] -- 0:00:06
Average standard deviation of split frequencies: 0.008468
890500 -- (-773.351) (-777.850) (-772.487) [-775.410] * (-771.986) [-772.195] (-772.501) (-778.134) -- 0:00:06
891000 -- (-772.997) (-777.338) (-776.300) [-773.764] * (-774.154) (-772.003) (-776.954) [-773.885] -- 0:00:06
891500 -- (-772.698) [-773.502] (-773.270) (-776.554) * (-773.158) (-772.830) [-774.020] (-773.576) -- 0:00:06
892000 -- (-772.930) (-771.701) [-773.910] (-772.950) * (-772.788) (-771.557) [-772.740] (-774.273) -- 0:00:06
892500 -- (-772.176) (-773.850) (-775.187) [-773.007] * (-771.815) [-771.670] (-776.481) (-775.581) -- 0:00:06
893000 -- (-773.618) (-776.066) (-773.419) [-773.267] * (-772.014) (-774.284) (-772.809) [-772.449] -- 0:00:06
893500 -- (-774.880) (-775.874) [-772.740] (-775.089) * (-778.217) (-776.400) [-774.600] (-773.156) -- 0:00:06
894000 -- [-771.604] (-773.243) (-773.539) (-778.126) * (-777.965) [-774.571] (-772.285) (-772.139) -- 0:00:06
894500 -- (-772.657) [-773.273] (-772.683) (-776.176) * (-773.348) (-772.587) [-772.503] (-772.618) -- 0:00:06
895000 -- (-772.388) (-777.221) [-774.180] (-776.106) * [-773.294] (-777.766) (-772.694) (-773.044) -- 0:00:06
Average standard deviation of split frequencies: 0.008628
895500 -- [-771.715] (-774.248) (-774.892) (-773.135) * [-772.119] (-772.902) (-772.181) (-775.354) -- 0:00:06
896000 -- [-772.911] (-772.932) (-780.141) (-773.840) * [-773.570] (-774.095) (-776.676) (-773.585) -- 0:00:06
896500 -- [-773.354] (-773.710) (-774.291) (-775.408) * [-774.331] (-777.315) (-777.443) (-773.143) -- 0:00:06
897000 -- (-772.989) [-774.828] (-776.124) (-775.043) * (-774.970) (-773.592) [-774.549] (-774.053) -- 0:00:06
897500 -- (-774.867) (-774.254) (-774.759) [-775.598] * (-774.244) (-776.251) (-772.733) [-771.642] -- 0:00:06
898000 -- [-773.588] (-773.930) (-773.384) (-772.185) * [-772.533] (-777.484) (-774.089) (-777.336) -- 0:00:06
898500 -- (-774.586) [-773.894] (-780.234) (-775.442) * (-776.329) (-776.266) [-771.513] (-775.811) -- 0:00:06
899000 -- (-775.833) (-775.074) (-774.164) [-774.338] * (-775.596) [-774.999] (-772.109) (-776.386) -- 0:00:06
899500 -- (-772.758) (-772.690) (-774.515) [-772.577] * [-775.663] (-772.419) (-771.846) (-776.507) -- 0:00:06
900000 -- [-772.153] (-772.190) (-776.564) (-772.589) * (-773.611) (-772.355) [-772.442] (-773.585) -- 0:00:06
Average standard deviation of split frequencies: 0.008863
900500 -- (-774.455) (-774.701) [-775.519] (-774.841) * (-777.346) (-773.436) (-772.170) [-772.457] -- 0:00:06
901000 -- [-771.691] (-773.747) (-775.325) (-773.707) * (-777.191) (-772.019) [-773.881] (-774.627) -- 0:00:06
901500 -- (-771.754) (-771.325) (-775.061) [-771.804] * (-775.838) (-772.123) [-772.107] (-773.929) -- 0:00:06
902000 -- (-771.469) (-772.807) [-773.327] (-771.841) * (-775.079) (-774.394) [-771.404] (-773.405) -- 0:00:05
902500 -- [-771.697] (-773.704) (-773.274) (-774.212) * [-775.088] (-774.388) (-774.575) (-772.739) -- 0:00:05
903000 -- (-773.647) (-775.407) (-772.281) [-774.288] * (-774.943) [-773.346] (-773.424) (-772.736) -- 0:00:05
903500 -- [-773.213] (-773.339) (-773.649) (-776.960) * (-772.303) (-772.362) [-773.678] (-776.042) -- 0:00:05
904000 -- (-774.722) (-771.948) (-772.337) [-774.512] * [-774.426] (-772.183) (-776.883) (-775.620) -- 0:00:05
904500 -- (-773.921) (-774.786) (-773.110) [-775.217] * [-773.412] (-771.849) (-772.764) (-774.694) -- 0:00:05
905000 -- (-772.297) [-775.254] (-772.843) (-775.962) * (-774.394) (-771.640) (-774.298) [-775.942] -- 0:00:05
Average standard deviation of split frequencies: 0.008498
905500 -- (-777.435) [-774.314] (-776.114) (-778.893) * (-774.052) [-773.850] (-772.930) (-771.870) -- 0:00:05
906000 -- (-774.066) [-775.127] (-776.632) (-773.481) * (-774.321) (-775.170) (-771.716) [-772.197] -- 0:00:05
906500 -- (-773.245) (-772.931) (-777.395) [-771.567] * [-773.824] (-773.158) (-774.745) (-773.084) -- 0:00:05
907000 -- (-772.519) (-779.480) [-773.165] (-772.478) * [-773.743] (-774.558) (-775.173) (-772.666) -- 0:00:05
907500 -- (-774.421) (-778.888) [-773.516] (-773.192) * (-772.867) (-777.357) [-778.138] (-772.157) -- 0:00:05
908000 -- [-771.774] (-771.714) (-772.891) (-772.260) * (-773.676) (-776.372) (-777.401) [-774.973] -- 0:00:05
908500 -- (-772.142) (-772.002) [-774.330] (-775.005) * (-775.613) [-774.084] (-776.360) (-774.058) -- 0:00:05
909000 -- (-772.575) [-774.466] (-777.921) (-773.832) * (-772.733) (-774.892) (-774.301) [-772.557] -- 0:00:05
909500 -- (-772.907) (-772.149) (-775.110) [-773.398] * (-773.078) (-773.364) [-773.094] (-771.500) -- 0:00:05
910000 -- [-772.968] (-775.621) (-773.857) (-773.341) * (-773.170) (-773.208) (-771.820) [-774.856] -- 0:00:05
Average standard deviation of split frequencies: 0.008627
910500 -- (-773.560) [-771.757] (-771.452) (-772.766) * (-773.002) (-773.207) [-775.407] (-776.519) -- 0:00:05
911000 -- [-773.731] (-771.770) (-776.299) (-772.116) * (-772.427) [-777.117] (-778.808) (-775.093) -- 0:00:05
911500 -- (-774.457) (-771.932) (-772.301) [-772.515] * [-772.893] (-772.388) (-780.268) (-772.016) -- 0:00:05
912000 -- [-775.188] (-775.297) (-777.934) (-774.790) * (-775.841) (-772.918) [-774.652] (-772.762) -- 0:00:05
912500 -- [-773.858] (-774.873) (-774.951) (-774.180) * (-773.414) (-778.065) (-772.316) [-777.179] -- 0:00:05
913000 -- [-776.267] (-772.429) (-774.922) (-774.636) * (-775.727) [-775.644] (-774.458) (-774.095) -- 0:00:05
913500 -- (-776.055) [-772.197] (-772.716) (-772.205) * [-773.379] (-775.664) (-774.876) (-772.469) -- 0:00:05
914000 -- [-773.760] (-772.377) (-773.314) (-773.456) * (-772.406) (-773.266) (-776.552) [-777.208] -- 0:00:05
914500 -- (-776.697) [-772.232] (-774.406) (-771.884) * [-772.249] (-775.967) (-775.950) (-774.828) -- 0:00:05
915000 -- (-773.298) [-772.812] (-774.298) (-774.533) * (-774.328) [-774.644] (-773.928) (-774.649) -- 0:00:05
Average standard deviation of split frequencies: 0.008612
915500 -- (-777.716) (-776.528) (-773.178) [-774.666] * (-773.825) (-774.939) (-772.924) [-773.142] -- 0:00:05
916000 -- (-776.932) (-775.250) [-772.415] (-779.255) * (-776.103) (-772.805) [-775.305] (-771.846) -- 0:00:05
916500 -- (-775.948) (-774.137) [-775.872] (-774.989) * [-774.233] (-773.621) (-773.305) (-771.946) -- 0:00:05
917000 -- (-774.412) (-774.277) [-773.875] (-774.921) * (-773.585) [-776.456] (-774.271) (-772.349) -- 0:00:05
917500 -- (-775.746) [-776.044] (-772.441) (-773.202) * (-774.251) [-777.860] (-775.600) (-773.714) -- 0:00:05
918000 -- (-773.487) [-773.727] (-773.757) (-773.882) * (-773.338) (-772.142) [-772.698] (-774.086) -- 0:00:05
918500 -- (-773.777) (-775.517) [-775.329] (-771.939) * (-775.657) [-775.588] (-777.652) (-774.234) -- 0:00:04
919000 -- [-774.226] (-773.333) (-773.413) (-774.014) * (-776.445) [-773.442] (-772.287) (-774.765) -- 0:00:04
919500 -- [-771.931] (-772.263) (-779.459) (-772.268) * [-772.343] (-774.566) (-774.539) (-775.303) -- 0:00:04
920000 -- (-771.777) (-773.077) [-772.985] (-774.779) * [-772.566] (-772.342) (-774.921) (-780.116) -- 0:00:04
Average standard deviation of split frequencies: 0.008602
920500 -- (-771.954) [-772.691] (-773.120) (-774.245) * (-773.540) (-772.590) [-775.084] (-776.534) -- 0:00:04
921000 -- [-773.992] (-771.944) (-774.434) (-772.279) * (-772.925) (-772.901) (-774.096) [-773.374] -- 0:00:04
921500 -- (-772.403) (-772.431) [-774.386] (-773.901) * [-772.843] (-777.080) (-774.311) (-777.714) -- 0:00:04
922000 -- (-773.000) (-778.498) (-774.957) [-773.876] * (-773.447) (-773.022) [-772.409] (-777.714) -- 0:00:04
922500 -- (-772.090) [-772.711] (-772.379) (-773.763) * (-773.700) [-772.205] (-773.338) (-772.756) -- 0:00:04
923000 -- (-772.111) [-773.009] (-775.375) (-772.006) * (-775.057) [-774.146] (-772.771) (-773.463) -- 0:00:04
923500 -- (-772.859) (-776.720) [-774.434] (-774.394) * [-772.349] (-772.994) (-773.178) (-771.951) -- 0:00:04
924000 -- (-772.702) (-780.814) [-773.178] (-774.111) * (-775.565) (-774.019) (-775.513) [-773.281] -- 0:00:04
924500 -- [-774.132] (-774.056) (-772.748) (-771.683) * (-773.699) (-774.282) (-777.187) [-774.144] -- 0:00:04
925000 -- (-773.458) (-774.904) [-772.522] (-775.510) * (-773.247) (-774.498) [-773.812] (-772.325) -- 0:00:04
Average standard deviation of split frequencies: 0.008451
925500 -- (-775.229) (-776.946) (-776.577) [-771.814] * [-774.451] (-773.210) (-772.972) (-773.565) -- 0:00:04
926000 -- (-772.890) [-774.634] (-772.637) (-774.971) * (-773.472) (-773.733) (-772.787) [-774.076] -- 0:00:04
926500 -- [-771.829] (-775.292) (-775.956) (-774.983) * (-775.832) (-772.012) [-773.580] (-772.360) -- 0:00:04
927000 -- [-772.702] (-774.549) (-774.796) (-773.247) * (-773.497) [-776.046] (-773.288) (-772.759) -- 0:00:04
927500 -- [-773.498] (-775.148) (-774.635) (-773.154) * (-773.786) (-778.823) [-775.926] (-774.704) -- 0:00:04
928000 -- (-772.367) (-774.747) [-773.400] (-772.694) * (-774.431) (-772.523) [-774.064] (-775.651) -- 0:00:04
928500 -- (-772.634) [-772.878] (-777.826) (-773.425) * [-773.464] (-771.762) (-775.430) (-775.369) -- 0:00:04
929000 -- [-772.860] (-772.477) (-771.358) (-771.810) * (-777.590) (-775.559) [-774.630] (-773.166) -- 0:00:04
929500 -- (-774.411) (-773.985) (-772.933) [-772.912] * (-775.917) (-778.665) [-774.182] (-773.165) -- 0:00:04
930000 -- (-772.082) (-772.071) [-773.339] (-774.856) * (-773.943) (-774.037) [-775.448] (-771.301) -- 0:00:04
Average standard deviation of split frequencies: 0.008172
930500 -- (-772.807) (-772.014) [-773.057] (-775.537) * (-772.271) (-774.026) [-772.200] (-774.251) -- 0:00:04
931000 -- (-773.234) (-777.850) (-773.122) [-775.372] * (-772.039) (-774.308) [-771.960] (-772.761) -- 0:00:04
931500 -- (-773.948) (-771.756) [-774.263] (-777.841) * (-774.121) (-773.171) [-775.822] (-772.604) -- 0:00:04
932000 -- (-773.735) (-771.995) (-774.328) [-777.757] * (-771.975) [-775.203] (-775.762) (-773.458) -- 0:00:04
932500 -- (-775.501) (-779.178) (-773.239) [-774.621] * (-772.736) (-775.787) (-774.128) [-773.510] -- 0:00:04
933000 -- (-776.550) (-775.802) (-773.548) [-774.285] * [-774.290] (-773.164) (-773.777) (-774.788) -- 0:00:04
933500 -- (-775.337) (-775.880) [-775.152] (-776.227) * (-772.521) [-774.120] (-774.845) (-777.799) -- 0:00:04
934000 -- [-774.677] (-773.659) (-775.866) (-775.200) * [-772.671] (-776.297) (-778.503) (-774.626) -- 0:00:04
934500 -- [-775.056] (-774.853) (-772.014) (-775.437) * (-774.105) (-774.866) (-773.168) [-778.444] -- 0:00:03
935000 -- [-774.376] (-772.529) (-774.744) (-773.462) * (-771.763) (-775.462) (-776.652) [-775.889] -- 0:00:03
Average standard deviation of split frequencies: 0.008428
935500 -- [-773.068] (-775.243) (-773.781) (-774.768) * (-771.958) [-774.553] (-772.472) (-772.716) -- 0:00:03
936000 -- [-773.662] (-772.163) (-772.544) (-772.243) * (-771.822) [-775.899] (-777.732) (-773.705) -- 0:00:03
936500 -- (-774.924) (-774.028) (-772.973) [-772.086] * [-776.430] (-777.348) (-772.633) (-773.717) -- 0:00:03
937000 -- [-772.129] (-775.293) (-774.337) (-772.040) * (-774.712) (-772.347) (-772.782) [-774.129] -- 0:00:03
937500 -- (-773.018) (-772.553) [-772.598] (-772.743) * (-778.840) [-773.853] (-773.481) (-772.490) -- 0:00:03
938000 -- (-776.465) [-772.946] (-776.155) (-775.734) * (-773.688) [-773.351] (-774.977) (-772.662) -- 0:00:03
938500 -- (-774.103) (-772.933) (-774.051) [-774.913] * (-775.897) (-774.098) [-774.370] (-775.435) -- 0:00:03
939000 -- (-772.599) (-774.305) [-773.854] (-772.428) * (-773.056) (-777.038) [-773.999] (-771.973) -- 0:00:03
939500 -- (-773.700) (-775.693) (-775.913) [-777.424] * (-771.984) [-774.159] (-773.117) (-773.562) -- 0:00:03
940000 -- [-772.300] (-772.164) (-774.038) (-774.240) * (-772.616) [-772.260] (-772.453) (-778.841) -- 0:00:03
Average standard deviation of split frequencies: 0.008152
940500 -- (-772.148) (-772.164) (-775.602) [-771.681] * (-782.760) (-773.231) [-772.100] (-774.019) -- 0:00:03
941000 -- (-773.863) [-773.419] (-775.867) (-772.850) * (-773.952) [-772.110] (-773.086) (-776.910) -- 0:00:03
941500 -- (-773.436) [-772.106] (-772.519) (-774.137) * [-773.479] (-772.480) (-771.984) (-774.475) -- 0:00:03
942000 -- (-775.928) (-772.097) [-771.968] (-771.901) * (-772.697) (-773.002) [-772.835] (-773.346) -- 0:00:03
942500 -- [-774.462] (-771.906) (-778.301) (-772.625) * (-772.681) (-772.380) (-776.810) [-776.734] -- 0:00:03
943000 -- (-773.735) [-772.134] (-773.467) (-772.317) * (-774.702) [-772.567] (-774.217) (-774.921) -- 0:00:03
943500 -- (-773.868) (-774.415) [-772.772] (-773.855) * (-776.040) (-774.324) [-773.339] (-774.188) -- 0:00:03
944000 -- [-773.671] (-773.636) (-774.770) (-773.122) * [-773.834] (-773.231) (-772.795) (-774.330) -- 0:00:03
944500 -- (-774.814) [-773.519] (-775.796) (-772.077) * (-772.820) (-772.353) (-775.211) [-772.984] -- 0:00:03
945000 -- (-772.209) (-774.479) (-772.285) [-772.247] * (-772.227) (-775.122) (-772.214) [-771.894] -- 0:00:03
Average standard deviation of split frequencies: 0.008305
945500 -- [-775.976] (-773.730) (-772.922) (-771.948) * [-772.233] (-776.758) (-772.436) (-772.345) -- 0:00:03
946000 -- (-773.971) (-773.532) [-772.642] (-773.082) * [-774.326] (-773.719) (-772.265) (-777.356) -- 0:00:03
946500 -- [-774.519] (-773.170) (-773.139) (-774.010) * [-774.485] (-772.434) (-774.192) (-772.509) -- 0:00:03
947000 -- (-772.614) (-773.791) (-773.665) [-772.024] * (-773.009) (-772.154) (-773.885) [-771.788] -- 0:00:03
947500 -- (-773.600) (-776.321) [-775.896] (-773.361) * (-775.123) (-773.471) [-773.507] (-773.501) -- 0:00:03
948000 -- (-772.678) (-773.776) (-773.720) [-773.365] * (-774.614) (-773.464) [-773.070] (-772.220) -- 0:00:03
948500 -- (-773.801) (-774.365) [-771.462] (-773.639) * [-773.861] (-775.080) (-773.074) (-774.897) -- 0:00:03
949000 -- (-773.878) (-779.787) [-773.457] (-776.559) * (-773.006) (-776.864) (-773.213) [-776.366] -- 0:00:03
949500 -- (-772.608) [-774.125] (-773.476) (-777.904) * (-772.231) [-777.728] (-773.341) (-776.661) -- 0:00:03
950000 -- (-773.239) [-777.981] (-773.827) (-772.248) * (-774.436) (-772.797) (-772.138) [-773.209] -- 0:00:03
Average standard deviation of split frequencies: 0.008132
950500 -- (-773.697) [-773.939] (-778.032) (-776.359) * [-772.604] (-773.201) (-775.612) (-771.406) -- 0:00:03
951000 -- [-776.292] (-774.365) (-777.588) (-775.375) * (-777.074) [-773.319] (-772.630) (-771.720) -- 0:00:02
951500 -- (-774.949) [-774.461] (-776.325) (-773.572) * (-776.308) [-773.321] (-775.561) (-778.130) -- 0:00:02
952000 -- (-776.290) [-772.201] (-775.575) (-773.335) * (-776.476) [-771.997] (-775.963) (-773.547) -- 0:00:02
952500 -- (-772.899) [-774.487] (-773.881) (-773.810) * (-774.239) [-775.155] (-772.841) (-772.293) -- 0:00:02
953000 -- (-775.730) (-776.884) (-773.308) [-773.712] * [-772.675] (-773.584) (-772.436) (-775.713) -- 0:00:02
953500 -- [-777.258] (-774.754) (-772.706) (-773.565) * (-774.985) (-774.251) (-773.031) [-775.327] -- 0:00:02
954000 -- (-771.775) (-774.521) [-773.553] (-771.543) * (-772.831) [-772.236] (-772.497) (-774.579) -- 0:00:02
954500 -- [-773.122] (-779.442) (-773.782) (-772.720) * [-772.515] (-776.284) (-774.369) (-773.440) -- 0:00:02
955000 -- [-773.752] (-777.321) (-774.108) (-774.038) * [-773.517] (-772.192) (-772.158) (-773.440) -- 0:00:02
Average standard deviation of split frequencies: 0.007922
955500 -- (-774.799) [-772.938] (-772.127) (-776.995) * [-773.286] (-773.162) (-773.457) (-774.033) -- 0:00:02
956000 -- (-775.106) [-773.278] (-776.611) (-774.588) * (-774.062) (-771.815) [-776.057] (-775.706) -- 0:00:02
956500 -- (-771.531) [-775.976] (-776.376) (-773.369) * (-775.020) (-774.116) (-773.809) [-774.566] -- 0:00:02
957000 -- (-772.586) [-773.099] (-777.734) (-774.035) * (-773.586) [-774.004] (-773.880) (-778.026) -- 0:00:02
957500 -- [-772.394] (-774.633) (-774.600) (-773.763) * [-774.713] (-773.363) (-775.527) (-774.047) -- 0:00:02
958000 -- (-776.320) [-771.838] (-771.865) (-772.677) * (-772.067) [-776.268] (-773.640) (-772.670) -- 0:00:02
958500 -- (-775.119) (-773.407) (-772.231) [-773.456] * [-772.635] (-775.170) (-772.691) (-773.346) -- 0:00:02
959000 -- [-772.198] (-773.845) (-773.123) (-772.633) * (-778.247) [-778.050] (-772.317) (-772.162) -- 0:00:02
959500 -- [-775.041] (-772.991) (-773.592) (-772.232) * [-773.194] (-771.593) (-772.363) (-773.077) -- 0:00:02
960000 -- (-773.213) (-773.229) [-774.759] (-771.862) * [-773.454] (-774.091) (-774.295) (-774.311) -- 0:00:02
Average standard deviation of split frequencies: 0.007753
960500 -- (-771.580) (-772.437) [-775.087] (-771.519) * (-776.059) (-776.195) (-774.285) [-771.504] -- 0:00:02
961000 -- (-772.692) [-772.182] (-774.669) (-773.788) * (-774.725) (-774.278) (-772.097) [-772.717] -- 0:00:02
961500 -- (-781.363) (-771.963) (-771.584) [-773.843] * (-775.065) (-773.420) [-772.260] (-777.799) -- 0:00:02
962000 -- (-773.139) [-776.001] (-772.448) (-778.862) * (-774.424) (-774.270) [-773.490] (-777.677) -- 0:00:02
962500 -- (-773.723) (-774.003) (-773.488) [-772.487] * (-774.175) (-773.312) [-773.083] (-772.605) -- 0:00:02
963000 -- (-772.311) (-774.356) (-771.991) [-775.392] * (-775.164) (-774.522) [-772.852] (-772.621) -- 0:00:02
963500 -- (-772.150) [-774.327] (-772.487) (-773.240) * (-777.087) [-773.205] (-772.113) (-774.698) -- 0:00:02
964000 -- (-773.245) (-778.504) [-774.944] (-774.570) * (-772.235) (-776.554) [-772.606] (-772.767) -- 0:00:02
964500 -- (-772.234) (-778.667) [-773.776] (-772.390) * (-772.571) (-778.170) (-771.363) [-772.634] -- 0:00:02
965000 -- [-772.988] (-772.561) (-775.387) (-781.976) * (-775.170) (-771.983) [-773.193] (-772.718) -- 0:00:02
Average standard deviation of split frequencies: 0.007580
965500 -- (-773.176) [-772.479] (-772.048) (-772.362) * (-774.050) (-773.219) (-775.324) [-773.330] -- 0:00:02
966000 -- (-774.708) (-772.162) [-772.923] (-775.031) * (-773.961) (-774.893) [-772.937] (-772.573) -- 0:00:02
966500 -- (-775.087) (-774.340) (-773.009) [-774.399] * (-773.442) [-774.332] (-773.125) (-773.129) -- 0:00:02
967000 -- (-773.873) [-775.892] (-773.884) (-772.330) * [-771.722] (-779.487) (-774.066) (-774.961) -- 0:00:02
967500 -- (-774.184) (-776.259) [-771.485] (-776.592) * [-775.082] (-772.904) (-775.971) (-773.735) -- 0:00:01
968000 -- [-773.603] (-778.079) (-774.233) (-772.304) * (-772.998) (-772.870) [-772.809] (-775.595) -- 0:00:01
968500 -- (-773.473) [-775.020] (-773.882) (-772.600) * (-774.697) [-773.063] (-773.826) (-779.092) -- 0:00:01
969000 -- (-778.118) [-772.474] (-772.833) (-772.849) * (-774.364) [-773.108] (-775.108) (-780.691) -- 0:00:01
969500 -- (-771.991) (-772.363) [-771.393] (-774.542) * (-774.570) [-771.872] (-771.854) (-777.501) -- 0:00:01
970000 -- (-779.617) [-772.749] (-771.444) (-774.109) * (-772.907) (-774.443) [-773.168] (-778.691) -- 0:00:01
Average standard deviation of split frequencies: 0.007932
970500 -- [-773.716] (-773.524) (-774.813) (-775.378) * [-773.870] (-773.148) (-775.925) (-774.331) -- 0:00:01
971000 -- (-773.348) (-777.396) [-771.863] (-771.549) * (-771.989) (-772.558) (-773.125) [-774.288] -- 0:00:01
971500 -- (-775.461) (-779.292) [-772.705] (-774.104) * [-772.052] (-776.196) (-772.199) (-773.741) -- 0:00:01
972000 -- (-780.588) [-771.757] (-771.441) (-771.648) * (-772.255) (-775.560) [-772.477] (-772.400) -- 0:00:01
972500 -- [-772.016] (-772.396) (-773.157) (-772.695) * [-772.459] (-774.897) (-772.480) (-773.887) -- 0:00:01
973000 -- (-772.696) [-771.933] (-772.340) (-774.721) * (-773.789) [-772.714] (-774.209) (-775.872) -- 0:00:01
973500 -- [-772.421] (-773.751) (-773.620) (-774.166) * (-773.065) [-772.951] (-773.538) (-776.420) -- 0:00:01
974000 -- (-774.289) (-773.793) (-772.888) [-771.880] * (-773.584) (-771.793) (-772.516) [-773.565] -- 0:00:01
974500 -- (-779.321) (-773.947) [-773.299] (-771.599) * [-777.311] (-771.710) (-776.907) (-774.922) -- 0:00:01
975000 -- (-780.126) [-775.242] (-773.942) (-772.962) * (-775.561) (-772.148) [-775.513] (-777.981) -- 0:00:01
Average standard deviation of split frequencies: 0.008436
975500 -- (-777.357) [-772.003] (-773.271) (-773.210) * (-773.409) (-775.944) (-772.449) [-774.153] -- 0:00:01
976000 -- [-775.136] (-774.564) (-773.760) (-773.043) * [-771.934] (-774.687) (-774.112) (-779.664) -- 0:00:01
976500 -- (-773.686) (-775.199) [-771.933] (-772.833) * [-772.413] (-775.871) (-773.201) (-774.079) -- 0:00:01
977000 -- (-773.380) [-773.007] (-774.250) (-772.197) * (-773.775) (-773.163) (-773.115) [-778.824] -- 0:00:01
977500 -- (-773.317) [-774.908] (-772.270) (-776.372) * (-773.823) [-771.918] (-773.719) (-777.599) -- 0:00:01
978000 -- (-773.354) (-778.320) (-775.102) [-773.934] * (-774.445) (-775.796) (-774.902) [-774.448] -- 0:00:01
978500 -- (-773.856) (-780.569) (-773.881) [-773.575] * (-775.000) [-772.281] (-774.272) (-772.728) -- 0:00:01
979000 -- (-773.774) (-776.947) [-774.201] (-775.432) * (-776.801) (-772.801) [-773.648] (-775.764) -- 0:00:01
979500 -- (-773.015) (-772.756) (-772.482) [-774.093] * (-777.955) (-774.047) (-778.068) [-774.943] -- 0:00:01
980000 -- (-772.098) [-775.049] (-773.972) (-776.545) * [-772.556] (-774.829) (-772.188) (-774.669) -- 0:00:01
Average standard deviation of split frequencies: 0.008749
980500 -- (-772.239) (-774.556) (-776.077) [-774.125] * (-777.176) (-778.058) [-772.509] (-779.424) -- 0:00:01
981000 -- [-773.893] (-773.588) (-772.612) (-775.938) * (-775.891) (-775.645) [-773.052] (-777.376) -- 0:00:01
981500 -- (-771.609) (-773.536) (-774.248) [-774.395] * [-774.516] (-776.773) (-773.653) (-774.475) -- 0:00:01
982000 -- (-774.337) (-775.597) (-773.260) [-777.180] * [-778.010] (-776.655) (-772.486) (-774.780) -- 0:00:01
982500 -- [-774.169] (-775.465) (-773.325) (-772.912) * (-775.329) (-774.618) (-773.414) [-778.262] -- 0:00:01
983000 -- [-773.752] (-772.360) (-772.919) (-772.142) * (-772.208) [-775.985] (-773.307) (-772.590) -- 0:00:01
983500 -- (-772.524) (-773.199) [-773.336] (-775.846) * [-772.670] (-775.153) (-771.966) (-773.449) -- 0:00:01
984000 -- (-777.235) (-772.308) [-773.094] (-776.953) * (-774.873) (-773.380) (-772.119) [-772.883] -- 0:00:00
984500 -- (-773.674) [-772.214] (-773.086) (-778.465) * (-772.383) (-774.385) (-772.134) [-773.381] -- 0:00:00
985000 -- (-773.925) [-772.146] (-775.303) (-771.861) * (-772.563) (-774.319) [-772.922] (-771.950) -- 0:00:00
Average standard deviation of split frequencies: 0.008765
985500 -- (-773.723) (-771.663) (-775.281) [-773.086] * (-775.536) (-774.865) (-773.552) [-772.897] -- 0:00:00
986000 -- [-772.816] (-775.925) (-774.501) (-774.466) * (-777.481) [-772.491] (-773.373) (-773.900) -- 0:00:00
986500 -- (-773.050) (-775.561) (-777.321) [-776.222] * (-777.577) (-777.962) [-773.139] (-774.302) -- 0:00:00
987000 -- (-772.294) [-771.909] (-773.431) (-774.271) * (-773.048) [-773.660] (-773.680) (-774.346) -- 0:00:00
987500 -- (-773.848) (-774.084) (-775.405) [-773.595] * (-774.388) (-776.321) (-774.304) [-773.474] -- 0:00:00
988000 -- (-773.616) (-773.959) [-773.443] (-774.966) * (-772.674) [-773.589] (-774.699) (-772.369) -- 0:00:00
988500 -- (-778.188) [-773.898] (-773.728) (-777.747) * [-773.420] (-773.093) (-772.976) (-772.963) -- 0:00:00
989000 -- (-778.253) [-774.392] (-773.375) (-775.892) * (-773.605) (-773.993) (-771.962) [-774.062] -- 0:00:00
989500 -- [-772.316] (-775.788) (-772.115) (-773.288) * (-777.948) [-771.458] (-775.572) (-774.705) -- 0:00:00
990000 -- (-775.946) [-774.439] (-771.774) (-772.154) * (-775.877) (-774.453) [-773.588] (-774.228) -- 0:00:00
Average standard deviation of split frequencies: 0.008787
990500 -- (-773.082) (-773.725) (-773.483) [-771.730] * (-776.229) [-772.701] (-773.555) (-774.303) -- 0:00:00
991000 -- (-772.970) (-773.970) [-785.127] (-772.032) * (-774.225) [-772.102] (-776.703) (-774.524) -- 0:00:00
991500 -- [-773.161] (-774.829) (-779.117) (-778.664) * (-774.880) [-774.729] (-780.661) (-775.190) -- 0:00:00
992000 -- (-773.208) [-774.721] (-774.554) (-775.451) * (-775.182) [-774.106] (-776.094) (-774.433) -- 0:00:00
992500 -- (-776.876) [-772.358] (-774.673) (-773.088) * (-783.291) (-776.785) (-773.924) [-774.204] -- 0:00:00
993000 -- [-772.323] (-772.465) (-775.965) (-775.154) * [-778.111] (-779.729) (-773.700) (-776.261) -- 0:00:00
993500 -- [-772.568] (-774.497) (-775.418) (-776.728) * (-776.136) [-775.194] (-777.019) (-774.616) -- 0:00:00
994000 -- [-772.754] (-772.738) (-774.924) (-773.491) * (-776.374) (-775.268) (-772.726) [-772.053] -- 0:00:00
994500 -- (-772.109) [-779.725] (-773.378) (-772.699) * (-778.074) (-774.392) [-772.660] (-772.438) -- 0:00:00
995000 -- (-772.000) (-774.314) [-773.291] (-774.077) * [-774.513] (-776.021) (-775.233) (-772.077) -- 0:00:00
Average standard deviation of split frequencies: 0.008740
995500 -- (-773.272) (-773.612) [-773.491] (-774.819) * [-774.746] (-775.523) (-774.764) (-772.141) -- 0:00:00
996000 -- (-773.357) [-775.229] (-772.497) (-775.803) * (-774.212) (-775.380) (-773.436) [-771.849] -- 0:00:00
996500 -- (-771.455) [-773.978] (-771.979) (-773.094) * (-773.015) (-775.182) [-772.858] (-773.367) -- 0:00:00
997000 -- (-772.290) (-772.842) (-773.547) [-773.442] * [-776.629] (-778.293) (-772.486) (-775.182) -- 0:00:00
997500 -- [-771.630] (-774.216) (-773.245) (-774.771) * [-773.522] (-781.118) (-773.126) (-772.449) -- 0:00:00
998000 -- [-772.159] (-775.311) (-771.597) (-772.433) * [-774.295] (-773.681) (-773.295) (-773.368) -- 0:00:00
998500 -- [-774.686] (-774.708) (-772.904) (-773.703) * (-776.017) (-771.982) [-775.332] (-774.258) -- 0:00:00
999000 -- (-771.523) [-775.273] (-774.603) (-774.028) * [-774.365] (-772.725) (-772.289) (-777.850) -- 0:00:00
999500 -- (-772.547) [-771.863] (-777.837) (-772.290) * (-773.576) (-773.007) [-771.472] (-776.972) -- 0:00:00
1000000 -- (-773.735) (-771.721) (-773.514) [-772.914] * (-773.090) (-776.024) (-773.613) [-774.066] -- 0:00:00
Average standard deviation of split frequencies: 0.008605
Analysis completed in 1 mins 1 seconds
Analysis used 60.01 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -771.26
Likelihood of best state for "cold" chain of run 2 was -771.26
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.0 % ( 31 %) Dirichlet(Pi{all})
30.8 % ( 18 %) Slider(Pi{all})
78.7 % ( 48 %) Multiplier(Alpha{1,2})
77.7 % ( 44 %) Multiplier(Alpha{3})
23.0 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 95 %) ExtSPR(Tau{all},V{all})
70.1 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 95 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.8 % ( 30 %) Dirichlet(Pi{all})
30.9 % ( 33 %) Slider(Pi{all})
79.2 % ( 56 %) Multiplier(Alpha{1,2})
78.1 % ( 56 %) Multiplier(Alpha{3})
22.3 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166579 0.82 0.67
3 | 166479 166406 0.84
4 | 166706 167331 166499
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166968 0.82 0.67
3 | 166297 167140 0.84
4 | 166531 166151 166913
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -773.04
|2 1 1 |
| 2 2 |
| 2 221 2 |
| 1 1 1 * 2 1 |
| 11 * 1 2 211 1 11 |
| 2 2 2 21 1 2 2 22* 2 |
|1 1 1 2 *1 2 1 *1 2 2 1 2 |
| 2 1 1 2 11 1 2 1 1 12|
| 2 * * 2* 2 1 1 2 2 2 |
| * 1 1 2 * 1 2 1 2 2 1|
| 1 2 2 2 1 2 2 1 1 1 1 2 1 |
| 2 2 * 2 2 |
| 1 1 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -774.59
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -773.00 -777.97
2 -773.00 -776.21
--------------------------------------
TOTAL -773.00 -777.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894177 0.084197 0.383995 1.461167 0.855900 1501.00 1501.00 1.001
r(A<->C){all} 0.164484 0.020497 0.000028 0.456643 0.126515 196.81 200.43 1.000
r(A<->G){all} 0.163031 0.019268 0.000001 0.432411 0.126110 110.57 258.19 1.000
r(A<->T){all} 0.162398 0.018275 0.000017 0.439707 0.132458 321.60 339.96 1.000
r(C<->G){all} 0.163441 0.020112 0.000001 0.455415 0.121497 108.00 156.71 1.001
r(C<->T){all} 0.173371 0.021721 0.000095 0.466102 0.134788 143.05 178.57 1.001
r(G<->T){all} 0.173275 0.021290 0.000048 0.463911 0.135435 202.27 223.61 1.000
pi(A){all} 0.202737 0.000278 0.171995 0.237212 0.202208 1169.20 1317.46 1.000
pi(C){all} 0.251685 0.000342 0.214565 0.286784 0.252294 1253.13 1296.60 1.000
pi(G){all} 0.328915 0.000382 0.290249 0.366322 0.328613 1320.51 1376.22 1.000
pi(T){all} 0.216663 0.000296 0.182273 0.249708 0.216129 1266.65 1273.42 1.000
alpha{1,2} 0.417422 0.217565 0.000117 1.382974 0.252048 1222.63 1333.96 1.000
alpha{3} 0.470663 0.258414 0.000127 1.473455 0.304404 752.31 957.63 1.000
pinvar{all} 0.997213 0.000010 0.990779 1.000000 0.998228 1235.41 1305.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*..*.
9 -- .****.
10 -- .**...
11 -- ..*.*.
12 -- .***.*
13 -- ..**..
14 -- ....**
15 -- .**.**
16 -- .*.***
17 -- .*.*..
18 -- ..****
19 -- ..*..*
20 -- ...**.
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.011777 0.147235 0.163891 2
8 456 0.151899 0.007537 0.146569 0.157229 2
9 453 0.150899 0.010835 0.143238 0.158561 2
10 453 0.150899 0.008951 0.144570 0.157229 2
11 451 0.150233 0.004240 0.147235 0.153231 2
12 445 0.148235 0.000471 0.147901 0.148568 2
13 441 0.146902 0.008009 0.141239 0.152565 2
14 421 0.140240 0.008009 0.134577 0.145903 2
15 417 0.138907 0.008951 0.132578 0.145237 2
16 409 0.136243 0.024026 0.119254 0.153231 2
17 409 0.136243 0.002355 0.134577 0.137908 2
18 407 0.135576 0.004240 0.132578 0.138574 2
19 407 0.135576 0.006124 0.131246 0.139907 2
20 402 0.133911 0.017901 0.121252 0.146569 2
21 390 0.129913 0.005653 0.125916 0.133911 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100096 0.010379 0.000004 0.298967 0.069203 1.000 2
length{all}[2] 0.098621 0.009826 0.000113 0.294627 0.067365 1.000 2
length{all}[3] 0.098815 0.009422 0.000004 0.291521 0.070183 1.000 2
length{all}[4] 0.099691 0.009871 0.000022 0.289742 0.070407 1.000 2
length{all}[5] 0.102778 0.009987 0.000017 0.302766 0.074937 1.000 2
length{all}[6] 0.097706 0.009896 0.000043 0.293109 0.065809 1.000 2
length{all}[7] 0.099175 0.009007 0.000142 0.301651 0.069094 0.999 2
length{all}[8] 0.095372 0.008454 0.000176 0.286415 0.068510 0.998 2
length{all}[9] 0.102548 0.010275 0.000154 0.283446 0.073405 0.998 2
length{all}[10] 0.100800 0.009948 0.000020 0.316799 0.068708 1.000 2
length{all}[11] 0.100488 0.010694 0.000278 0.305565 0.071206 0.998 2
length{all}[12] 0.093257 0.007853 0.000493 0.257849 0.065765 0.999 2
length{all}[13] 0.094873 0.009313 0.000682 0.293980 0.063276 1.000 2
length{all}[14] 0.101118 0.011348 0.000392 0.297670 0.066391 0.998 2
length{all}[15] 0.096901 0.009740 0.000106 0.291143 0.064346 0.998 2
length{all}[16] 0.101935 0.011031 0.000077 0.315524 0.065230 1.001 2
length{all}[17] 0.098799 0.009962 0.000074 0.294868 0.064527 1.003 2
length{all}[18] 0.100241 0.010010 0.000072 0.288731 0.068571 0.998 2
length{all}[19] 0.100955 0.011524 0.000072 0.322188 0.065953 1.002 2
length{all}[20] 0.100914 0.012177 0.000240 0.295866 0.067785 1.004 2
length{all}[21] 0.096725 0.011156 0.000148 0.309545 0.062171 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008605
Maximum standard deviation of split frequencies = 0.024026
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 564
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 188 / 188 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 188 / 188 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011314 0.059088 0.070495 0.024184 0.063526 0.100483 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -813.390671
Iterating by ming2
Initial: fx= 813.390671
x= 0.01131 0.05909 0.07049 0.02418 0.06353 0.10048 0.30000 1.30000
1 h-m-p 0.0000 0.0001 453.5811 ++ 800.902475 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0431 32.5484 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 414.2317 ++ 789.024156 m 0.0001 44 | 2/8
4 h-m-p 0.0009 0.0512 27.4990 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 370.6785 +++ 763.032238 m 0.0002 76 | 3/8
6 h-m-p 0.0026 0.0618 23.3824 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 322.6030 ++ 760.533422 m 0.0000 108 | 4/8
8 h-m-p 0.0003 0.0794 19.6505 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 263.2788 ++ 757.916548 m 0.0000 138 | 5/8
10 h-m-p 0.0005 0.1198 13.0671 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 185.9191 +++ 752.262252 m 0.0002 170 | 6/8
12 h-m-p 0.8822 8.0000 0.0000 ++ 752.262252 m 8.0000 181 | 6/8
13 h-m-p 0.0754 8.0000 0.0006 ++++ 752.262252 m 8.0000 196 | 6/8
14 h-m-p 0.0022 0.1605 2.1320 ------Y 752.262252 0 0.0000 215 | 6/8
15 h-m-p 0.5980 8.0000 0.0000 Y 752.262252 0 0.5980 226 | 6/8
16 h-m-p 0.4059 8.0000 0.0000 ---------------.. | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 752.262252 m 8.0000 268 | 6/8
18 h-m-p 0.0010 0.4827 1.0216 --------C 752.262252 0 0.0000 289 | 6/8
19 h-m-p 0.0160 8.0000 0.0002 +++++ 752.262252 m 8.0000 303 | 6/8
20 h-m-p 0.0037 1.8547 1.4767 +++++ 752.262196 m 1.8547 319 | 7/8
21 h-m-p 0.4121 2.0606 1.3178 ++ 752.262039 m 2.0606 330 | 8/8
22 h-m-p 0.0160 8.0000 0.0000 Y 752.262039 0 0.0160 341
Out..
lnL = -752.262039
342 lfun, 342 eigenQcodon, 2052 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.091906 0.109668 0.013616 0.076338 0.100230 0.097348 0.000100 0.707478 0.482612
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.024826
np = 9
lnL0 = -840.518230
Iterating by ming2
Initial: fx= 840.518230
x= 0.09191 0.10967 0.01362 0.07634 0.10023 0.09735 0.00011 0.70748 0.48261
1 h-m-p 0.0000 0.0000 431.0654 ++ 839.704764 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 523.3256 ++ 825.820223 m 0.0001 26 | 2/9
3 h-m-p 0.0003 0.0014 111.9846 ++ 773.493049 m 0.0014 38 | 3/9
4 h-m-p 0.0006 0.0029 88.9746 ++ 755.156245 m 0.0029 50 | 4/9
5 h-m-p 0.0000 0.0000 6709.4189 ++ 754.591673 m 0.0000 62 | 5/9
6 h-m-p 0.0001 0.0003 19.0787 ++ 754.097354 m 0.0003 74 | 6/9
7 h-m-p 0.0000 0.0000 603.9165 ++ 753.882596 m 0.0000 86 | 7/9
8 h-m-p 0.0000 0.0004 202.6004 +++ 752.262192 m 0.0004 99 | 8/9
9 h-m-p 1.6000 8.0000 0.0002 ----------------.. | 8/9
10 h-m-p 0.0160 8.0000 0.0002 +++++ 752.262192 m 8.0000 141 | 8/9
11 h-m-p 0.0048 2.1724 0.3002 ----------C 752.262192 0 0.0000 164 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 752.262192 m 8.0000 180 | 8/9
13 h-m-p 0.0040 1.9802 0.3293 ----------Y 752.262192 0 0.0000 203 | 8/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 752.262192 m 8.0000 219 | 8/9
15 h-m-p 0.0043 2.1733 0.3003 --------Y 752.262192 0 0.0000 240 | 8/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 752.262192 m 8.0000 256 | 8/9
17 h-m-p 0.0044 2.1977 0.2973 -----------N 752.262192 0 0.0000 280 | 8/9
18 h-m-p 0.0160 8.0000 0.0000 +++++ 752.262192 m 8.0000 296 | 8/9
19 h-m-p 0.0045 2.2281 0.2933 ------------.. | 8/9
20 h-m-p 0.0160 8.0000 0.0002 +++++ 752.262191 m 8.0000 335 | 8/9
21 h-m-p 0.0050 2.2230 0.2946 ------------.. | 8/9
22 h-m-p 0.0160 8.0000 0.0002 +++++ 752.262191 m 8.0000 374 | 8/9
23 h-m-p 0.0049 2.1867 0.3002 ----------Y 752.262191 0 0.0000 397 | 8/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 752.262191 m 8.0000 413 | 8/9
25 h-m-p 0.0030 1.5158 0.4331 ---------Y 752.262191 0 0.0000 435 | 8/9
26 h-m-p 0.0160 8.0000 0.0001 --------C 752.262191 0 0.0000 456 | 8/9
27 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
28 h-m-p 0.0160 8.0000 0.0002 +++++ 752.262191 m 8.0000 496 | 8/9
29 h-m-p 0.0050 2.2529 0.2920 ---------Y 752.262191 0 0.0000 518 | 8/9
30 h-m-p 0.0007 0.3285 2.0031 -----------.. | 8/9
31 h-m-p 0.0160 8.0000 0.0002 +++++ 752.262191 m 8.0000 555 | 8/9
32 h-m-p 0.0057 1.2872 0.2646 ++++ 752.262039 m 1.2872 570 | 9/9
33 h-m-p 0.0160 8.0000 0.0000 N 752.262039 0 0.0160 583 | 9/9
34 h-m-p 0.0160 8.0000 0.0000 N 752.262039 0 0.0160 595
Out..
lnL = -752.262039
596 lfun, 1788 eigenQcodon, 7152 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.035589 0.025715 0.037766 0.049226 0.035268 0.074393 0.000100 1.323498 0.353103 0.136327 2.915238
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.115948
np = 11
lnL0 = -794.273309
Iterating by ming2
Initial: fx= 794.273309
x= 0.03559 0.02572 0.03777 0.04923 0.03527 0.07439 0.00011 1.32350 0.35310 0.13633 2.91524
1 h-m-p 0.0000 0.0000 351.6636 ++ 793.638082 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 106.3169 ++++ 779.800097 m 0.0014 32 | 2/11
3 h-m-p 0.0004 0.0018 92.0348 ++ 769.576458 m 0.0018 46 | 3/11
4 h-m-p 0.0000 0.0000 12974238.3574 ++ 768.537334 m 0.0000 60 | 4/11
5 h-m-p 0.0000 0.0000 521694.2429 ++ 763.928477 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0001 13535.2666 ++ 756.953163 m 0.0001 88 | 6/11
7 h-m-p 0.0000 0.0002 2426.8926 ++ 752.995441 m 0.0002 102 | 7/11
8 h-m-p 0.0001 0.0006 1280.0558 ++ 752.262231 m 0.0006 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0005 ++ 752.262231 m 8.0000 130 | 8/11
10 h-m-p 0.0294 8.0000 0.1255 +++++ 752.262226 m 8.0000 150 | 8/11
11 h-m-p 0.2755 1.5756 3.6428 -------------C 752.262226 0 0.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0022 +++++ 752.262226 m 8.0000 197 | 8/11
13 h-m-p 0.0046 1.5815 3.8390 ---------C 752.262226 0 0.0000 223 | 8/11
14 h-m-p 0.0160 8.0000 0.0249 +++++ 752.262223 m 8.0000 240 | 8/11
15 h-m-p 0.0498 1.6173 4.0004 ------------Y 752.262223 0 0.0000 269 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 752.262223 m 8.0000 286 | 8/11
17 h-m-p 0.0160 8.0000 0.0961 +++++ 752.262194 m 8.0000 306 | 8/11
18 h-m-p 0.1978 3.0973 3.8852 -------------Y 752.262194 0 0.0000 336 | 8/11
19 h-m-p 0.0160 8.0000 0.0000 -Y 752.262194 0 0.0010 351 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 752.262194 m 8.0000 371 | 8/11
21 h-m-p 0.0160 8.0000 0.2580 ---------C 752.262194 0 0.0000 397 | 8/11
22 h-m-p 0.0160 8.0000 0.0000 ------N 752.262194 0 0.0000 420 | 8/11
23 h-m-p 0.0160 8.0000 0.0000 --N 752.262194 0 0.0003 439
Out..
lnL = -752.262194
440 lfun, 1760 eigenQcodon, 7920 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -752.278159 S = -752.259875 -0.007009
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:05
did 20 / 55 patterns 0:05
did 30 / 55 patterns 0:05
did 40 / 55 patterns 0:05
did 50 / 55 patterns 0:05
did 55 / 55 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067702 0.052379 0.017927 0.052440 0.102762 0.016379 0.000100 0.321150 1.701906
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 28.584896
np = 9
lnL0 = -805.503030
Iterating by ming2
Initial: fx= 805.503030
x= 0.06770 0.05238 0.01793 0.05244 0.10276 0.01638 0.00011 0.32115 1.70191
1 h-m-p 0.0000 0.0000 401.7169 ++ 805.181248 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0107 31.9165 +++++ 800.431557 m 0.0107 29 | 2/9
3 h-m-p 0.0001 0.0009 1325.8103 ++ 759.424301 m 0.0009 41 | 3/9
4 h-m-p 0.0001 0.0003 1000.7503 ++ 755.971262 m 0.0003 53 | 4/9
5 h-m-p 0.0000 0.0001 80.8913 --------.. | 4/9
6 h-m-p 0.0000 0.0000 354.5717 ++ 755.778565 m 0.0000 83 | 5/9
7 h-m-p 0.0001 0.0089 7.2394 ---------.. | 5/9
8 h-m-p 0.0000 0.0000 307.0326 ++ 752.713961 m 0.0000 114 | 6/9
9 h-m-p 0.0125 0.1355 0.6483 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 211.6580 ++ 752.709854 m 0.0000 152 | 7/9
11 h-m-p 0.0160 8.0000 4.6746 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 180.3556 ++ 752.262114 m 0.0000 187 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 ++ 752.262114 m 8.0000 199 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 752.262114 m 8.0000 215 | 8/9
15 h-m-p 0.0160 8.0000 0.0048 --------Y 752.262114 0 0.0000 236 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
17 h-m-p 0.0160 8.0000 0.0002 +++++ 752.262113 m 8.0000 276 | 8/9
18 h-m-p 0.2680 8.0000 0.0058 ----------C 752.262113 0 0.0000 299 | 8/9
19 h-m-p 0.0160 8.0000 1.5986 +++
QuantileBeta(0.15, 0.00500, 6.61896) = 3.362904e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
+ 752.262039 m 8.0000 315
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.724769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85994) = 1.666588e-161 2000 rounds
| 8/9
20 h-m-p 1.6000 8.0000 0.0018
QuantileBeta(0.15, 0.00500, 12.85710) = 1.666970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85922) = 1.666684e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85975) = 1.666612e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85989) = 1.666595e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85992) = 1.666590e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
Y 752.262039 0 0.0000 339
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.724769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.86026) = 1.666545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85960) = 1.666632e-161 2000 rounds
| 8/9
21 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
Y 752.262039 0 1.6000 352
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
Out..
lnL = -752.262039
353 lfun, 3883 eigenQcodon, 21180 P(t)
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.85993) = 1.666589e-161 2000 rounds
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.102910 0.090509 0.060184 0.096975 0.013093 0.026446 0.000100 0.900000 0.534469 1.409393 2.360546
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.749411
np = 11
lnL0 = -813.468686
Iterating by ming2
Initial: fx= 813.468686
x= 0.10291 0.09051 0.06018 0.09698 0.01309 0.02645 0.00011 0.90000 0.53447 1.40939 2.36055
1 h-m-p 0.0000 0.0000 336.9115 ++ 813.244231 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 426.1349 ++ 801.901414 m 0.0001 30 | 2/11
3 h-m-p 0.0001 0.0003 138.9851 ++ 792.168623 m 0.0003 44 | 3/11
4 h-m-p 0.0004 0.0047 88.9822 ++ 764.838916 m 0.0047 58 | 4/11
5 h-m-p 0.0000 0.0000 12774.8764 ++ 757.164059 m 0.0000 72 | 5/11
6 h-m-p 0.0258 0.1290 2.5324 -------------.. | 5/11
7 h-m-p 0.0000 0.0000 298.2112 ++ 754.096860 m 0.0000 111 | 6/11
8 h-m-p 0.0005 0.0074 15.6014 ++ 752.654312 m 0.0074 125 | 7/11
9 h-m-p 0.0000 0.0000 427.5720 ++ 752.262110 m 0.0000 139 | 8/11
10 h-m-p 1.6000 8.0000 0.0001 ++ 752.262109 m 8.0000 153 | 8/11
11 h-m-p 0.0160 8.0000 0.0646 ------------N 752.262109 0 0.0000 182 | 8/11
12 h-m-p 0.0144 7.1886 0.0055 +++++ 752.262039 m 7.1886 202 | 9/11
13 h-m-p 1.6000 8.0000 0.0000 Y 752.262039 0 1.6000 219 | 9/11
14 h-m-p 0.0528 8.0000 0.0003 ---Y 752.262039 0 0.0002 238 | 9/11
15 h-m-p 0.1936 8.0000 0.0000 -----------N 752.262039 0 0.0000 265
Out..
lnL = -752.262039
266 lfun, 3192 eigenQcodon, 17556 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -752.321214 S = -752.262963 -0.025875
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:15
did 20 / 55 patterns 0:15
did 30 / 55 patterns 0:15
did 40 / 55 patterns 0:15
did 50 / 55 patterns 0:16
did 55 / 55 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=188
NC_011896_1_WP_010908136_1_1159_MLBR_RS05435 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NC_002677_1_NP_301812_1_684_ML1115 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH
**************************************************
NC_011896_1_WP_010908136_1_1159_MLBR_RS05435 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NC_002677_1_NP_301812_1_684_ML1115 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090 HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF
**************************************************
NC_011896_1_WP_010908136_1_1159_MLBR_RS05435 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NC_002677_1_NP_301812_1_684_ML1115 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090 SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG
**************************************************
NC_011896_1_WP_010908136_1_1159_MLBR_RS05435 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NC_002677_1_NP_301812_1_684_ML1115 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090 IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
**************************************
>NC_011896_1_WP_010908136_1_1159_MLBR_RS05435 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA TTGCTAACTCGAAA >NC_002677_1_NP_301812_1_684_ML1115 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA TTGCTAACTCGAAA >NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA TTGCTAACTCGAAA >NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA TTGCTAACTCGAAA >NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA TTGCTAACTCGAAA >NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090 GTGCGATGTGACGTGAGGGCGTTGGCCCTGGCGGCTCGGGGGTTGATAGA GCTGATGATTGTGATTCCGATGGTTGCGGGGTGCTCCAATGCAGGCTCTA ACAAGTCGGTCGGGACGATATCGTCGACGCCTGGGAATACGGAGGGCCAT CATGGCCCAATGTTCCCGCGATGCGGGGGTATCAGCGATCAGACGATGTC GCAGCTAACGAAGGTTACCGGGTTGACGAACACCGCCCGGAATTCGGTGG GTTGCCAGTGGCTGGCCGGTGGCGGTATCGTTGGCCCGCACTTTTCGTTT TCATGGTATCGCGGCAGCCCGATTGGGCGTGAACGCAAGACCGAGGAGCT GTCACGGGCGAGCGTTGACGATATCAATATCAACGGCCACAGCGGTTTCA TAGCGGTCGGAAACGAGCCCAGCTTGGGCGATTCGCTCTGCGAAGTTGGA ATCCAGTTCCAGGATGACTTCATCGAATGGTCGGTCAGTTTCAGCCAAAA GCCATTCCCGTCGCCATGCGGCATCGCTAAGGAACTGACTCGCCAGTCGA TTGCTAACTCGAAA
>NC_011896_1_WP_010908136_1_1159_MLBR_RS05435 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK >NC_002677_1_NP_301812_1_684_ML1115 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK >NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK >NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK >NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK >NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090 VRCDVRALALAARGLIELMIVIPMVAGCSNAGSNKSVGTISSTPGNTEGH HGPMFPRCGGISDQTMSQLTKVTGLTNTARNSVGCQWLAGGGIVGPHFSF SWYRGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPSLGDSLCEVG IQFQDDFIEWSVSFSQKPFPSPCGIAKELTRQSIANSK
#NEXUS
[ID: 5526162807]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908136_1_1159_MLBR_RS05435
NC_002677_1_NP_301812_1_684_ML1115
NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295
NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945
NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970
NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908136_1_1159_MLBR_RS05435,
2 NC_002677_1_NP_301812_1_684_ML1115,
3 NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295,
4 NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945,
5 NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970,
6 NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06920348,2:0.06736484,3:0.07018251,4:0.07040715,5:0.07493683,6:0.06580895);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06920348,2:0.06736484,3:0.07018251,4:0.07040715,5:0.07493683,6:0.06580895);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -773.00 -777.97
2 -773.00 -776.21
--------------------------------------
TOTAL -773.00 -777.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894177 0.084197 0.383995 1.461167 0.855900 1501.00 1501.00 1.001
r(A<->C){all} 0.164484 0.020497 0.000028 0.456643 0.126515 196.81 200.43 1.000
r(A<->G){all} 0.163031 0.019268 0.000001 0.432411 0.126110 110.57 258.19 1.000
r(A<->T){all} 0.162398 0.018275 0.000017 0.439707 0.132458 321.60 339.96 1.000
r(C<->G){all} 0.163441 0.020112 0.000001 0.455415 0.121497 108.00 156.71 1.001
r(C<->T){all} 0.173371 0.021721 0.000095 0.466102 0.134788 143.05 178.57 1.001
r(G<->T){all} 0.173275 0.021290 0.000048 0.463911 0.135435 202.27 223.61 1.000
pi(A){all} 0.202737 0.000278 0.171995 0.237212 0.202208 1169.20 1317.46 1.000
pi(C){all} 0.251685 0.000342 0.214565 0.286784 0.252294 1253.13 1296.60 1.000
pi(G){all} 0.328915 0.000382 0.290249 0.366322 0.328613 1320.51 1376.22 1.000
pi(T){all} 0.216663 0.000296 0.182273 0.249708 0.216129 1266.65 1273.42 1.000
alpha{1,2} 0.417422 0.217565 0.000117 1.382974 0.252048 1222.63 1333.96 1.000
alpha{3} 0.470663 0.258414 0.000127 1.473455 0.304404 752.31 957.63 1.000
pinvar{all} 0.997213 0.000010 0.990779 1.000000 0.998228 1235.41 1305.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1115/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 188
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 6 6 6 6 6 6 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 5 5 5 5 5 5
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 11 11 11 11 11 11 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 5 | CCG 5 5 5 5 5 5 | CAG 6 6 6 6 6 6 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 1 1 1 1 1 1 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 6 6 6 6 6 6
ATA 3 3 3 3 3 3 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 6 6 6 6 6 6 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 3 3 3 3 3 3 | Asp GAT 4 4 4 4 4 4 | Gly GGT 5 5 5 5 5 5
GTC 3 3 3 3 3 3 | GCC 3 3 3 3 3 3 | GAC 3 3 3 3 3 3 | GGC 9 9 9 9 9 9
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 4 4 4 4 4 4 | GGA 2 2 2 2 2 2
GTG 4 4 4 4 4 4 | GCG 5 5 5 5 5 5 | GAG 5 5 5 5 5 5 | GGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435
position 1: T:0.19681 C:0.19681 A:0.27128 G:0.33511
position 2: T:0.26064 C:0.25000 A:0.22872 G:0.26064
position 3: T:0.19149 C:0.30851 A:0.10638 G:0.39362
Average T:0.21631 C:0.25177 A:0.20213 G:0.32979
#2: NC_002677_1_NP_301812_1_684_ML1115
position 1: T:0.19681 C:0.19681 A:0.27128 G:0.33511
position 2: T:0.26064 C:0.25000 A:0.22872 G:0.26064
position 3: T:0.19149 C:0.30851 A:0.10638 G:0.39362
Average T:0.21631 C:0.25177 A:0.20213 G:0.32979
#3: NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295
position 1: T:0.19681 C:0.19681 A:0.27128 G:0.33511
position 2: T:0.26064 C:0.25000 A:0.22872 G:0.26064
position 3: T:0.19149 C:0.30851 A:0.10638 G:0.39362
Average T:0.21631 C:0.25177 A:0.20213 G:0.32979
#4: NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945
position 1: T:0.19681 C:0.19681 A:0.27128 G:0.33511
position 2: T:0.26064 C:0.25000 A:0.22872 G:0.26064
position 3: T:0.19149 C:0.30851 A:0.10638 G:0.39362
Average T:0.21631 C:0.25177 A:0.20213 G:0.32979
#5: NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970
position 1: T:0.19681 C:0.19681 A:0.27128 G:0.33511
position 2: T:0.26064 C:0.25000 A:0.22872 G:0.26064
position 3: T:0.19149 C:0.30851 A:0.10638 G:0.39362
Average T:0.21631 C:0.25177 A:0.20213 G:0.32979
#6: NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090
position 1: T:0.19681 C:0.19681 A:0.27128 G:0.33511
position 2: T:0.26064 C:0.25000 A:0.22872 G:0.26064
position 3: T:0.19149 C:0.30851 A:0.10638 G:0.39362
Average T:0.21631 C:0.25177 A:0.20213 G:0.32979
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 36 | TCC 6 | TAC 0 | TGC 30
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 66 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 6
CTC 6 | CCC 6 | CAC 12 | CGC 18
CTA 6 | CCA 18 | Gln Q CAA 6 | CGA 12
CTG 30 | CCG 30 | CAG 36 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 6 | Asn N AAT 24 | Ser S AGT 6
ATC 42 | ACC 18 | AAC 30 | AGC 36
ATA 18 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 24 | ACG 36 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 18 | Asp D GAT 24 | Gly G GGT 30
GTC 18 | GCC 18 | GAC 18 | GGC 54
GTA 0 | GCA 6 | Glu E GAA 24 | GGA 12
GTG 24 | GCG 30 | GAG 30 | GGG 42
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19681 C:0.19681 A:0.27128 G:0.33511
position 2: T:0.26064 C:0.25000 A:0.22872 G:0.26064
position 3: T:0.19149 C:0.30851 A:0.10638 G:0.39362
Average T:0.21631 C:0.25177 A:0.20213 G:0.32979
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -752.262039 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 453.0 111.0 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 453.0 111.0 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 453.0 111.0 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 453.0 111.0 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 453.0 111.0 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 453.0 111.0 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -752.262039 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -752.262194 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.933923 0.009258 0.000001 6.161205
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.93392 0.00926 0.05682
w: 0.00000 1.00000 6.16120
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 453.0 111.0 0.3593 0.0000 0.0000 0.0 0.0
7..2 0.000 453.0 111.0 0.3593 0.0000 0.0000 0.0 0.0
7..3 0.000 453.0 111.0 0.3593 0.0000 0.0000 0.0 0.0
7..4 0.000 453.0 111.0 0.3593 0.0000 0.0000 0.0 0.0
7..5 0.000 453.0 111.0 0.3593 0.0000 0.0000 0.0 0.0
7..6 0.000 453.0 111.0 0.3593 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -752.262039 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 12.859930
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 12.85993
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -752.262039 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.597881 2.603304
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908136_1_1159_MLBR_RS05435: 0.000004, NC_002677_1_NP_301812_1_684_ML1115: 0.000004, NZ_LVXE01000074_1_WP_010908136_1_2633_A3216_RS13295: 0.000004, NZ_LYPH01000021_1_WP_010908136_1_830_A8144_RS03945: 0.000004, NZ_CP029543_1_WP_010908136_1_1179_DIJ64_RS05970: 0.000004, NZ_AP014567_1_WP_010908136_1_1203_JK2ML_RS06090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.59788
(p1 = 0.00001) w = 2.60330
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.60330
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 453.0 111.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908136_1_1159_MLBR_RS05435)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.097 0.098 0.099 0.100 0.101 0.102 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Time used: 0:16
Model 1: NearlyNeutral -752.262039 Model 2: PositiveSelection -752.262194 Model 0: one-ratio -752.262039 Model 7: beta -752.262039 Model 8: beta&w>1 -752.262039 Model 0 vs 1 0.0 Model 2 vs 1 3.1000000012681994E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
