--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:51:19 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1117/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -657.05 -659.70
2 -657.06 -660.17
--------------------------------------
TOTAL -657.06 -659.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894974 0.095486 0.326824 1.483618 0.860603 1498.01 1499.50 1.000
r(A<->C){all} 0.171374 0.021002 0.000090 0.466220 0.134652 195.38 229.25 1.001
r(A<->G){all} 0.160108 0.020157 0.000061 0.454692 0.120828 186.05 204.28 1.001
r(A<->T){all} 0.173888 0.021338 0.000116 0.468051 0.134026 106.18 144.63 1.002
r(C<->G){all} 0.170217 0.020452 0.000007 0.462935 0.131695 266.05 272.88 1.000
r(C<->T){all} 0.163257 0.019881 0.000107 0.447042 0.121575 288.98 337.37 1.013
r(G<->T){all} 0.161156 0.018685 0.000011 0.436556 0.123389 251.16 282.95 1.001
pi(A){all} 0.234487 0.000368 0.195754 0.270343 0.234136 1366.80 1403.17 1.000
pi(C){all} 0.317929 0.000446 0.277452 0.359201 0.317442 1285.55 1290.79 1.000
pi(G){all} 0.285542 0.000435 0.248687 0.329915 0.284919 1338.59 1343.06 1.000
pi(T){all} 0.162041 0.000265 0.129446 0.193459 0.161721 1164.46 1295.55 1.000
alpha{1,2} 0.443632 0.254147 0.000162 1.456053 0.266268 1305.49 1403.24 1.000
alpha{3} 0.462435 0.250389 0.000248 1.448425 0.304370 1142.59 1222.95 1.001
pinvar{all} 0.996654 0.000017 0.988938 0.999998 0.997888 1096.98 1298.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -640.284086
Model 2: PositiveSelection -640.2841
Model 0: one-ratio -640.284113
Model 7: beta -640.284069
Model 8: beta&w>1 -640.28405
Model 0 vs 1 5.400000009103678E-5
Model 2 vs 1 2.7999999929306796E-5
Model 8 vs 7 3.80000001314329E-5
>C1
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C2
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C3
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C4
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C5
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C6
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
C1 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C2 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C3 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C4 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C5 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C6 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
**************************************************
C1 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C2 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C3 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C4 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C5 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C6 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
**************************************************
C1 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C2 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C3 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C4 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C5 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C6 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
**************************************************
C1 SAELVAFHVPR
C2 SAELVAFHVPR
C3 SAELVAFHVPR
C4 SAELVAFHVPR
C5 SAELVAFHVPR
C6 SAELVAFHVPR
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4830]--->[4830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.692 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C2 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C3 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C4 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C5 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
C6 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
**************************************************
C1 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C2 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C3 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C4 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C5 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
C6 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
**************************************************
C1 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C2 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C3 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C4 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C5 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
C6 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
**************************************************
C1 SAELVAFHVPR
C2 SAELVAFHVPR
C3 SAELVAFHVPR
C4 SAELVAFHVPR
C5 SAELVAFHVPR
C6 SAELVAFHVPR
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
C2 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
C3 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
C4 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
C5 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
C6 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
**************************************************
C1 CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
C2 CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
C3 CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
C4 CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
C5 CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
C6 CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
**************************************************
C1 CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
C2 CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
C3 CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
C4 CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
C5 CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
C6 CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
**************************************************
C1 TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
C2 TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
C3 TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
C4 TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
C5 TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
C6 TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
**************************************************
C1 CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
C2 CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
C3 CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
C4 CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
C5 CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
C6 CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
**************************************************
C1 TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
C2 TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
C3 TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
C4 TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
C5 TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
C6 TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
**************************************************
C1 AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
C2 AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
C3 AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
C4 AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
C5 AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
C6 AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
**************************************************
C1 GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
C2 GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
C3 GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
C4 GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
C5 GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
C6 GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
**************************************************
C1 GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
C2 GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
C3 GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
C4 GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
C5 GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
C6 GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
**************************************************
C1 AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
C2 AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
C3 AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
C4 AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
C5 AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
C6 AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
*********************************
>C1
ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
>C2
ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
>C3
ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
>C4
ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
>C5
ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
>C6
ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC
CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG
CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT
TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC
CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA
TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC
AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG
GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG
GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG
AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
>C1
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C2
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C3
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C4
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C5
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
>C6
MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
SAELVAFHVPR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 483 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855798
Setting output file names to "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1860894256
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5221006030
Seed = 1591363484
Swapseed = 1579855798
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1080.977098 -- -24.965149
Chain 2 -- -1080.977098 -- -24.965149
Chain 3 -- -1080.976994 -- -24.965149
Chain 4 -- -1080.977159 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1080.976994 -- -24.965149
Chain 2 -- -1080.977159 -- -24.965149
Chain 3 -- -1080.977159 -- -24.965149
Chain 4 -- -1080.977159 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1080.977] (-1080.977) (-1080.977) (-1080.977) * [-1080.977] (-1080.977) (-1080.977) (-1080.977)
500 -- (-661.208) [-670.039] (-679.179) (-670.235) * (-682.785) [-667.503] (-669.698) (-665.047) -- 0:00:00
1000 -- (-665.035) [-664.721] (-662.886) (-664.008) * (-670.171) (-667.993) (-670.264) [-663.547] -- 0:16:39
1500 -- (-669.310) [-662.601] (-667.452) (-662.614) * [-666.706] (-671.196) (-671.203) (-661.124) -- 0:11:05
2000 -- (-668.510) [-664.882] (-668.303) (-674.442) * (-663.874) [-663.883] (-661.209) (-665.045) -- 0:08:19
2500 -- (-674.375) [-666.764] (-663.859) (-674.210) * (-669.994) (-672.124) (-667.093) [-670.324] -- 0:06:39
3000 -- (-668.238) [-668.011] (-668.205) (-668.125) * (-671.269) (-663.909) (-663.644) [-669.304] -- 0:05:32
3500 -- [-665.114] (-665.122) (-670.372) (-673.732) * (-660.705) (-666.356) [-661.655] (-666.652) -- 0:04:44
4000 -- (-666.792) (-670.825) (-667.870) [-662.848] * [-663.385] (-667.619) (-671.295) (-665.502) -- 0:04:09
4500 -- (-660.517) (-674.659) (-665.731) [-671.571] * (-671.709) [-665.713] (-663.349) (-666.184) -- 0:03:41
5000 -- (-670.092) [-667.778] (-665.289) (-666.840) * (-677.093) [-661.839] (-666.863) (-666.498) -- 0:03:19
Average standard deviation of split frequencies: 0.085710
5500 -- (-670.631) (-669.011) [-663.549] (-671.070) * [-661.695] (-665.761) (-666.920) (-670.064) -- 0:03:00
6000 -- (-670.866) (-663.204) [-666.585] (-674.384) * (-666.452) (-667.101) (-672.695) [-667.525] -- 0:02:45
6500 -- (-664.560) [-668.563] (-665.034) (-661.981) * [-663.793] (-673.272) (-664.361) (-675.014) -- 0:02:32
7000 -- (-670.047) (-673.919) (-667.656) [-670.362] * (-667.371) [-663.857] (-668.695) (-667.842) -- 0:02:21
7500 -- (-665.058) (-670.946) [-666.346] (-670.189) * (-669.152) (-665.174) (-664.874) [-671.093] -- 0:02:12
8000 -- (-666.147) (-664.731) [-666.318] (-676.274) * (-667.048) (-669.039) [-661.723] (-665.378) -- 0:02:04
8500 -- (-664.362) (-666.187) [-672.254] (-678.053) * (-668.900) [-660.890] (-674.886) (-660.113) -- 0:01:56
9000 -- (-666.396) (-664.540) (-661.433) [-656.116] * (-669.559) [-668.238] (-672.994) (-671.720) -- 0:01:50
9500 -- (-670.649) (-664.192) [-665.200] (-656.468) * (-667.949) [-674.703] (-667.019) (-668.776) -- 0:01:44
10000 -- (-664.475) (-678.296) [-665.958] (-658.371) * (-672.359) [-663.190] (-664.754) (-667.557) -- 0:01:39
Average standard deviation of split frequencies: 0.079550
10500 -- (-666.764) (-671.530) [-672.256] (-658.250) * [-662.504] (-668.873) (-663.137) (-669.915) -- 0:01:34
11000 -- [-673.213] (-665.642) (-672.936) (-658.415) * [-668.236] (-664.532) (-662.799) (-664.685) -- 0:01:29
11500 -- (-665.508) (-667.209) [-662.896] (-657.263) * [-664.912] (-671.557) (-665.313) (-665.277) -- 0:01:25
12000 -- (-675.565) [-665.390] (-670.636) (-657.747) * (-676.836) (-677.743) [-666.427] (-668.363) -- 0:01:22
12500 -- (-665.471) [-669.337] (-677.198) (-658.632) * (-672.479) (-672.751) (-669.767) [-671.061] -- 0:01:19
13000 -- (-660.992) (-666.180) [-665.403] (-659.261) * (-674.962) [-664.024] (-669.000) (-667.675) -- 0:01:15
13500 -- (-666.985) [-672.186] (-669.187) (-656.128) * (-666.985) (-668.038) [-664.863] (-666.378) -- 0:01:13
14000 -- [-665.927] (-666.801) (-668.597) (-658.466) * [-656.054] (-661.759) (-664.546) (-664.111) -- 0:01:10
14500 -- (-666.358) (-676.352) [-663.921] (-657.610) * (-660.432) (-677.613) (-665.932) [-664.652] -- 0:01:07
15000 -- (-674.148) (-665.026) [-663.874] (-659.681) * (-658.200) (-661.010) (-670.727) [-662.140] -- 0:01:05
Average standard deviation of split frequencies: 0.051993
15500 -- (-667.732) (-660.534) [-666.135] (-661.944) * (-655.664) (-672.491) (-677.629) [-662.251] -- 0:01:03
16000 -- (-670.500) [-656.631] (-664.193) (-658.111) * (-660.777) (-666.852) (-667.985) [-664.961] -- 0:02:03
16500 -- (-671.973) (-655.512) [-670.383] (-658.451) * [-659.480] (-662.933) (-665.317) (-668.320) -- 0:01:59
17000 -- (-668.307) [-655.639] (-668.364) (-656.565) * [-657.614] (-660.205) (-670.162) (-662.084) -- 0:01:55
17500 -- [-667.017] (-658.234) (-679.719) (-658.620) * (-659.842) [-656.489] (-672.436) (-666.378) -- 0:01:52
18000 -- (-672.053) [-658.138] (-665.920) (-656.810) * (-658.215) (-656.552) [-664.831] (-663.965) -- 0:01:49
18500 -- (-664.289) (-658.067) (-674.337) [-658.161] * [-659.761] (-657.567) (-667.059) (-660.765) -- 0:01:46
19000 -- [-670.488] (-656.373) (-665.564) (-658.745) * [-657.572] (-658.043) (-663.443) (-677.608) -- 0:01:43
19500 -- [-673.745] (-656.074) (-668.569) (-656.817) * [-656.352] (-658.949) (-661.458) (-668.928) -- 0:01:40
20000 -- (-665.267) [-656.626] (-671.137) (-657.371) * (-657.312) (-659.543) (-675.416) [-674.214] -- 0:01:38
Average standard deviation of split frequencies: 0.046887
20500 -- (-670.072) [-658.498] (-671.754) (-656.534) * (-659.311) (-655.973) [-674.435] (-664.779) -- 0:01:35
21000 -- (-664.966) (-658.572) [-660.437] (-658.490) * (-657.456) (-657.335) (-677.841) [-661.839] -- 0:01:33
21500 -- [-664.780] (-661.157) (-667.513) (-658.464) * (-660.412) (-656.849) (-669.612) [-670.587] -- 0:01:31
22000 -- (-665.900) [-659.528] (-680.049) (-657.022) * [-658.801] (-656.439) (-667.726) (-667.899) -- 0:01:28
22500 -- (-666.860) (-657.532) [-670.899] (-655.935) * [-655.698] (-656.141) (-668.418) (-666.532) -- 0:01:26
23000 -- (-665.404) (-658.388) (-666.254) [-656.469] * (-658.101) [-658.255] (-662.171) (-669.400) -- 0:01:24
23500 -- (-666.361) [-655.763] (-666.145) (-656.077) * (-659.124) (-657.231) [-664.688] (-673.464) -- 0:01:23
24000 -- [-666.315] (-655.754) (-664.989) (-656.420) * (-659.074) [-657.639] (-677.961) (-658.452) -- 0:01:21
24500 -- (-670.453) [-656.753] (-668.481) (-658.311) * (-658.952) [-660.318] (-670.826) (-662.918) -- 0:01:19
25000 -- (-670.986) (-656.876) (-677.132) [-656.947] * [-656.147] (-658.456) (-665.354) (-656.167) -- 0:01:18
Average standard deviation of split frequencies: 0.033240
25500 -- (-665.241) (-657.099) [-667.344] (-656.746) * (-656.045) [-657.901] (-674.440) (-659.620) -- 0:01:16
26000 -- (-669.706) (-657.768) [-665.680] (-659.374) * (-657.118) [-657.457] (-676.774) (-656.127) -- 0:01:14
26500 -- [-667.426] (-657.123) (-664.397) (-658.986) * (-657.441) [-656.237] (-667.276) (-656.705) -- 0:01:13
27000 -- (-663.431) (-660.545) (-663.544) [-662.717] * [-655.501] (-656.279) (-667.872) (-656.987) -- 0:01:12
27500 -- (-667.740) [-655.700] (-668.586) (-657.845) * [-656.721] (-657.171) (-676.825) (-659.011) -- 0:01:10
28000 -- (-664.909) [-655.879] (-665.242) (-659.683) * [-659.760] (-659.166) (-665.433) (-657.302) -- 0:01:09
28500 -- (-666.308) (-657.425) (-668.742) [-657.981] * (-656.701) [-656.876] (-662.707) (-656.030) -- 0:01:08
29000 -- (-666.691) [-659.535] (-673.099) (-657.041) * (-655.906) (-657.511) [-665.183] (-659.916) -- 0:01:06
29500 -- (-671.417) (-657.801) (-666.072) [-656.704] * (-659.461) [-658.646] (-672.692) (-657.593) -- 0:01:05
30000 -- (-670.767) (-656.894) [-671.228] (-658.182) * [-659.756] (-657.191) (-669.088) (-655.987) -- 0:01:04
Average standard deviation of split frequencies: 0.039643
30500 -- (-665.511) [-658.190] (-665.460) (-656.184) * (-659.314) (-657.807) (-665.564) [-656.879] -- 0:01:03
31000 -- (-673.074) (-656.792) (-668.781) [-658.794] * (-660.642) (-657.794) (-668.616) [-659.311] -- 0:01:33
31500 -- [-668.332] (-657.745) (-668.710) (-658.068) * (-655.888) (-658.576) (-670.730) [-658.775] -- 0:01:32
32000 -- (-675.024) (-659.952) [-662.829] (-656.304) * [-656.862] (-657.012) (-662.209) (-659.265) -- 0:01:30
32500 -- (-664.624) (-660.214) (-682.804) [-656.723] * (-657.060) [-657.567] (-660.932) (-657.654) -- 0:01:29
33000 -- (-681.805) [-658.184] (-666.396) (-658.500) * (-657.815) (-659.068) (-671.824) [-656.910] -- 0:01:27
33500 -- (-664.305) (-658.468) [-667.516] (-657.578) * (-660.468) (-656.381) (-662.725) [-657.219] -- 0:01:26
34000 -- (-667.531) [-657.068] (-671.486) (-659.118) * (-660.252) (-656.266) (-660.063) [-656.877] -- 0:01:25
34500 -- (-690.107) [-659.956] (-671.800) (-661.053) * (-659.842) (-657.207) (-657.712) [-658.561] -- 0:01:23
35000 -- (-675.748) [-658.960] (-666.304) (-657.951) * (-660.768) (-663.980) (-658.379) [-658.606] -- 0:01:22
Average standard deviation of split frequencies: 0.040662
35500 -- (-661.618) (-660.492) [-670.629] (-656.953) * (-659.812) (-660.630) (-658.031) [-658.565] -- 0:01:21
36000 -- (-662.346) (-659.000) (-662.234) [-660.018] * (-658.490) [-660.853] (-657.023) (-659.679) -- 0:01:20
36500 -- (-660.949) [-660.625] (-660.235) (-657.433) * (-657.934) (-656.094) (-660.916) [-658.859] -- 0:01:19
37000 -- (-661.123) (-656.472) (-657.617) [-660.430] * (-659.051) (-655.772) [-657.950] (-661.317) -- 0:01:18
37500 -- (-657.278) (-658.564) [-658.120] (-667.122) * (-659.376) (-657.529) (-656.862) [-658.007] -- 0:01:17
38000 -- [-659.816] (-659.071) (-658.474) (-659.962) * (-657.912) (-657.838) [-656.655] (-656.596) -- 0:01:15
38500 -- (-659.353) (-655.892) [-655.817] (-659.395) * (-657.567) (-662.108) [-658.712] (-657.614) -- 0:01:14
39000 -- (-659.748) (-656.268) [-658.176] (-658.775) * [-658.878] (-659.001) (-658.972) (-656.644) -- 0:01:13
39500 -- [-656.919] (-657.566) (-657.429) (-658.370) * (-657.934) (-656.808) [-657.783] (-658.187) -- 0:01:12
40000 -- (-662.203) (-656.728) [-659.927] (-656.898) * (-656.667) [-656.132] (-659.109) (-658.349) -- 0:01:12
Average standard deviation of split frequencies: 0.040877
40500 -- (-661.008) [-657.284] (-660.019) (-657.289) * (-657.914) [-656.188] (-656.360) (-657.592) -- 0:01:11
41000 -- (-660.463) [-657.972] (-657.360) (-665.791) * [-656.734] (-658.225) (-656.749) (-659.129) -- 0:01:10
41500 -- (-658.661) (-657.893) [-657.903] (-657.240) * (-664.533) [-656.071] (-658.168) (-657.537) -- 0:01:09
42000 -- [-657.145] (-657.043) (-657.599) (-656.778) * (-660.930) (-656.190) [-658.542] (-656.888) -- 0:01:08
42500 -- (-656.293) (-656.523) (-657.262) [-658.062] * (-657.939) (-655.986) (-660.675) [-656.978] -- 0:01:07
43000 -- (-657.665) (-655.855) [-656.912] (-661.698) * (-657.242) [-657.585] (-661.016) (-659.651) -- 0:01:06
43500 -- (-661.123) [-656.926] (-657.636) (-656.697) * (-657.286) [-658.008] (-658.040) (-656.876) -- 0:01:05
44000 -- (-659.052) [-657.603] (-656.839) (-656.860) * (-658.798) (-660.141) (-657.937) [-657.188] -- 0:01:05
44500 -- (-655.910) [-659.592] (-655.674) (-658.363) * [-660.625] (-658.722) (-660.022) (-656.082) -- 0:01:04
45000 -- (-657.852) [-657.344] (-656.199) (-659.458) * [-659.323] (-657.955) (-659.350) (-658.000) -- 0:01:03
Average standard deviation of split frequencies: 0.035598
45500 -- (-657.194) (-658.431) (-657.156) [-657.086] * [-660.072] (-658.771) (-660.164) (-657.359) -- 0:01:02
46000 -- (-656.474) [-657.898] (-656.731) (-659.740) * (-659.418) [-658.636] (-660.155) (-659.279) -- 0:01:02
46500 -- [-656.663] (-655.862) (-656.361) (-656.562) * [-655.605] (-656.751) (-655.839) (-657.378) -- 0:01:22
47000 -- [-655.737] (-657.114) (-658.300) (-658.537) * (-656.904) (-660.026) [-656.525] (-658.134) -- 0:01:21
47500 -- [-656.959] (-658.037) (-656.927) (-656.871) * [-660.312] (-657.941) (-657.410) (-657.389) -- 0:01:20
48000 -- (-657.190) (-655.883) (-657.199) [-657.782] * [-656.590] (-656.742) (-657.026) (-661.921) -- 0:01:19
48500 -- (-655.486) (-657.660) [-657.676] (-661.852) * (-660.589) (-656.875) [-656.215] (-657.791) -- 0:01:18
49000 -- (-656.433) (-661.411) (-657.563) [-657.127] * (-657.330) (-661.684) [-657.900] (-657.344) -- 0:01:17
49500 -- (-657.430) (-665.350) (-656.940) [-656.851] * (-658.761) (-663.899) (-656.966) [-658.217] -- 0:01:16
50000 -- (-656.667) (-659.626) [-657.560] (-656.400) * (-662.103) (-659.969) (-659.199) [-655.686] -- 0:01:16
Average standard deviation of split frequencies: 0.035747
50500 -- (-656.185) [-658.145] (-658.443) (-657.173) * (-658.466) (-656.399) (-660.740) [-656.228] -- 0:01:15
51000 -- (-656.207) [-659.245] (-660.671) (-655.581) * (-659.142) (-660.198) (-657.301) [-659.233] -- 0:01:14
51500 -- (-656.535) [-656.572] (-658.305) (-657.292) * (-659.097) (-659.156) (-659.256) [-659.789] -- 0:01:13
52000 -- (-660.199) (-657.904) (-659.162) [-655.642] * [-659.043] (-658.928) (-660.524) (-659.951) -- 0:01:12
52500 -- (-656.995) (-658.124) (-658.343) [-657.994] * (-664.931) (-656.713) (-663.375) [-656.381] -- 0:01:12
53000 -- (-657.331) (-659.051) [-656.311] (-656.539) * (-657.880) (-655.626) (-658.924) [-656.642] -- 0:01:11
53500 -- (-657.442) (-661.154) (-656.611) [-657.930] * (-656.415) (-656.158) (-657.433) [-658.046] -- 0:01:10
54000 -- (-656.964) (-660.185) [-655.464] (-658.163) * (-656.754) [-657.209] (-660.229) (-659.226) -- 0:01:10
54500 -- (-657.061) (-660.386) [-656.465] (-656.587) * [-656.229] (-656.944) (-657.169) (-656.743) -- 0:01:09
55000 -- [-657.763] (-655.978) (-658.358) (-662.226) * (-659.107) (-657.357) [-656.166] (-659.177) -- 0:01:08
Average standard deviation of split frequencies: 0.031801
55500 -- [-657.781] (-656.128) (-656.182) (-658.249) * [-657.897] (-659.532) (-658.477) (-658.261) -- 0:01:08
56000 -- [-657.525] (-661.120) (-656.679) (-658.533) * (-656.771) (-659.778) [-658.403] (-658.656) -- 0:01:07
56500 -- (-660.862) (-658.083) [-656.947] (-661.065) * [-656.565] (-660.583) (-656.328) (-658.678) -- 0:01:06
57000 -- (-657.355) (-658.166) [-656.481] (-660.064) * (-657.748) [-657.630] (-655.586) (-658.281) -- 0:01:06
57500 -- [-656.481] (-656.414) (-657.079) (-657.155) * (-659.561) (-659.549) [-656.686] (-659.573) -- 0:01:05
58000 -- [-657.470] (-657.351) (-656.265) (-659.549) * [-657.191] (-657.654) (-657.819) (-658.050) -- 0:01:04
58500 -- [-662.898] (-656.924) (-657.392) (-657.837) * (-659.208) (-660.412) [-657.421] (-656.737) -- 0:01:04
59000 -- [-657.555] (-657.137) (-657.130) (-657.371) * (-658.136) (-658.898) [-659.874] (-658.173) -- 0:01:03
59500 -- (-657.657) [-661.115] (-657.961) (-660.904) * [-658.286] (-657.659) (-657.273) (-658.115) -- 0:01:03
60000 -- (-659.893) (-662.518) [-658.133] (-660.442) * (-659.475) (-661.362) (-656.709) [-656.570] -- 0:01:02
Average standard deviation of split frequencies: 0.022854
60500 -- (-657.568) (-657.325) (-660.537) [-660.028] * (-666.511) (-658.549) [-656.083] (-657.207) -- 0:01:02
61000 -- (-658.002) (-659.508) [-661.380] (-656.603) * (-659.219) (-656.983) [-655.955] (-656.329) -- 0:01:01
61500 -- [-657.571] (-656.040) (-656.759) (-658.319) * (-660.132) [-659.698] (-656.546) (-658.158) -- 0:01:01
62000 -- (-657.963) [-657.781] (-655.617) (-658.791) * (-661.142) [-661.311] (-659.163) (-659.120) -- 0:01:15
62500 -- [-656.990] (-656.161) (-657.185) (-657.664) * (-657.201) (-659.366) [-658.157] (-656.227) -- 0:01:15
63000 -- (-660.131) (-657.194) [-656.060] (-661.778) * (-657.463) (-656.346) (-657.527) [-656.537] -- 0:01:14
63500 -- [-659.454] (-657.972) (-661.183) (-662.012) * (-656.636) (-656.073) [-658.523] (-657.278) -- 0:01:13
64000 -- (-657.283) (-658.794) (-659.044) [-662.208] * (-657.115) (-656.411) (-658.632) [-656.777] -- 0:01:13
64500 -- [-657.318] (-656.393) (-658.317) (-657.993) * (-658.340) (-657.192) (-662.077) [-657.242] -- 0:01:12
65000 -- (-659.373) [-657.153] (-656.475) (-658.036) * (-658.192) [-656.132] (-657.476) (-657.067) -- 0:01:11
Average standard deviation of split frequencies: 0.017856
65500 -- [-657.148] (-657.058) (-658.452) (-657.919) * (-658.371) (-656.732) (-656.435) [-661.410] -- 0:01:11
66000 -- (-659.617) (-657.926) (-658.489) [-656.394] * [-659.127] (-655.962) (-657.659) (-657.256) -- 0:01:10
66500 -- (-659.192) (-658.129) (-657.613) [-660.853] * (-656.579) (-655.869) [-656.467] (-657.498) -- 0:01:10
67000 -- (-657.756) (-656.512) (-655.675) [-657.743] * (-657.205) [-656.575] (-655.871) (-657.393) -- 0:01:09
67500 -- (-656.535) (-657.573) (-656.080) [-660.060] * [-655.842] (-656.159) (-657.342) (-656.218) -- 0:01:09
68000 -- (-656.399) [-658.269] (-656.851) (-657.930) * (-656.966) (-660.502) (-657.565) [-656.092] -- 0:01:08
68500 -- (-656.373) (-655.762) (-660.111) [-657.556] * (-657.236) (-658.414) (-661.817) [-660.299] -- 0:01:07
69000 -- (-657.612) (-656.366) (-656.912) [-656.390] * (-657.308) [-658.105] (-658.771) (-656.555) -- 0:01:07
69500 -- (-657.576) (-656.963) [-656.416] (-659.487) * (-657.936) (-660.085) (-657.894) [-657.221] -- 0:01:06
70000 -- (-657.398) (-656.613) [-656.327] (-658.382) * [-658.592] (-658.107) (-659.142) (-655.514) -- 0:01:06
Average standard deviation of split frequencies: 0.017266
70500 -- (-659.324) [-656.029] (-658.200) (-656.611) * (-657.219) [-658.232] (-661.710) (-658.004) -- 0:01:05
71000 -- (-656.610) (-656.029) [-657.047] (-655.609) * [-655.852] (-662.113) (-659.969) (-657.458) -- 0:01:05
71500 -- [-657.112] (-659.523) (-657.458) (-660.622) * (-661.456) (-660.469) [-657.794] (-659.909) -- 0:01:04
72000 -- (-656.421) (-660.075) [-657.239] (-658.048) * (-657.391) (-657.111) [-657.138] (-658.904) -- 0:01:04
72500 -- (-656.252) [-658.346] (-657.520) (-656.268) * [-656.229] (-656.628) (-656.930) (-656.580) -- 0:01:03
73000 -- [-657.708] (-659.432) (-657.922) (-657.472) * (-660.064) [-657.626] (-657.035) (-658.092) -- 0:01:03
73500 -- (-658.211) (-657.433) (-657.179) [-656.899] * (-655.756) (-658.058) (-659.137) [-657.710] -- 0:01:03
74000 -- (-660.470) (-660.052) [-657.899] (-656.380) * (-657.433) (-656.159) (-661.628) [-660.426] -- 0:01:02
74500 -- (-664.181) [-658.049] (-659.207) (-656.251) * (-660.208) [-656.503] (-661.485) (-658.405) -- 0:01:02
75000 -- (-659.119) [-657.835] (-660.842) (-657.603) * (-663.088) (-656.423) [-656.342] (-659.101) -- 0:01:01
Average standard deviation of split frequencies: 0.016541
75500 -- (-658.206) (-656.693) (-657.734) [-656.114] * (-662.985) (-662.521) (-657.134) [-658.736] -- 0:01:01
76000 -- (-657.321) (-656.423) (-655.691) [-658.422] * (-660.481) (-657.287) [-657.181] (-660.341) -- 0:01:00
76500 -- [-655.970] (-656.669) (-656.801) (-659.153) * (-658.856) (-657.097) [-658.705] (-659.034) -- 0:01:00
77000 -- (-658.171) (-655.634) [-657.094] (-659.527) * [-657.712] (-657.372) (-656.758) (-659.223) -- 0:00:59
77500 -- [-655.891] (-657.320) (-656.773) (-659.525) * (-657.250) [-656.832] (-656.640) (-658.666) -- 0:00:59
78000 -- (-656.890) [-656.258] (-656.958) (-656.115) * [-658.097] (-660.803) (-656.414) (-659.892) -- 0:00:59
78500 -- (-658.303) (-658.917) [-657.436] (-660.297) * (-660.402) [-657.996] (-656.857) (-659.146) -- 0:01:10
79000 -- [-659.038] (-660.993) (-657.278) (-658.809) * (-661.184) [-658.760] (-656.475) (-657.035) -- 0:01:09
79500 -- (-658.671) (-656.813) (-658.897) [-658.448] * (-657.582) (-658.241) (-657.911) [-657.378] -- 0:01:09
80000 -- [-657.223] (-659.828) (-657.596) (-659.076) * (-661.474) (-657.155) [-657.367] (-657.347) -- 0:01:09
Average standard deviation of split frequencies: 0.017532
80500 -- (-656.646) [-660.369] (-659.366) (-657.698) * [-656.048] (-656.367) (-659.977) (-658.932) -- 0:01:08
81000 -- [-657.040] (-656.127) (-656.545) (-657.174) * (-662.839) (-656.761) [-661.117] (-657.140) -- 0:01:08
81500 -- [-656.935] (-661.010) (-656.014) (-658.145) * (-656.479) (-656.161) [-656.621] (-660.178) -- 0:01:07
82000 -- (-656.848) (-660.126) (-657.993) [-657.131] * (-658.257) [-661.772] (-656.413) (-658.546) -- 0:01:07
82500 -- [-656.950] (-660.526) (-658.906) (-657.334) * (-657.403) [-659.692] (-657.156) (-658.522) -- 0:01:06
83000 -- (-659.113) (-661.612) [-657.128] (-657.504) * (-656.223) [-658.235] (-656.693) (-657.924) -- 0:01:06
83500 -- (-656.740) (-663.379) [-656.081] (-656.933) * (-662.179) (-658.101) [-655.927] (-659.687) -- 0:01:05
84000 -- (-656.218) (-660.581) (-656.351) [-657.423] * (-656.340) (-659.258) (-656.735) [-658.114] -- 0:01:05
84500 -- (-658.252) (-658.876) [-657.374] (-661.932) * (-656.286) (-657.418) [-657.772] (-656.493) -- 0:01:05
85000 -- (-658.089) [-655.970] (-655.413) (-663.745) * (-655.962) [-658.015] (-657.063) (-656.474) -- 0:01:04
Average standard deviation of split frequencies: 0.016444
85500 -- (-657.757) (-655.561) [-656.176] (-663.488) * (-661.356) [-663.341] (-656.665) (-657.075) -- 0:01:04
86000 -- [-657.389] (-655.880) (-656.500) (-657.289) * (-658.766) [-662.582] (-661.589) (-657.576) -- 0:01:03
86500 -- (-657.089) (-656.075) (-656.533) [-659.707] * [-659.827] (-662.809) (-658.535) (-656.032) -- 0:01:03
87000 -- (-656.094) [-658.339] (-656.797) (-657.773) * (-658.702) (-657.227) (-657.304) [-659.138] -- 0:01:02
87500 -- (-660.036) (-657.027) [-658.240] (-658.591) * (-661.916) [-660.965] (-656.432) (-657.739) -- 0:01:02
88000 -- (-660.623) (-658.259) [-656.529] (-658.844) * (-658.651) (-657.542) (-656.769) [-657.406] -- 0:01:02
88500 -- (-661.660) (-656.741) (-659.579) [-656.975] * (-665.935) (-656.600) (-657.474) [-658.187] -- 0:01:01
89000 -- (-658.827) [-658.176] (-659.383) (-660.085) * [-657.267] (-656.825) (-657.646) (-658.374) -- 0:01:01
89500 -- [-657.331] (-657.963) (-658.492) (-661.118) * (-658.967) (-656.291) (-661.144) [-657.538] -- 0:01:01
90000 -- (-657.555) (-657.631) [-658.042] (-657.964) * [-659.324] (-656.314) (-656.350) (-658.891) -- 0:01:00
Average standard deviation of split frequencies: 0.019497
90500 -- (-657.964) (-658.042) [-657.920] (-657.502) * (-660.822) (-661.483) [-659.502] (-659.813) -- 0:01:00
91000 -- (-655.448) [-661.067] (-656.635) (-658.129) * (-663.771) (-661.652) (-658.249) [-657.760] -- 0:00:59
91500 -- (-657.075) (-660.338) [-656.131] (-657.177) * (-657.544) (-660.969) (-657.667) [-657.035] -- 0:00:59
92000 -- [-656.515] (-661.475) (-657.847) (-656.561) * (-656.482) (-659.716) (-657.667) [-657.696] -- 0:00:59
92500 -- [-656.212] (-659.412) (-656.354) (-656.668) * [-656.050] (-657.323) (-662.327) (-659.776) -- 0:00:58
93000 -- (-659.476) (-663.370) [-655.582] (-656.506) * [-656.255] (-656.849) (-657.729) (-660.555) -- 0:00:58
93500 -- [-657.181] (-661.778) (-656.846) (-657.503) * [-656.465] (-659.366) (-659.827) (-659.042) -- 0:00:58
94000 -- (-658.716) [-657.104] (-657.172) (-656.046) * (-659.963) [-656.330] (-662.215) (-656.747) -- 0:00:57
94500 -- (-657.307) [-663.838] (-657.106) (-655.520) * (-657.143) [-656.460] (-658.950) (-656.006) -- 0:00:57
95000 -- (-659.908) (-661.687) [-656.872] (-658.034) * (-657.927) (-657.887) (-657.663) [-659.883] -- 0:00:57
Average standard deviation of split frequencies: 0.023777
95500 -- [-657.490] (-659.271) (-658.271) (-656.300) * (-658.357) (-658.624) [-656.278] (-657.318) -- 0:01:06
96000 -- (-657.724) (-661.450) [-656.345] (-658.297) * (-657.001) [-656.720] (-660.430) (-658.803) -- 0:01:05
96500 -- (-656.930) (-656.620) [-657.639] (-657.688) * (-660.460) (-656.231) (-661.896) [-656.829] -- 0:01:05
97000 -- (-655.695) (-659.210) (-660.287) [-659.365] * (-660.722) (-657.623) (-658.981) [-656.541] -- 0:01:05
97500 -- [-657.445] (-655.658) (-656.198) (-656.540) * (-659.276) (-661.337) (-661.304) [-656.869] -- 0:01:04
98000 -- (-657.258) [-658.425] (-658.245) (-656.833) * (-658.915) [-656.432] (-655.852) (-656.847) -- 0:01:04
98500 -- [-658.213] (-657.298) (-656.103) (-657.432) * (-657.835) (-655.835) [-656.274] (-657.226) -- 0:01:04
99000 -- (-658.970) (-657.258) [-655.806] (-657.902) * (-657.880) [-657.780] (-656.421) (-658.350) -- 0:01:03
99500 -- (-657.723) (-670.279) [-659.276] (-658.304) * (-663.440) (-658.715) [-657.943] (-657.120) -- 0:01:03
100000 -- [-658.697] (-660.921) (-656.869) (-656.678) * (-659.257) (-657.378) (-657.496) [-658.712] -- 0:01:02
Average standard deviation of split frequencies: 0.025756
100500 -- (-660.709) (-659.330) (-659.303) [-658.862] * (-656.456) (-656.441) [-659.014] (-658.671) -- 0:01:02
101000 -- [-658.243] (-656.643) (-657.609) (-657.000) * (-656.871) (-658.234) (-658.806) [-656.939] -- 0:01:02
101500 -- (-658.255) [-656.959] (-659.543) (-657.618) * [-656.931] (-656.855) (-656.574) (-657.447) -- 0:01:01
102000 -- (-661.880) [-657.161] (-657.107) (-658.362) * [-656.535] (-658.512) (-655.563) (-657.703) -- 0:01:01
102500 -- [-661.074] (-661.117) (-657.865) (-658.621) * (-656.076) (-656.997) [-655.556] (-664.348) -- 0:01:01
103000 -- (-659.708) (-658.656) [-658.404] (-657.265) * [-656.794] (-659.139) (-657.207) (-660.680) -- 0:01:00
103500 -- [-656.969] (-656.565) (-660.365) (-655.981) * (-655.699) [-656.590] (-656.004) (-660.296) -- 0:01:00
104000 -- (-657.880) [-657.120] (-658.174) (-656.566) * (-655.951) (-657.463) (-656.521) [-657.395] -- 0:01:00
104500 -- (-661.404) [-657.772] (-657.191) (-656.267) * (-655.865) [-657.399] (-670.122) (-656.550) -- 0:00:59
105000 -- (-656.541) [-656.274] (-661.234) (-656.161) * (-658.703) [-658.730] (-658.917) (-657.515) -- 0:00:59
Average standard deviation of split frequencies: 0.026906
105500 -- [-659.414] (-661.398) (-658.125) (-656.018) * (-664.822) (-658.044) [-657.943] (-658.350) -- 0:00:59
106000 -- [-659.017] (-657.490) (-657.656) (-658.892) * (-664.442) (-659.938) (-657.968) [-661.821] -- 0:00:59
106500 -- [-656.856] (-658.565) (-660.667) (-657.572) * (-667.876) (-656.421) [-658.595] (-656.381) -- 0:00:58
107000 -- (-657.502) (-656.502) [-656.428] (-656.578) * (-658.903) (-659.090) [-657.442] (-656.461) -- 0:00:58
107500 -- (-656.449) [-658.818] (-660.058) (-659.462) * (-658.299) (-658.933) (-658.003) [-657.379] -- 0:00:58
108000 -- (-656.784) (-661.002) (-657.681) [-656.310] * (-658.605) [-656.622] (-659.303) (-658.148) -- 0:00:57
108500 -- (-656.436) (-658.445) [-659.740] (-658.067) * (-657.477) [-657.481] (-659.360) (-656.652) -- 0:00:57
109000 -- (-658.058) [-659.068] (-657.930) (-658.537) * (-656.788) (-657.816) (-656.459) [-658.638] -- 0:00:57
109500 -- (-663.654) [-657.085] (-657.178) (-657.285) * (-655.619) (-657.592) [-662.995] (-661.402) -- 0:00:56
110000 -- (-656.776) (-656.755) (-660.103) [-657.936] * [-655.496] (-660.233) (-661.296) (-658.108) -- 0:00:56
Average standard deviation of split frequencies: 0.024706
110500 -- (-659.563) [-656.823] (-656.775) (-659.274) * [-655.725] (-660.439) (-656.865) (-658.442) -- 0:00:56
111000 -- (-659.674) [-658.981] (-659.219) (-658.261) * (-659.099) (-658.094) [-658.530] (-660.316) -- 0:00:56
111500 -- (-659.047) (-658.969) [-658.278] (-656.599) * (-657.613) (-656.700) [-658.443] (-659.351) -- 0:00:55
112000 -- (-658.579) [-657.631] (-656.786) (-657.140) * (-666.376) [-658.988] (-656.163) (-657.363) -- 0:01:03
112500 -- (-662.185) (-661.936) (-657.236) [-658.001] * (-657.712) [-658.093] (-656.750) (-658.562) -- 0:01:03
113000 -- (-662.680) (-657.649) [-659.807] (-656.315) * (-656.105) [-658.948] (-657.896) (-658.954) -- 0:01:02
113500 -- (-664.435) (-658.048) [-660.846] (-657.145) * (-656.918) (-656.318) (-656.271) [-660.437] -- 0:01:02
114000 -- (-655.776) (-657.726) [-657.606] (-656.739) * (-656.052) (-661.968) [-657.421] (-659.339) -- 0:01:02
114500 -- (-655.953) [-656.279] (-658.449) (-661.740) * (-657.318) (-658.016) [-659.757] (-664.224) -- 0:01:01
115000 -- [-658.645] (-655.929) (-657.100) (-660.369) * (-656.439) (-658.312) (-656.289) [-658.544] -- 0:01:01
Average standard deviation of split frequencies: 0.024383
115500 -- (-661.405) (-655.931) (-658.786) [-656.438] * [-656.065] (-656.711) (-658.123) (-658.194) -- 0:01:01
116000 -- (-658.768) (-656.479) (-658.544) [-656.090] * [-656.196] (-658.888) (-658.902) (-656.908) -- 0:01:00
116500 -- [-657.477] (-656.821) (-656.905) (-655.894) * (-657.375) (-656.291) [-659.288] (-660.306) -- 0:01:00
117000 -- (-655.663) (-660.979) [-656.287] (-657.512) * (-659.145) (-656.343) (-656.292) [-656.839] -- 0:01:00
117500 -- (-658.288) (-656.001) [-660.984] (-656.441) * (-657.440) (-658.487) [-659.053] (-655.922) -- 0:01:00
118000 -- (-659.366) (-658.787) (-657.785) [-656.707] * (-656.446) (-658.244) (-655.791) [-657.828] -- 0:00:59
118500 -- (-655.944) [-658.316] (-655.990) (-655.876) * [-657.398] (-657.218) (-656.985) (-657.093) -- 0:00:59
119000 -- (-659.265) (-658.825) (-659.156) [-656.905] * (-658.632) (-658.210) (-656.302) [-660.598] -- 0:00:59
119500 -- (-656.195) (-656.835) (-659.143) [-657.834] * (-657.585) (-657.688) [-656.455] (-659.195) -- 0:00:58
120000 -- (-657.889) (-656.719) (-656.567) [-655.998] * (-657.357) [-658.658] (-657.283) (-655.929) -- 0:00:58
Average standard deviation of split frequencies: 0.023245
120500 -- (-661.888) (-658.487) [-657.032] (-657.138) * (-661.003) (-658.610) (-655.915) [-659.053] -- 0:00:58
121000 -- [-661.289] (-658.985) (-657.342) (-656.344) * (-661.600) (-656.141) (-657.513) [-656.195] -- 0:00:58
121500 -- [-656.813] (-663.577) (-659.333) (-656.009) * (-660.305) (-661.338) [-656.497] (-657.000) -- 0:00:57
122000 -- (-659.489) (-664.098) [-656.799] (-656.698) * (-657.648) (-656.778) [-657.124] (-658.008) -- 0:00:57
122500 -- (-659.970) (-659.775) (-658.012) [-656.711] * (-656.377) [-658.194] (-657.873) (-657.151) -- 0:00:57
123000 -- (-655.814) [-658.001] (-660.180) (-656.800) * (-655.727) (-657.548) (-662.038) [-659.544] -- 0:00:57
123500 -- (-655.998) [-656.503] (-657.993) (-657.769) * [-659.137] (-657.914) (-656.357) (-658.327) -- 0:00:56
124000 -- (-656.451) (-657.168) [-656.479] (-656.262) * (-659.424) (-659.610) [-656.826] (-657.488) -- 0:00:56
124500 -- (-657.088) (-658.416) [-655.861] (-658.457) * (-656.772) (-656.068) (-658.994) [-658.487] -- 0:00:56
125000 -- [-658.803] (-661.677) (-656.320) (-657.656) * [-656.845] (-656.128) (-659.656) (-658.699) -- 0:00:56
Average standard deviation of split frequencies: 0.023383
125500 -- (-656.164) (-657.915) (-658.575) [-656.801] * (-657.869) (-656.185) (-656.347) [-656.914] -- 0:00:55
126000 -- (-655.672) [-657.779] (-656.928) (-658.836) * [-657.261] (-660.307) (-657.376) (-657.806) -- 0:00:55
126500 -- (-658.072) (-657.454) (-659.208) [-660.689] * (-656.741) (-656.531) [-659.449] (-659.160) -- 0:00:55
127000 -- (-656.915) (-657.689) (-657.608) [-661.128] * [-657.526] (-656.622) (-656.647) (-657.480) -- 0:00:54
127500 -- (-660.186) (-656.272) [-657.681] (-659.898) * (-658.666) [-659.955] (-656.831) (-656.637) -- 0:00:54
128000 -- (-657.361) (-658.086) [-659.080] (-659.609) * (-658.160) (-660.162) (-658.410) [-655.497] -- 0:00:54
128500 -- [-655.559] (-656.129) (-659.607) (-659.870) * (-659.129) (-656.119) [-657.254] (-656.752) -- 0:00:54
129000 -- (-655.764) (-658.158) (-660.019) [-660.286] * (-657.282) (-658.609) [-656.415] (-657.010) -- 0:01:00
129500 -- [-661.560] (-659.114) (-658.709) (-657.304) * (-657.950) (-661.030) [-658.946] (-656.621) -- 0:01:00
130000 -- (-656.090) [-658.943] (-657.276) (-659.543) * [-658.418] (-657.604) (-659.804) (-656.573) -- 0:01:00
Average standard deviation of split frequencies: 0.024452
130500 -- (-655.392) [-663.222] (-658.110) (-656.319) * (-658.162) (-660.915) [-660.502] (-657.888) -- 0:00:59
131000 -- (-657.745) [-657.384] (-658.710) (-660.639) * (-657.727) (-657.220) (-660.216) [-656.403] -- 0:00:59
131500 -- [-657.265] (-657.188) (-658.108) (-657.615) * (-659.442) [-657.358] (-664.094) (-656.059) -- 0:00:59
132000 -- [-660.871] (-655.411) (-660.291) (-655.535) * (-660.565) [-658.734] (-658.346) (-656.211) -- 0:00:59
132500 -- (-656.779) (-656.702) [-661.263] (-657.339) * (-659.654) (-658.637) [-658.699] (-656.765) -- 0:00:58
133000 -- [-661.185] (-656.250) (-659.038) (-659.617) * (-658.898) (-657.935) [-656.128] (-655.812) -- 0:00:58
133500 -- (-655.773) (-655.771) [-657.956] (-658.951) * (-656.367) (-657.996) [-659.121] (-656.683) -- 0:00:58
134000 -- (-657.660) (-657.619) [-655.488] (-657.884) * (-657.423) (-658.633) (-663.792) [-656.788] -- 0:00:58
134500 -- (-660.184) (-655.989) [-656.688] (-658.114) * (-657.952) [-656.245] (-661.355) (-659.117) -- 0:00:57
135000 -- (-660.017) (-656.325) (-657.584) [-657.045] * [-656.309] (-656.070) (-655.514) (-662.428) -- 0:00:57
Average standard deviation of split frequencies: 0.022723
135500 -- (-658.537) (-658.443) (-657.692) [-661.231] * (-657.247) [-656.004] (-661.883) (-657.632) -- 0:00:57
136000 -- (-656.813) [-661.532] (-657.639) (-657.694) * [-656.962] (-656.452) (-657.618) (-663.181) -- 0:00:57
136500 -- (-659.018) (-656.116) [-657.986] (-661.790) * [-655.879] (-658.291) (-656.718) (-659.523) -- 0:00:56
137000 -- (-659.053) (-658.404) [-656.738] (-657.029) * (-656.871) (-657.564) (-657.500) [-659.321] -- 0:00:56
137500 -- (-656.976) (-658.628) (-657.321) [-658.238] * (-657.010) (-658.971) (-656.713) [-657.659] -- 0:00:56
138000 -- (-655.896) (-660.526) (-657.228) [-660.526] * (-659.954) (-657.644) [-657.795] (-663.852) -- 0:00:56
138500 -- (-655.758) (-658.147) (-660.491) [-658.826] * (-658.641) (-659.612) [-659.357] (-656.240) -- 0:00:55
139000 -- (-657.830) (-656.183) [-659.506] (-658.095) * (-659.609) (-657.715) [-657.313] (-656.754) -- 0:00:55
139500 -- (-656.792) (-658.769) [-657.893] (-659.193) * (-660.153) [-656.776] (-658.365) (-661.138) -- 0:00:55
140000 -- (-657.697) (-658.294) [-655.995] (-657.580) * (-662.148) (-660.397) (-658.801) [-657.385] -- 0:00:55
Average standard deviation of split frequencies: 0.022341
140500 -- (-657.073) (-660.979) (-656.472) [-659.492] * (-658.834) [-657.860] (-657.853) (-656.368) -- 0:00:55
141000 -- (-657.883) [-657.216] (-657.521) (-659.898) * [-656.991] (-657.217) (-655.833) (-659.786) -- 0:00:54
141500 -- (-655.786) [-656.702] (-658.595) (-658.736) * [-658.002] (-658.486) (-664.184) (-657.445) -- 0:00:54
142000 -- (-656.170) [-658.255] (-657.017) (-660.352) * (-661.624) [-656.931] (-662.163) (-658.108) -- 0:00:54
142500 -- (-656.230) [-656.848] (-657.946) (-659.508) * (-659.930) (-657.125) [-657.327] (-657.555) -- 0:00:54
143000 -- (-657.642) [-658.302] (-656.856) (-658.687) * (-660.500) (-661.862) (-658.885) [-658.768] -- 0:00:53
143500 -- (-656.364) (-658.520) [-658.196] (-657.572) * (-660.731) (-656.235) (-655.436) [-657.959] -- 0:00:53
144000 -- (-655.739) [-657.148] (-656.995) (-658.370) * (-657.049) (-660.541) (-655.462) [-657.066] -- 0:00:53
144500 -- (-656.043) (-663.338) (-656.742) [-657.150] * (-659.173) [-658.620] (-655.700) (-656.074) -- 0:00:53
145000 -- (-660.683) (-659.249) [-656.329] (-658.584) * (-661.105) (-656.893) [-657.932] (-661.583) -- 0:00:53
Average standard deviation of split frequencies: 0.020019
145500 -- (-656.530) [-656.656] (-658.446) (-657.615) * (-657.096) (-656.867) (-659.084) [-658.348] -- 0:00:52
146000 -- [-657.040] (-657.376) (-661.305) (-660.011) * (-660.368) (-660.675) [-659.253] (-658.759) -- 0:00:58
146500 -- (-659.477) (-658.190) [-660.130] (-658.052) * (-661.647) (-658.200) (-661.226) [-657.586] -- 0:00:58
147000 -- (-656.804) (-656.074) [-657.502] (-662.387) * (-660.369) (-657.665) (-657.088) [-657.468] -- 0:00:58
147500 -- (-658.743) (-656.031) (-657.831) [-657.632] * (-657.460) (-658.053) (-657.369) [-657.019] -- 0:00:57
148000 -- (-659.027) [-655.848] (-657.300) (-657.826) * (-657.698) (-660.207) [-655.627] (-658.440) -- 0:00:57
148500 -- (-656.347) (-655.852) [-657.111] (-656.523) * (-657.262) (-657.651) (-663.012) [-656.362] -- 0:00:57
149000 -- (-655.968) [-656.456] (-658.329) (-657.159) * (-660.133) (-658.918) [-660.899] (-656.869) -- 0:00:57
149500 -- [-657.183] (-656.459) (-658.939) (-657.110) * (-660.081) (-656.801) (-662.457) [-656.155] -- 0:00:56
150000 -- (-656.489) (-657.722) [-657.150] (-656.759) * (-666.106) (-656.059) [-656.531] (-656.033) -- 0:00:56
Average standard deviation of split frequencies: 0.018114
150500 -- (-659.298) (-655.976) [-656.885] (-656.559) * [-656.019] (-658.395) (-657.409) (-657.387) -- 0:00:56
151000 -- (-657.966) (-656.256) (-657.647) [-659.737] * (-656.093) (-657.662) [-659.717] (-660.311) -- 0:00:56
151500 -- (-659.164) (-655.797) [-655.826] (-662.437) * (-659.925) (-659.166) [-658.456] (-656.829) -- 0:00:56
152000 -- [-661.002] (-660.119) (-655.773) (-656.700) * (-655.665) (-660.056) [-663.748] (-658.669) -- 0:00:55
152500 -- (-663.107) (-658.598) (-659.947) [-659.599] * (-656.190) (-658.927) (-656.306) [-660.628] -- 0:00:55
153000 -- (-657.959) (-659.294) [-655.790] (-656.862) * (-659.469) (-659.512) (-657.828) [-656.960] -- 0:00:55
153500 -- [-655.925] (-656.720) (-657.592) (-655.902) * [-659.567] (-663.540) (-658.781) (-656.496) -- 0:00:55
154000 -- [-656.505] (-657.490) (-657.602) (-658.344) * (-657.910) (-659.990) (-662.295) [-658.183] -- 0:00:54
154500 -- (-656.567) [-659.877] (-658.198) (-656.344) * (-656.555) (-658.047) [-660.837] (-656.552) -- 0:00:54
155000 -- (-656.530) [-657.440] (-656.434) (-659.359) * [-657.982] (-656.355) (-658.420) (-656.503) -- 0:00:54
Average standard deviation of split frequencies: 0.018467
155500 -- (-656.431) (-658.428) [-657.100] (-657.874) * (-657.646) [-656.459] (-659.549) (-657.627) -- 0:00:54
156000 -- (-659.730) [-656.820] (-660.592) (-660.296) * (-657.853) (-658.888) (-659.508) [-657.096] -- 0:00:54
156500 -- (-657.678) (-660.817) (-657.259) [-656.199] * (-658.553) (-659.701) (-659.215) [-656.414] -- 0:00:53
157000 -- (-659.293) (-656.973) [-659.942] (-657.395) * [-656.332] (-660.710) (-657.435) (-658.993) -- 0:00:53
157500 -- [-657.563] (-656.911) (-660.097) (-656.518) * (-655.496) (-660.688) (-661.152) [-655.845] -- 0:00:53
158000 -- [-659.607] (-657.423) (-664.311) (-657.760) * [-655.839] (-656.019) (-657.635) (-655.968) -- 0:00:53
158500 -- (-657.425) (-657.502) (-656.813) [-658.795] * (-660.376) (-656.310) (-658.104) [-656.743] -- 0:00:53
159000 -- [-656.711] (-656.536) (-657.161) (-657.258) * (-659.504) (-658.674) [-656.316] (-657.352) -- 0:00:52
159500 -- (-657.542) (-656.099) (-659.570) [-663.132] * (-664.155) [-656.950] (-658.639) (-658.118) -- 0:00:52
160000 -- [-657.123] (-657.014) (-657.615) (-658.551) * (-657.472) (-657.207) [-658.445] (-658.235) -- 0:00:52
Average standard deviation of split frequencies: 0.016626
160500 -- (-661.062) [-655.901] (-656.386) (-662.183) * (-655.842) (-658.235) [-657.463] (-660.258) -- 0:00:52
161000 -- (-656.836) [-658.265] (-658.373) (-659.241) * (-657.004) (-660.848) (-656.870) [-656.621] -- 0:00:52
161500 -- (-657.374) (-656.061) [-657.533] (-658.643) * (-664.781) (-658.171) (-661.755) [-659.961] -- 0:00:51
162000 -- (-658.087) (-658.520) [-655.867] (-657.741) * (-656.844) (-656.088) (-660.265) [-657.607] -- 0:00:51
162500 -- (-656.404) [-659.831] (-655.971) (-658.181) * (-657.133) (-656.857) (-659.164) [-661.172] -- 0:00:51
163000 -- [-661.281] (-661.452) (-655.533) (-658.069) * (-657.197) (-656.593) (-657.897) [-655.816] -- 0:00:56
163500 -- (-659.138) (-658.212) (-656.047) [-657.495] * (-657.011) (-659.176) [-658.587] (-656.269) -- 0:00:56
164000 -- [-658.909] (-658.112) (-658.168) (-657.612) * (-657.267) [-655.723] (-657.022) (-656.165) -- 0:00:56
164500 -- (-657.726) [-657.568] (-656.102) (-656.672) * (-657.383) [-655.987] (-657.883) (-655.677) -- 0:00:55
165000 -- (-657.998) (-658.598) [-656.895] (-657.273) * (-658.689) (-655.679) [-656.053] (-657.399) -- 0:00:55
Average standard deviation of split frequencies: 0.015461
165500 -- (-656.865) (-658.464) [-658.058] (-657.147) * (-656.534) (-655.989) [-658.030] (-657.345) -- 0:00:55
166000 -- (-656.800) (-659.352) [-655.676] (-656.875) * (-657.906) (-655.518) (-658.308) [-656.849] -- 0:00:55
166500 -- [-656.888] (-659.758) (-656.085) (-657.645) * (-659.294) (-656.135) (-658.489) [-658.335] -- 0:00:55
167000 -- (-658.430) [-658.177] (-658.268) (-655.841) * (-660.367) (-655.483) [-657.354] (-657.219) -- 0:00:54
167500 -- [-661.252] (-657.353) (-659.285) (-658.367) * (-659.142) (-655.997) (-658.308) [-657.620] -- 0:00:54
168000 -- [-660.162] (-659.384) (-657.974) (-658.918) * (-658.170) (-658.014) [-657.572] (-656.966) -- 0:00:54
168500 -- (-660.614) (-660.230) (-661.332) [-657.890] * (-655.931) [-657.926] (-657.689) (-663.070) -- 0:00:54
169000 -- (-656.119) (-657.431) (-657.277) [-658.532] * (-656.417) [-656.050] (-656.709) (-662.237) -- 0:00:54
169500 -- (-657.401) [-655.966] (-656.658) (-656.953) * [-656.678] (-658.496) (-657.438) (-663.622) -- 0:00:53
170000 -- [-658.465] (-658.218) (-656.273) (-656.788) * (-659.980) (-657.960) [-657.066] (-658.343) -- 0:00:53
Average standard deviation of split frequencies: 0.015192
170500 -- (-659.591) (-656.927) (-657.295) [-657.626] * [-655.534] (-661.098) (-657.280) (-657.309) -- 0:00:53
171000 -- (-658.556) (-657.408) [-657.040] (-657.529) * (-656.076) [-656.326] (-656.422) (-658.225) -- 0:00:53
171500 -- (-657.265) (-656.773) (-656.427) [-659.280] * (-656.106) [-662.336] (-656.677) (-658.840) -- 0:00:53
172000 -- (-657.393) [-659.423] (-659.513) (-661.459) * [-656.019] (-655.720) (-659.402) (-662.182) -- 0:00:52
172500 -- (-659.766) (-656.186) (-658.689) [-657.888] * (-658.285) [-656.859] (-660.774) (-660.534) -- 0:00:52
173000 -- (-656.810) [-656.521] (-656.779) (-660.166) * (-656.292) [-661.754] (-661.787) (-657.389) -- 0:00:52
173500 -- [-657.925] (-656.653) (-659.565) (-661.215) * (-659.744) (-658.422) [-657.404] (-656.914) -- 0:00:52
174000 -- (-657.605) [-656.715] (-659.588) (-657.791) * (-659.556) (-660.350) [-658.212] (-657.394) -- 0:00:52
174500 -- (-659.523) [-656.263] (-657.119) (-656.466) * [-657.671] (-658.642) (-657.479) (-658.424) -- 0:00:52
175000 -- (-657.206) (-656.080) (-658.376) [-657.882] * (-659.548) (-657.407) [-656.160] (-657.706) -- 0:00:51
Average standard deviation of split frequencies: 0.014136
175500 -- [-656.777] (-658.264) (-658.089) (-657.203) * (-658.223) [-659.011] (-657.678) (-656.804) -- 0:00:51
176000 -- (-657.046) (-659.205) [-658.351] (-659.506) * (-663.570) (-658.669) [-657.165] (-656.874) -- 0:00:51
176500 -- (-661.847) (-657.601) (-655.839) [-656.511] * (-658.461) [-659.327] (-659.712) (-658.072) -- 0:00:51
177000 -- (-660.704) (-659.168) [-656.350] (-658.974) * [-656.528] (-656.794) (-661.154) (-656.576) -- 0:00:51
177500 -- (-656.949) [-659.667] (-657.988) (-659.891) * [-657.557] (-657.612) (-658.305) (-657.240) -- 0:00:50
178000 -- (-659.028) (-658.908) [-656.907] (-660.650) * (-658.546) [-656.131] (-657.599) (-658.655) -- 0:00:50
178500 -- (-660.434) [-656.664] (-660.178) (-662.435) * (-662.144) (-657.565) (-657.203) [-659.349] -- 0:00:50
179000 -- (-657.734) [-660.040] (-661.130) (-661.329) * [-656.994] (-657.412) (-659.331) (-660.442) -- 0:00:50
179500 -- (-659.220) (-667.768) [-657.971] (-660.706) * (-662.832) (-657.030) (-658.867) [-656.308] -- 0:00:50
180000 -- (-656.564) (-662.454) [-656.916] (-661.692) * (-660.342) (-657.577) (-656.997) [-660.036] -- 0:00:54
Average standard deviation of split frequencies: 0.015800
180500 -- (-656.075) (-657.639) (-656.196) [-661.803] * (-660.546) (-657.669) [-657.756] (-662.111) -- 0:00:54
181000 -- (-658.651) (-660.511) (-658.271) [-657.486] * (-660.489) (-661.052) [-658.528] (-657.967) -- 0:00:54
181500 -- (-656.847) (-657.823) [-655.669] (-656.708) * (-668.055) (-660.676) [-657.032] (-659.426) -- 0:00:54
182000 -- (-658.315) [-656.516] (-657.082) (-656.206) * (-664.559) [-657.952] (-656.476) (-658.672) -- 0:00:53
182500 -- (-659.541) (-661.730) (-657.757) [-656.888] * [-657.597] (-657.319) (-657.587) (-657.896) -- 0:00:53
183000 -- (-662.870) (-664.049) (-658.401) [-656.848] * (-659.591) [-657.650] (-656.279) (-660.743) -- 0:00:53
183500 -- (-658.695) (-658.695) (-658.324) [-657.688] * (-657.958) [-658.488] (-657.981) (-659.460) -- 0:00:53
184000 -- (-657.450) (-655.945) [-655.933] (-656.315) * (-656.747) (-661.358) [-658.129] (-658.951) -- 0:00:53
184500 -- (-661.871) (-656.729) (-657.897) [-658.603] * (-658.134) (-657.275) (-657.298) [-657.150] -- 0:00:53
185000 -- (-661.761) (-656.832) [-659.609] (-658.748) * [-656.293] (-657.811) (-656.810) (-657.497) -- 0:00:52
Average standard deviation of split frequencies: 0.015066
185500 -- [-656.657] (-656.290) (-656.993) (-657.721) * (-657.788) [-658.130] (-658.523) (-656.494) -- 0:00:52
186000 -- (-658.989) (-657.213) (-657.011) [-660.121] * [-658.341] (-657.846) (-658.284) (-655.600) -- 0:00:52
186500 -- (-659.349) (-661.112) (-655.986) [-656.440] * [-657.315] (-659.969) (-657.413) (-660.433) -- 0:00:52
187000 -- (-656.379) (-659.166) (-655.826) [-656.322] * (-659.639) (-658.232) [-658.477] (-660.035) -- 0:00:52
187500 -- (-659.308) [-658.133] (-657.020) (-658.976) * [-656.903] (-657.365) (-656.284) (-657.613) -- 0:00:52
188000 -- (-661.507) (-661.719) [-656.351] (-659.265) * (-659.139) [-656.466] (-658.282) (-656.626) -- 0:00:51
188500 -- (-657.667) (-655.899) (-655.955) [-657.429] * (-659.494) (-658.254) [-656.757] (-657.657) -- 0:00:51
189000 -- (-657.138) [-656.770] (-657.930) (-657.304) * (-660.087) (-658.005) (-658.148) [-656.038] -- 0:00:51
189500 -- [-656.794] (-658.931) (-657.487) (-656.075) * (-658.712) (-658.017) (-661.031) [-656.089] -- 0:00:51
190000 -- (-657.295) [-657.322] (-659.083) (-657.538) * (-658.308) [-658.870] (-661.284) (-656.084) -- 0:00:51
Average standard deviation of split frequencies: 0.014972
190500 -- (-655.552) (-659.256) (-659.247) [-656.689] * (-657.734) (-657.263) (-658.284) [-657.884] -- 0:00:50
191000 -- (-658.678) (-656.976) [-660.586] (-660.904) * (-655.893) (-658.960) [-656.741] (-659.725) -- 0:00:50
191500 -- (-664.193) [-656.003] (-661.973) (-662.685) * (-656.977) [-659.354] (-662.863) (-657.926) -- 0:00:50
192000 -- (-657.097) [-656.309] (-661.408) (-659.234) * (-658.118) (-658.266) [-656.921] (-656.127) -- 0:00:50
192500 -- [-656.629] (-663.298) (-660.811) (-658.928) * (-657.627) [-655.868] (-662.144) (-656.718) -- 0:00:50
193000 -- (-659.106) [-662.529] (-656.967) (-658.879) * (-655.928) [-656.725] (-660.182) (-656.896) -- 0:00:50
193500 -- (-658.036) [-659.134] (-658.335) (-657.292) * (-657.822) [-657.909] (-657.153) (-657.515) -- 0:00:50
194000 -- (-660.263) (-657.749) [-656.849] (-659.175) * (-657.434) (-656.657) [-658.831] (-656.599) -- 0:00:49
194500 -- (-655.810) (-658.759) (-657.688) [-657.366] * (-657.105) (-656.987) [-657.935] (-661.463) -- 0:00:49
195000 -- (-655.993) [-656.217] (-658.309) (-656.795) * (-658.299) (-656.510) (-661.609) [-658.431] -- 0:00:49
Average standard deviation of split frequencies: 0.016836
195500 -- (-657.403) (-660.161) (-659.322) [-656.630] * (-656.926) [-657.076] (-659.555) (-658.201) -- 0:00:49
196000 -- (-656.157) [-656.414] (-661.925) (-657.832) * (-658.108) (-659.909) [-660.670] (-657.108) -- 0:00:49
196500 -- (-657.228) [-665.476] (-659.265) (-656.686) * (-658.301) (-657.784) [-656.570] (-656.809) -- 0:00:53
197000 -- (-657.375) (-660.077) (-657.976) [-657.304] * (-662.002) (-656.448) (-658.189) [-659.177] -- 0:00:52
197500 -- (-658.370) [-657.427] (-656.452) (-664.038) * (-657.265) [-656.315] (-657.265) (-657.832) -- 0:00:52
198000 -- (-659.343) (-657.409) (-655.652) [-659.471] * (-656.966) (-655.688) (-656.904) [-657.796] -- 0:00:52
198500 -- (-661.929) (-657.919) [-656.695] (-660.933) * (-656.865) [-656.285] (-660.840) (-656.103) -- 0:00:52
199000 -- (-664.067) [-658.097] (-656.632) (-656.862) * (-657.153) (-658.515) (-656.672) [-660.217] -- 0:00:52
199500 -- (-658.803) (-657.643) [-656.751] (-656.608) * (-658.211) (-661.261) [-656.669] (-659.327) -- 0:00:52
200000 -- (-656.384) (-658.251) [-655.980] (-656.871) * (-659.495) [-656.948] (-656.919) (-658.511) -- 0:00:51
Average standard deviation of split frequencies: 0.014226
200500 -- (-657.905) (-656.796) (-656.605) [-657.036] * [-656.877] (-657.601) (-656.166) (-657.997) -- 0:00:51
201000 -- (-657.632) (-658.894) [-656.007] (-659.075) * (-658.284) [-658.267] (-658.357) (-657.027) -- 0:00:51
201500 -- (-659.362) [-658.754] (-656.045) (-657.246) * (-660.032) (-662.143) [-659.909] (-658.182) -- 0:00:51
202000 -- (-658.077) (-661.056) (-658.969) [-656.838] * (-658.245) (-656.295) [-658.146] (-656.090) -- 0:00:51
202500 -- [-658.067] (-658.057) (-658.583) (-657.165) * (-657.246) [-659.174] (-659.349) (-658.929) -- 0:00:51
203000 -- (-661.768) (-659.898) (-656.031) [-657.387] * (-658.763) [-656.945] (-661.143) (-659.642) -- 0:00:51
203500 -- [-657.132] (-656.770) (-659.560) (-660.970) * [-657.994] (-657.521) (-656.982) (-657.807) -- 0:00:50
204000 -- (-657.795) (-656.176) [-657.045] (-659.511) * (-657.667) (-661.927) [-657.757] (-656.369) -- 0:00:50
204500 -- [-656.252] (-656.363) (-661.870) (-659.813) * (-658.300) (-658.966) [-656.334] (-655.619) -- 0:00:50
205000 -- (-657.742) (-659.187) [-655.871] (-660.051) * (-659.485) (-657.047) (-658.510) [-659.635] -- 0:00:50
Average standard deviation of split frequencies: 0.014112
205500 -- [-657.926] (-660.116) (-658.835) (-663.080) * (-659.310) (-656.707) [-663.122] (-656.816) -- 0:00:50
206000 -- (-657.336) (-663.964) [-657.736] (-658.068) * (-660.365) (-659.095) (-657.732) [-658.169] -- 0:00:50
206500 -- [-658.239] (-664.307) (-657.624) (-656.751) * (-656.752) [-656.559] (-657.500) (-657.574) -- 0:00:49
207000 -- (-656.246) [-656.572] (-658.024) (-656.900) * [-657.144] (-656.010) (-656.586) (-658.839) -- 0:00:49
207500 -- [-658.153] (-659.606) (-656.337) (-658.446) * (-659.810) [-656.064] (-658.371) (-656.838) -- 0:00:49
208000 -- (-660.007) [-657.129] (-658.199) (-657.830) * (-657.337) (-655.809) (-658.217) [-656.141] -- 0:00:49
208500 -- (-662.489) (-656.108) [-657.412] (-664.150) * (-656.616) (-657.026) (-657.932) [-657.967] -- 0:00:49
209000 -- (-657.946) (-656.945) (-659.431) [-660.685] * [-657.302] (-661.773) (-662.419) (-658.117) -- 0:00:49
209500 -- (-658.772) [-659.874] (-661.266) (-658.718) * (-655.670) [-658.002] (-657.048) (-655.987) -- 0:00:49
210000 -- (-660.449) (-659.175) [-657.589] (-657.429) * (-658.410) (-655.754) (-656.025) [-656.428] -- 0:00:48
Average standard deviation of split frequencies: 0.013550
210500 -- (-659.256) (-656.505) (-658.076) [-660.341] * [-656.074] (-659.637) (-657.370) (-656.687) -- 0:00:48
211000 -- (-661.871) (-659.402) [-656.020] (-658.441) * (-655.859) [-658.138] (-656.625) (-656.687) -- 0:00:48
211500 -- (-656.422) [-656.085] (-659.222) (-656.967) * (-656.589) (-657.448) (-657.842) [-655.635] -- 0:00:48
212000 -- (-657.822) [-657.841] (-657.230) (-656.023) * (-658.926) [-659.205] (-661.291) (-659.829) -- 0:00:48
212500 -- (-658.242) (-659.834) [-657.372] (-661.230) * (-656.374) (-656.445) (-659.733) [-656.661] -- 0:00:48
213000 -- [-657.905] (-656.326) (-658.302) (-656.348) * [-657.489] (-656.206) (-659.354) (-658.290) -- 0:00:48
213500 -- (-658.858) (-656.258) [-657.747] (-656.635) * [-657.250] (-660.106) (-656.593) (-659.432) -- 0:00:51
214000 -- (-659.537) (-656.072) [-657.224] (-656.120) * [-655.535] (-660.705) (-657.039) (-658.657) -- 0:00:51
214500 -- (-657.728) [-657.346] (-657.153) (-657.745) * (-656.899) (-656.795) [-657.527] (-657.797) -- 0:00:51
215000 -- (-657.201) (-657.483) [-660.737] (-658.633) * (-658.056) (-659.931) [-655.768] (-656.664) -- 0:00:51
Average standard deviation of split frequencies: 0.013458
215500 -- [-656.485] (-659.884) (-660.017) (-659.617) * [-656.074] (-655.555) (-657.408) (-656.640) -- 0:00:50
216000 -- (-656.215) (-662.755) [-660.452] (-658.560) * [-655.741] (-657.935) (-657.281) (-661.571) -- 0:00:50
216500 -- (-657.527) (-659.938) (-661.485) [-655.811] * (-660.816) (-656.142) (-656.713) [-658.288] -- 0:00:50
217000 -- (-655.849) (-659.257) [-659.083] (-656.501) * (-662.839) (-657.298) (-657.322) [-658.820] -- 0:00:50
217500 -- [-658.951] (-657.189) (-656.869) (-657.760) * (-657.346) (-657.018) (-657.341) [-657.671] -- 0:00:50
218000 -- (-658.838) (-659.596) [-659.237] (-656.025) * (-659.862) (-656.465) (-658.178) [-655.513] -- 0:00:50
218500 -- (-657.552) (-658.143) [-657.301] (-656.226) * [-658.115] (-656.503) (-657.170) (-655.852) -- 0:00:50
219000 -- [-656.142] (-656.997) (-657.125) (-656.830) * [-655.709] (-658.386) (-657.689) (-660.054) -- 0:00:49
219500 -- [-655.960] (-658.098) (-656.176) (-656.247) * (-658.967) (-663.023) (-656.778) [-658.810] -- 0:00:49
220000 -- [-662.447] (-656.506) (-656.497) (-656.406) * (-658.850) (-659.628) [-657.364] (-658.136) -- 0:00:49
Average standard deviation of split frequencies: 0.012106
220500 -- (-663.383) (-656.004) [-656.926] (-658.104) * (-660.962) (-660.624) (-656.368) [-656.127] -- 0:00:49
221000 -- (-658.018) (-660.647) [-659.341] (-658.299) * [-660.011] (-659.768) (-656.106) (-657.583) -- 0:00:49
221500 -- [-656.961] (-658.619) (-656.047) (-658.019) * (-656.996) (-659.287) [-657.632] (-661.594) -- 0:00:49
222000 -- (-657.974) [-657.861] (-664.085) (-657.790) * (-660.586) (-662.102) (-658.011) [-658.605] -- 0:00:49
222500 -- [-657.166] (-656.802) (-659.342) (-656.154) * (-658.800) (-661.308) [-657.911] (-656.930) -- 0:00:48
223000 -- (-660.746) [-657.529] (-655.661) (-660.447) * (-661.043) (-656.841) (-658.473) [-655.669] -- 0:00:48
223500 -- (-658.189) (-658.789) (-656.557) [-657.923] * (-656.182) (-657.807) (-657.589) [-656.224] -- 0:00:48
224000 -- (-656.172) [-659.699] (-656.885) (-656.645) * [-656.110] (-658.646) (-658.447) (-655.962) -- 0:00:48
224500 -- (-657.828) [-658.040] (-656.769) (-657.382) * (-656.603) (-656.049) [-658.277] (-658.608) -- 0:00:48
225000 -- [-657.828] (-660.201) (-656.978) (-657.433) * [-656.964] (-658.627) (-656.155) (-660.143) -- 0:00:48
Average standard deviation of split frequencies: 0.011472
225500 -- (-661.366) (-658.478) (-657.200) [-655.760] * [-659.256] (-657.660) (-656.873) (-657.836) -- 0:00:48
226000 -- [-657.272] (-659.088) (-660.036) (-659.870) * (-657.220) [-657.130] (-656.441) (-659.776) -- 0:00:47
226500 -- (-656.098) (-655.639) (-657.214) [-656.666] * (-657.580) (-656.747) (-657.391) [-657.427] -- 0:00:47
227000 -- (-662.989) [-657.747] (-657.295) (-656.824) * [-655.860] (-656.483) (-657.960) (-655.886) -- 0:00:47
227500 -- [-659.345] (-656.415) (-657.873) (-658.063) * (-655.595) (-658.705) [-657.590] (-656.250) -- 0:00:47
228000 -- (-659.443) (-658.767) [-658.026] (-661.032) * (-658.847) (-660.977) [-656.760] (-655.809) -- 0:00:47
228500 -- (-657.077) [-655.918] (-656.136) (-657.007) * [-657.027] (-658.944) (-656.938) (-658.155) -- 0:00:47
229000 -- [-657.882] (-656.412) (-655.767) (-660.739) * (-660.047) (-656.874) (-659.070) [-658.020] -- 0:00:47
229500 -- [-656.166] (-659.715) (-659.174) (-664.911) * (-660.261) [-657.837] (-659.880) (-661.828) -- 0:00:47
230000 -- (-657.896) [-660.035] (-657.890) (-658.321) * (-657.913) [-658.891] (-657.076) (-659.898) -- 0:00:46
Average standard deviation of split frequencies: 0.011541
230500 -- (-658.136) [-656.851] (-656.705) (-657.450) * [-657.202] (-659.526) (-656.829) (-656.495) -- 0:00:50
231000 -- (-657.341) (-657.438) [-659.500] (-656.686) * (-656.866) (-658.959) [-657.347] (-657.986) -- 0:00:49
231500 -- [-661.474] (-655.913) (-660.123) (-656.448) * [-658.968] (-658.612) (-656.293) (-659.273) -- 0:00:49
232000 -- [-659.253] (-657.345) (-658.088) (-656.423) * (-660.702) (-657.151) [-657.048] (-659.209) -- 0:00:49
232500 -- [-656.270] (-657.457) (-657.206) (-657.988) * (-659.657) (-661.687) [-657.463] (-657.288) -- 0:00:49
233000 -- (-657.949) [-659.109] (-656.540) (-658.990) * (-655.737) [-656.112] (-661.352) (-655.727) -- 0:00:49
233500 -- (-661.377) (-657.033) [-656.010] (-661.300) * (-661.786) (-657.439) (-656.843) [-655.790] -- 0:00:49
234000 -- (-659.875) [-659.192] (-656.721) (-657.434) * (-655.857) (-657.362) [-656.573] (-656.300) -- 0:00:49
234500 -- [-656.752] (-658.629) (-662.237) (-658.096) * (-656.164) [-656.195] (-662.490) (-658.352) -- 0:00:48
235000 -- (-658.587) (-657.239) [-658.696] (-656.654) * (-657.263) (-656.154) [-657.424] (-657.609) -- 0:00:48
Average standard deviation of split frequencies: 0.011750
235500 -- (-659.637) [-656.723] (-657.240) (-656.084) * (-660.616) [-656.204] (-659.617) (-658.466) -- 0:00:48
236000 -- [-661.941] (-657.006) (-657.418) (-657.247) * [-656.680] (-656.201) (-658.881) (-659.405) -- 0:00:48
236500 -- (-659.804) (-657.340) [-656.309] (-660.202) * (-656.840) (-656.653) (-658.079) [-658.135] -- 0:00:48
237000 -- (-657.947) (-658.117) [-658.791] (-656.984) * (-656.703) [-658.663] (-656.051) (-659.960) -- 0:00:48
237500 -- (-659.723) (-657.607) (-657.648) [-657.469] * (-656.180) (-660.081) (-656.086) [-658.737] -- 0:00:48
238000 -- (-655.699) (-658.022) [-658.436] (-655.707) * (-658.292) [-659.052] (-660.529) (-657.684) -- 0:00:48
238500 -- [-656.754] (-657.105) (-656.991) (-656.384) * (-657.709) [-656.972] (-660.362) (-655.690) -- 0:00:47
239000 -- [-657.193] (-659.225) (-660.509) (-657.489) * (-660.690) (-658.076) [-657.869] (-657.021) -- 0:00:47
239500 -- (-657.897) (-660.377) [-658.977] (-658.586) * [-658.519] (-661.385) (-656.726) (-657.061) -- 0:00:47
240000 -- (-655.822) (-658.676) (-660.703) [-657.231] * (-658.742) (-659.270) [-658.645] (-657.022) -- 0:00:47
Average standard deviation of split frequencies: 0.011522
240500 -- (-656.930) (-660.319) [-658.440] (-658.552) * (-656.818) (-656.524) (-656.564) [-665.344] -- 0:00:47
241000 -- (-656.681) (-658.459) [-657.643] (-658.707) * (-661.669) (-657.374) (-657.704) [-664.512] -- 0:00:47
241500 -- [-656.220] (-657.153) (-656.422) (-656.516) * (-657.741) [-657.489] (-657.438) (-655.894) -- 0:00:47
242000 -- [-656.386] (-658.243) (-658.185) (-657.211) * (-657.057) [-657.836] (-659.401) (-655.867) -- 0:00:46
242500 -- (-656.005) (-658.042) [-656.883] (-657.011) * (-656.962) [-656.614] (-656.840) (-657.014) -- 0:00:46
243000 -- (-657.155) [-656.829] (-655.842) (-659.368) * (-659.792) (-656.746) (-656.709) [-657.845] -- 0:00:46
243500 -- (-655.412) [-656.505] (-660.074) (-656.352) * [-660.532] (-659.026) (-660.873) (-659.384) -- 0:00:46
244000 -- (-655.498) (-658.148) [-658.351] (-660.173) * (-664.756) (-657.102) (-657.454) [-656.961] -- 0:00:46
244500 -- (-656.276) (-659.108) (-656.896) [-660.201] * (-662.409) (-661.504) (-655.797) [-656.237] -- 0:00:46
245000 -- (-656.723) (-659.032) (-657.353) [-662.075] * (-656.844) (-656.071) (-659.455) [-656.274] -- 0:00:46
Average standard deviation of split frequencies: 0.011610
245500 -- (-656.290) (-660.633) (-657.938) [-657.722] * (-658.141) [-659.177] (-659.003) (-659.574) -- 0:00:46
246000 -- (-657.005) [-658.746] (-660.970) (-657.944) * [-659.317] (-657.677) (-660.043) (-657.553) -- 0:00:45
246500 -- (-656.508) [-661.571] (-657.027) (-657.963) * (-659.397) (-658.709) [-662.024] (-658.031) -- 0:00:45
247000 -- (-660.494) [-658.696] (-656.380) (-657.740) * (-656.146) (-659.990) [-657.128] (-657.486) -- 0:00:45
247500 -- (-656.143) (-660.311) [-659.188] (-657.235) * (-656.152) (-659.056) (-663.661) [-657.623] -- 0:00:48
248000 -- [-656.431] (-657.219) (-661.241) (-657.871) * (-660.041) (-660.202) [-660.360] (-657.359) -- 0:00:48
248500 -- (-656.276) (-657.700) (-659.576) [-657.728] * [-657.602] (-659.470) (-661.779) (-657.072) -- 0:00:48
249000 -- [-657.547] (-660.305) (-658.881) (-657.482) * [-656.743] (-660.260) (-659.580) (-656.716) -- 0:00:48
249500 -- (-664.347) (-656.757) (-667.295) [-656.434] * (-659.013) [-657.107] (-659.410) (-656.159) -- 0:00:48
250000 -- (-657.796) [-659.596] (-657.472) (-657.555) * [-657.777] (-657.202) (-659.073) (-656.231) -- 0:00:48
Average standard deviation of split frequencies: 0.013269
250500 -- (-657.150) (-658.381) [-658.899] (-657.403) * (-661.395) (-658.343) [-658.499] (-656.306) -- 0:00:47
251000 -- [-655.808] (-657.422) (-660.454) (-660.654) * [-655.743] (-657.639) (-658.846) (-657.647) -- 0:00:47
251500 -- (-655.963) [-657.715] (-657.648) (-656.597) * [-656.238] (-658.597) (-658.740) (-660.555) -- 0:00:47
252000 -- (-658.240) (-663.276) (-657.131) [-656.683] * (-656.663) [-657.511] (-656.553) (-657.489) -- 0:00:47
252500 -- (-657.909) [-659.620] (-658.929) (-656.728) * [-660.341] (-656.951) (-656.231) (-660.927) -- 0:00:47
253000 -- (-657.233) [-658.005] (-657.082) (-656.613) * [-661.034] (-657.235) (-660.718) (-660.754) -- 0:00:47
253500 -- (-659.171) (-657.277) (-660.560) [-658.492] * [-659.970] (-656.817) (-657.731) (-664.474) -- 0:00:47
254000 -- (-659.437) [-657.733] (-656.495) (-656.722) * (-658.216) (-657.760) (-657.333) [-655.850] -- 0:00:46
254500 -- [-657.900] (-660.792) (-657.050) (-657.631) * (-658.199) (-656.517) [-656.433] (-657.972) -- 0:00:46
255000 -- [-659.176] (-657.691) (-656.441) (-660.312) * (-657.447) (-660.403) [-657.220] (-661.106) -- 0:00:46
Average standard deviation of split frequencies: 0.012890
255500 -- (-658.987) (-656.453) (-657.436) [-658.393] * (-657.532) [-657.012] (-657.511) (-657.822) -- 0:00:46
256000 -- [-655.550] (-658.550) (-656.247) (-658.949) * (-655.780) (-658.544) (-656.405) [-660.936] -- 0:00:46
256500 -- (-655.911) [-655.972] (-658.077) (-656.231) * (-662.876) (-658.703) (-656.919) [-658.623] -- 0:00:46
257000 -- (-658.431) (-660.764) (-657.460) [-656.754] * [-658.937] (-656.454) (-658.037) (-659.205) -- 0:00:46
257500 -- (-658.458) (-658.902) [-657.997] (-656.198) * (-655.821) (-662.158) (-656.326) [-657.246] -- 0:00:46
258000 -- [-657.001] (-657.708) (-659.076) (-657.011) * (-655.878) [-656.906] (-657.828) (-659.407) -- 0:00:46
258500 -- (-656.641) [-658.111] (-657.806) (-658.351) * (-656.906) (-660.376) [-658.377] (-661.357) -- 0:00:45
259000 -- (-658.547) (-659.507) (-660.231) [-659.242] * (-657.685) (-657.815) [-659.061] (-657.260) -- 0:00:45
259500 -- (-659.513) (-658.217) (-657.707) [-662.818] * [-655.955] (-657.268) (-661.534) (-661.683) -- 0:00:45
260000 -- (-660.762) [-658.506] (-665.249) (-658.041) * (-657.543) (-659.235) (-664.365) [-656.612] -- 0:00:45
Average standard deviation of split frequencies: 0.012872
260500 -- [-657.487] (-659.536) (-659.963) (-657.560) * (-660.066) [-658.278] (-657.369) (-657.256) -- 0:00:45
261000 -- (-656.963) [-658.889] (-657.842) (-657.096) * (-657.414) (-660.552) (-660.229) [-657.555] -- 0:00:45
261500 -- (-661.598) (-659.029) [-656.870] (-657.833) * (-661.446) (-659.209) (-659.159) [-657.345] -- 0:00:45
262000 -- (-657.055) [-657.321] (-658.425) (-659.494) * (-657.224) (-656.065) (-658.598) [-657.647] -- 0:00:45
262500 -- (-656.822) (-656.927) (-657.884) [-659.571] * (-657.450) (-658.380) [-656.994] (-657.509) -- 0:00:44
263000 -- [-657.616] (-657.555) (-656.275) (-658.328) * (-659.509) (-661.316) [-660.111] (-658.752) -- 0:00:44
263500 -- (-656.817) (-658.540) [-657.903] (-657.309) * (-656.503) [-658.802] (-659.791) (-657.284) -- 0:00:44
264000 -- (-655.933) (-657.623) (-659.091) [-656.006] * (-656.738) [-656.811] (-661.512) (-657.475) -- 0:00:44
264500 -- [-656.350] (-656.436) (-657.507) (-657.235) * (-661.178) [-657.354] (-662.208) (-657.635) -- 0:00:47
265000 -- (-659.880) (-656.288) (-656.609) [-659.612] * (-656.137) (-659.620) (-662.328) [-660.257] -- 0:00:47
Average standard deviation of split frequencies: 0.012301
265500 -- (-656.886) (-657.932) (-656.602) [-659.482] * (-656.841) (-659.768) (-657.661) [-657.965] -- 0:00:47
266000 -- [-656.962] (-660.496) (-658.479) (-657.867) * (-660.352) (-659.169) (-664.269) [-657.989] -- 0:00:46
266500 -- (-656.755) (-661.481) [-659.084] (-656.877) * (-657.554) (-658.598) (-656.102) [-655.473] -- 0:00:46
267000 -- (-659.139) [-656.809] (-657.789) (-658.864) * [-657.032] (-655.800) (-658.612) (-656.283) -- 0:00:46
267500 -- (-658.754) [-656.746] (-656.684) (-656.826) * [-657.709] (-658.851) (-658.774) (-655.921) -- 0:00:46
268000 -- (-658.828) (-657.988) (-657.603) [-657.456] * (-656.257) (-659.605) (-659.209) [-657.076] -- 0:00:46
268500 -- [-658.433] (-661.669) (-658.240) (-659.811) * (-657.537) (-658.422) [-656.762] (-657.210) -- 0:00:46
269000 -- (-657.662) (-658.323) (-660.008) [-657.756] * [-657.083] (-657.847) (-657.968) (-657.093) -- 0:00:46
269500 -- (-658.631) [-655.906] (-656.516) (-659.080) * (-658.603) (-656.413) (-659.294) [-658.085] -- 0:00:46
270000 -- (-660.490) (-657.139) [-656.245] (-657.733) * (-658.010) (-659.195) [-657.033] (-659.688) -- 0:00:45
Average standard deviation of split frequencies: 0.012909
270500 -- [-657.131] (-655.706) (-657.395) (-657.266) * [-655.852] (-657.905) (-660.899) (-658.591) -- 0:00:45
271000 -- (-656.508) (-655.393) [-658.039] (-661.824) * (-656.925) (-656.777) (-656.518) [-656.606] -- 0:00:45
271500 -- (-658.216) (-661.094) [-658.154] (-662.536) * (-660.889) [-659.723] (-655.607) (-656.329) -- 0:00:45
272000 -- (-657.247) [-658.023] (-657.183) (-656.752) * (-656.749) (-657.588) [-656.403] (-659.523) -- 0:00:45
272500 -- (-660.876) (-657.943) (-658.289) [-657.207] * (-659.918) (-659.253) [-656.691] (-657.956) -- 0:00:45
273000 -- (-656.725) (-657.101) (-657.350) [-656.827] * [-657.583] (-657.163) (-656.721) (-659.469) -- 0:00:45
273500 -- (-657.514) (-659.010) [-657.005] (-656.674) * (-658.747) (-656.598) [-659.032] (-658.080) -- 0:00:45
274000 -- (-656.657) [-658.775] (-656.545) (-661.000) * (-656.872) (-657.252) (-657.856) [-659.608] -- 0:00:45
274500 -- (-655.666) (-660.638) [-656.122] (-661.565) * (-657.320) (-657.105) (-657.133) [-657.308] -- 0:00:44
275000 -- [-659.390] (-660.458) (-661.410) (-662.706) * (-656.163) [-657.358] (-660.885) (-657.520) -- 0:00:44
Average standard deviation of split frequencies: 0.012169
275500 -- (-657.355) (-658.135) (-664.484) [-659.893] * (-659.721) (-656.983) [-657.154] (-658.600) -- 0:00:44
276000 -- [-661.484] (-657.678) (-656.891) (-658.031) * (-659.731) (-657.788) [-656.493] (-657.656) -- 0:00:44
276500 -- (-658.240) [-658.294] (-657.078) (-659.810) * (-659.020) [-657.935] (-660.787) (-656.548) -- 0:00:44
277000 -- (-658.860) [-661.243] (-657.561) (-656.286) * (-659.787) (-659.117) (-657.251) [-657.486] -- 0:00:44
277500 -- [-660.267] (-657.240) (-658.676) (-657.528) * (-661.235) [-657.803] (-657.934) (-659.018) -- 0:00:44
278000 -- [-657.211] (-660.550) (-658.840) (-656.756) * [-658.713] (-658.810) (-659.667) (-658.063) -- 0:00:44
278500 -- [-658.143] (-661.109) (-658.587) (-657.075) * (-658.593) [-656.298] (-665.455) (-656.786) -- 0:00:44
279000 -- (-659.251) (-661.787) [-658.500] (-657.118) * (-657.702) [-662.982] (-660.244) (-658.620) -- 0:00:43
279500 -- (-657.956) [-659.532] (-659.240) (-656.154) * (-660.658) (-664.184) [-658.900] (-658.653) -- 0:00:43
280000 -- (-656.550) (-656.396) (-659.533) [-656.285] * (-658.056) (-657.672) (-659.952) [-658.042] -- 0:00:43
Average standard deviation of split frequencies: 0.012492
280500 -- (-658.059) [-659.868] (-656.251) (-658.782) * (-661.342) (-661.884) [-657.441] (-655.692) -- 0:00:43
281000 -- [-657.054] (-657.929) (-664.697) (-657.156) * (-660.337) (-658.353) (-658.792) [-655.779] -- 0:00:43
281500 -- (-657.852) (-656.236) (-658.945) [-657.266] * [-657.376] (-657.651) (-658.612) (-660.836) -- 0:00:45
282000 -- (-658.882) (-657.891) (-663.488) [-658.416] * (-659.205) (-659.713) [-658.194] (-662.679) -- 0:00:45
282500 -- (-655.800) [-656.710] (-673.956) (-656.887) * (-657.277) (-658.366) [-656.830] (-658.997) -- 0:00:45
283000 -- (-660.411) (-656.710) [-659.284] (-656.734) * [-657.150] (-658.794) (-656.265) (-659.021) -- 0:00:45
283500 -- (-655.849) [-657.518] (-669.555) (-657.778) * (-657.723) (-658.283) (-659.365) [-656.766] -- 0:00:45
284000 -- (-657.436) (-657.473) (-656.260) [-659.704] * (-664.382) (-655.792) [-656.649] (-658.127) -- 0:00:45
284500 -- [-658.420] (-655.999) (-656.308) (-656.964) * (-660.426) [-656.440] (-658.358) (-656.891) -- 0:00:45
285000 -- (-657.217) (-655.829) [-655.725] (-658.350) * (-658.925) (-657.702) [-657.001] (-663.302) -- 0:00:45
Average standard deviation of split frequencies: 0.012465
285500 -- (-657.313) [-656.882] (-657.168) (-657.959) * (-657.493) (-657.230) (-655.899) [-655.859] -- 0:00:45
286000 -- (-661.751) (-656.659) (-659.951) [-657.739] * (-657.101) (-657.203) (-658.811) [-655.947] -- 0:00:44
286500 -- (-656.583) (-656.568) [-655.855] (-657.308) * [-657.855] (-659.086) (-658.695) (-657.962) -- 0:00:44
287000 -- (-656.074) (-657.172) (-655.601) [-660.399] * (-657.231) [-659.236] (-655.690) (-656.968) -- 0:00:44
287500 -- [-656.060] (-656.027) (-656.360) (-658.102) * (-656.169) (-660.104) [-655.575] (-660.435) -- 0:00:44
288000 -- (-658.328) (-655.545) [-656.326] (-656.852) * (-656.937) (-659.499) (-657.488) [-657.515] -- 0:00:44
288500 -- [-657.102] (-656.779) (-658.019) (-655.916) * (-658.709) (-656.786) (-655.967) [-658.650] -- 0:00:44
289000 -- (-658.679) (-658.181) [-660.893] (-659.728) * [-663.152] (-658.180) (-659.821) (-657.343) -- 0:00:44
289500 -- (-658.347) (-660.279) (-657.613) [-655.669] * (-662.330) (-657.639) (-657.105) [-660.084] -- 0:00:44
290000 -- [-657.469] (-656.377) (-656.372) (-655.426) * (-657.057) [-657.123] (-656.692) (-659.620) -- 0:00:44
Average standard deviation of split frequencies: 0.013076
290500 -- (-657.735) [-659.808] (-657.957) (-659.742) * (-658.425) (-657.756) [-656.022] (-657.776) -- 0:00:43
291000 -- [-657.434] (-667.315) (-656.616) (-657.505) * (-657.404) (-659.677) [-656.492] (-656.044) -- 0:00:43
291500 -- (-657.027) (-663.408) (-656.348) [-656.365] * (-656.502) [-657.278] (-658.981) (-656.620) -- 0:00:43
292000 -- (-657.911) (-657.052) [-656.405] (-657.870) * (-656.975) (-656.448) (-655.665) [-657.701] -- 0:00:43
292500 -- (-657.213) (-657.563) [-656.944] (-661.527) * (-657.848) (-656.701) (-655.839) [-657.945] -- 0:00:43
293000 -- (-657.142) [-656.116] (-657.781) (-658.957) * (-657.791) [-655.923] (-656.297) (-656.639) -- 0:00:43
293500 -- (-658.386) (-659.648) [-657.149] (-656.214) * (-656.887) [-656.153] (-656.268) (-659.568) -- 0:00:43
294000 -- (-657.700) [-657.451] (-656.245) (-657.641) * (-657.258) (-658.300) (-658.039) [-660.494] -- 0:00:43
294500 -- (-657.867) (-657.556) [-657.061] (-655.457) * [-656.988] (-660.045) (-658.621) (-656.266) -- 0:00:43
295000 -- [-658.287] (-658.444) (-658.361) (-657.237) * (-657.558) (-660.296) (-661.260) [-657.806] -- 0:00:43
Average standard deviation of split frequencies: 0.012641
295500 -- (-657.431) (-659.761) (-659.075) [-657.943] * [-656.927] (-661.384) (-657.496) (-657.969) -- 0:00:42
296000 -- (-657.614) [-659.494] (-658.307) (-658.296) * [-658.501] (-658.888) (-662.049) (-660.642) -- 0:00:42
296500 -- (-657.339) (-659.708) (-658.720) [-659.546] * [-658.408] (-658.836) (-655.752) (-657.903) -- 0:00:42
297000 -- (-657.437) (-659.257) (-657.790) [-656.768] * [-656.414] (-659.680) (-656.189) (-659.051) -- 0:00:42
297500 -- (-660.720) (-659.400) (-656.949) [-658.825] * (-660.030) [-659.033] (-656.292) (-658.446) -- 0:00:42
298000 -- (-659.941) (-662.771) (-658.402) [-657.273] * (-657.499) (-657.815) (-660.814) [-657.885] -- 0:00:42
298500 -- (-659.561) [-659.336] (-663.132) (-656.873) * (-660.698) (-662.763) [-657.195] (-657.207) -- 0:00:44
299000 -- [-657.171] (-657.423) (-656.268) (-658.274) * (-658.197) (-658.039) (-659.380) [-657.127] -- 0:00:44
299500 -- (-660.930) (-663.052) [-656.371] (-657.025) * [-656.630] (-655.675) (-658.471) (-658.874) -- 0:00:44
300000 -- (-660.793) [-656.235] (-656.314) (-657.022) * (-657.465) (-657.528) [-657.124] (-656.935) -- 0:00:44
Average standard deviation of split frequencies: 0.012347
300500 -- [-657.539] (-656.937) (-659.753) (-659.315) * (-657.482) [-658.579] (-656.109) (-657.206) -- 0:00:44
301000 -- [-657.045] (-655.867) (-657.215) (-660.731) * (-656.727) [-656.467] (-659.487) (-658.993) -- 0:00:44
301500 -- (-656.037) (-657.733) (-656.367) [-657.547] * (-656.156) [-658.685] (-656.723) (-656.685) -- 0:00:44
302000 -- (-658.005) (-658.163) (-659.285) [-659.314] * [-657.056] (-663.038) (-655.765) (-656.902) -- 0:00:43
302500 -- (-657.893) (-661.347) [-660.203] (-658.980) * [-656.924] (-656.739) (-655.851) (-657.255) -- 0:00:43
303000 -- (-656.099) [-659.220] (-658.890) (-657.807) * (-657.003) (-656.715) (-656.354) [-658.584] -- 0:00:43
303500 -- (-656.613) (-656.649) [-657.567] (-656.793) * (-656.320) [-657.428] (-659.524) (-661.076) -- 0:00:43
304000 -- (-658.215) [-656.826] (-658.858) (-656.802) * [-661.176] (-657.999) (-661.126) (-657.063) -- 0:00:43
304500 -- (-658.580) (-661.924) (-657.172) [-656.752] * (-659.229) [-658.968] (-657.444) (-658.034) -- 0:00:43
305000 -- (-657.744) (-659.876) (-658.495) [-656.778] * [-657.151] (-656.831) (-659.239) (-656.505) -- 0:00:43
Average standard deviation of split frequencies: 0.012421
305500 -- (-658.944) [-656.959] (-657.472) (-660.540) * (-658.514) (-656.986) [-657.725] (-656.145) -- 0:00:43
306000 -- (-658.726) [-658.519] (-656.329) (-657.363) * (-655.640) [-657.627] (-655.983) (-655.835) -- 0:00:43
306500 -- [-656.171] (-658.409) (-656.537) (-656.832) * (-659.401) [-657.155] (-657.755) (-659.255) -- 0:00:42
307000 -- [-656.854] (-655.743) (-656.144) (-656.737) * (-658.832) (-658.259) [-656.240] (-659.283) -- 0:00:42
307500 -- [-662.163] (-655.562) (-658.924) (-659.325) * [-659.506] (-658.564) (-656.466) (-664.827) -- 0:00:42
308000 -- (-658.815) [-657.358] (-659.297) (-660.294) * (-657.188) (-659.250) [-655.779] (-664.279) -- 0:00:42
308500 -- (-656.540) (-655.706) (-656.706) [-660.002] * (-656.408) [-658.331] (-661.440) (-657.867) -- 0:00:42
309000 -- [-656.944] (-655.914) (-656.570) (-662.209) * [-656.408] (-658.325) (-657.138) (-658.132) -- 0:00:42
309500 -- (-657.284) [-656.427] (-655.697) (-657.459) * (-656.851) [-659.788] (-657.155) (-658.599) -- 0:00:42
310000 -- (-660.136) [-655.914] (-655.776) (-657.506) * (-658.040) (-657.792) [-656.328] (-658.085) -- 0:00:42
Average standard deviation of split frequencies: 0.012424
310500 -- (-656.943) (-657.945) (-657.666) [-656.656] * (-659.310) (-658.736) [-657.672] (-657.662) -- 0:00:42
311000 -- (-660.474) [-660.374] (-659.994) (-656.468) * (-657.807) [-657.092] (-657.409) (-659.221) -- 0:00:42
311500 -- (-658.265) [-658.913] (-661.098) (-657.880) * (-659.397) (-663.129) (-657.094) [-658.369] -- 0:00:41
312000 -- (-659.344) (-656.529) [-657.555] (-656.123) * (-658.538) (-661.285) [-657.201] (-657.652) -- 0:00:41
312500 -- (-656.883) (-657.689) [-656.459] (-657.657) * (-657.057) (-658.555) (-657.708) [-656.065] -- 0:00:41
313000 -- (-657.137) (-660.044) [-657.448] (-657.585) * [-655.552] (-655.635) (-660.207) (-658.192) -- 0:00:41
313500 -- [-656.878] (-656.725) (-658.892) (-659.841) * (-655.552) (-658.194) [-661.622] (-658.200) -- 0:00:41
314000 -- (-660.198) [-657.418] (-660.690) (-657.042) * (-658.370) [-658.129] (-656.907) (-657.353) -- 0:00:41
314500 -- (-655.820) (-658.864) [-659.457] (-659.394) * (-656.206) [-659.705] (-656.901) (-658.824) -- 0:00:41
315000 -- (-660.167) (-659.470) (-658.103) [-656.664] * [-657.118] (-657.998) (-657.439) (-658.165) -- 0:00:43
Average standard deviation of split frequencies: 0.011095
315500 -- (-658.192) (-658.964) (-659.164) [-657.312] * (-657.457) (-657.111) (-665.589) [-658.984] -- 0:00:43
316000 -- (-660.966) (-656.313) (-658.960) [-656.574] * (-657.931) (-660.530) [-660.922] (-657.367) -- 0:00:43
316500 -- [-657.642] (-657.297) (-656.512) (-657.257) * (-658.665) [-657.229] (-658.470) (-656.286) -- 0:00:43
317000 -- (-657.611) (-663.091) [-660.224] (-656.650) * (-656.907) (-658.879) (-657.182) [-659.422] -- 0:00:43
317500 -- (-659.000) [-656.794] (-661.278) (-655.611) * (-658.275) (-659.084) [-655.981] (-656.717) -- 0:00:42
318000 -- (-659.217) [-655.495] (-658.024) (-656.624) * [-657.705] (-661.715) (-656.909) (-658.220) -- 0:00:42
318500 -- (-656.766) [-656.329] (-658.364) (-658.307) * (-657.638) [-657.127] (-658.609) (-656.435) -- 0:00:42
319000 -- (-656.874) (-656.812) [-657.153] (-659.022) * (-659.657) (-657.218) [-658.389] (-659.560) -- 0:00:42
319500 -- (-660.930) (-661.788) [-656.773] (-658.686) * (-656.489) (-657.405) (-656.961) [-657.230] -- 0:00:42
320000 -- (-659.500) (-659.683) (-656.286) [-656.900] * (-661.649) (-657.557) [-658.049] (-656.600) -- 0:00:42
Average standard deviation of split frequencies: 0.011501
320500 -- (-656.485) (-655.732) (-655.683) [-656.501] * (-662.892) (-658.114) [-657.210] (-662.053) -- 0:00:42
321000 -- (-656.253) (-655.703) (-656.877) [-658.046] * (-661.332) [-659.178] (-658.684) (-658.823) -- 0:00:42
321500 -- [-657.012] (-657.580) (-658.415) (-660.456) * (-662.124) [-657.943] (-655.949) (-655.908) -- 0:00:42
322000 -- (-664.168) [-657.313] (-657.286) (-658.952) * [-660.346] (-660.948) (-657.750) (-657.518) -- 0:00:42
322500 -- (-656.579) [-656.138] (-656.426) (-655.888) * (-656.567) (-657.284) [-656.508] (-655.896) -- 0:00:42
323000 -- [-657.255] (-657.003) (-656.673) (-656.873) * (-659.665) (-662.054) [-656.709] (-656.030) -- 0:00:41
323500 -- (-657.652) [-657.149] (-659.972) (-657.402) * (-656.690) (-656.921) [-658.094] (-658.200) -- 0:00:41
324000 -- (-661.535) [-656.877] (-662.727) (-657.045) * (-658.591) (-657.370) [-656.236] (-656.619) -- 0:00:41
324500 -- (-657.362) (-657.501) (-661.447) [-656.283] * (-658.362) (-662.491) (-659.339) [-656.073] -- 0:00:41
325000 -- [-657.587] (-655.887) (-658.747) (-656.848) * (-656.905) (-660.797) [-657.852] (-657.148) -- 0:00:41
Average standard deviation of split frequencies: 0.010888
325500 -- (-656.425) [-656.102] (-658.591) (-658.105) * (-657.183) (-662.886) [-658.103] (-657.532) -- 0:00:41
326000 -- (-660.205) (-658.753) (-657.262) [-656.825] * (-657.045) (-658.366) [-656.673] (-657.087) -- 0:00:41
326500 -- (-661.428) (-658.545) (-655.632) [-658.591] * (-656.786) (-657.192) (-657.450) [-656.580] -- 0:00:41
327000 -- (-658.347) [-657.999] (-658.152) (-656.552) * (-657.423) (-660.182) (-657.121) [-656.301] -- 0:00:41
327500 -- [-658.482] (-661.771) (-655.652) (-656.440) * [-660.522] (-656.137) (-659.308) (-657.696) -- 0:00:41
328000 -- (-658.110) [-656.253] (-657.652) (-656.915) * (-657.705) [-658.605] (-657.762) (-655.926) -- 0:00:40
328500 -- (-656.316) (-656.777) (-658.920) [-656.329] * (-659.618) (-656.475) [-656.196] (-659.724) -- 0:00:40
329000 -- (-660.171) (-656.031) [-661.346] (-655.909) * (-661.409) (-657.410) [-657.379] (-661.459) -- 0:00:40
329500 -- (-660.167) (-655.889) (-656.399) [-658.203] * [-662.488] (-657.725) (-657.887) (-656.434) -- 0:00:40
330000 -- (-658.735) (-658.870) [-656.675] (-659.724) * (-656.982) (-658.417) (-657.255) [-658.073] -- 0:00:40
Average standard deviation of split frequencies: 0.011740
330500 -- (-656.687) [-656.449] (-663.967) (-656.176) * (-657.109) (-656.033) (-659.757) [-658.698] -- 0:00:40
331000 -- (-657.044) (-659.656) (-657.999) [-656.072] * (-658.668) (-660.242) (-657.796) [-657.615] -- 0:00:40
331500 -- (-656.761) (-658.292) [-657.939] (-658.091) * [-657.469] (-657.064) (-662.651) (-657.176) -- 0:00:42
332000 -- (-659.590) (-657.272) (-657.654) [-656.369] * (-655.726) (-657.362) (-657.785) [-656.085] -- 0:00:42
332500 -- (-657.805) (-658.935) (-657.148) [-655.455] * (-658.653) (-657.155) [-657.392] (-655.742) -- 0:00:42
333000 -- (-657.231) [-656.264] (-659.838) (-655.925) * (-656.846) [-657.803] (-658.164) (-658.536) -- 0:00:42
333500 -- [-657.231] (-656.245) (-659.310) (-656.424) * (-656.328) [-659.728] (-658.067) (-657.011) -- 0:00:41
334000 -- (-656.799) (-660.311) [-658.109] (-658.783) * [-659.503] (-657.419) (-656.910) (-656.307) -- 0:00:41
334500 -- (-662.114) (-659.495) [-658.279] (-656.451) * (-660.617) (-656.437) (-657.202) [-656.966] -- 0:00:41
335000 -- (-661.094) [-656.946] (-657.437) (-656.424) * (-661.067) [-662.795] (-658.606) (-657.451) -- 0:00:41
Average standard deviation of split frequencies: 0.011306
335500 -- (-658.250) [-659.404] (-660.854) (-658.576) * (-659.048) (-662.502) (-662.706) [-659.283] -- 0:00:41
336000 -- [-661.202] (-660.280) (-658.659) (-656.061) * (-657.742) (-662.143) (-660.352) [-658.673] -- 0:00:41
336500 -- [-655.986] (-659.518) (-657.574) (-657.231) * [-657.801] (-664.704) (-661.443) (-656.606) -- 0:00:41
337000 -- (-655.992) (-656.486) [-656.011] (-660.967) * [-658.994] (-658.925) (-656.622) (-655.858) -- 0:00:41
337500 -- (-656.279) (-658.713) (-657.160) [-658.414] * (-659.920) (-663.657) (-657.393) [-656.132] -- 0:00:41
338000 -- (-659.433) (-657.320) (-657.996) [-658.712] * (-657.512) [-656.832] (-658.843) (-656.288) -- 0:00:41
338500 -- [-659.891] (-657.755) (-659.240) (-665.741) * (-660.776) [-656.502] (-661.557) (-656.132) -- 0:00:41
339000 -- (-659.232) [-657.036] (-662.264) (-659.658) * [-657.634] (-656.118) (-660.737) (-659.083) -- 0:00:40
339500 -- [-658.334] (-657.317) (-660.130) (-656.848) * (-656.795) [-656.103] (-659.832) (-657.075) -- 0:00:40
340000 -- (-658.038) (-656.797) (-660.288) [-656.759] * (-657.227) (-656.595) (-657.164) [-655.728] -- 0:00:40
Average standard deviation of split frequencies: 0.009768
340500 -- [-657.229] (-658.075) (-660.096) (-658.097) * (-656.022) [-655.741] (-658.980) (-657.473) -- 0:00:40
341000 -- (-655.435) (-657.713) (-656.854) [-659.296] * [-656.663] (-657.984) (-658.864) (-659.310) -- 0:00:40
341500 -- (-660.179) (-656.800) (-656.670) [-658.499] * (-657.199) (-657.960) [-661.599] (-657.491) -- 0:00:40
342000 -- (-660.576) (-661.728) [-657.162] (-655.418) * [-656.290] (-656.616) (-658.453) (-659.481) -- 0:00:40
342500 -- (-659.603) (-659.968) [-656.913] (-659.304) * [-656.150] (-657.027) (-661.094) (-661.478) -- 0:00:40
343000 -- (-660.427) (-657.560) [-658.084] (-655.957) * [-655.851] (-658.784) (-657.860) (-657.754) -- 0:00:40
343500 -- (-657.381) (-658.674) [-659.978] (-656.571) * (-657.922) (-661.073) (-659.045) [-661.058] -- 0:00:40
344000 -- (-659.591) (-657.242) (-660.854) [-656.479] * (-658.224) (-655.961) (-660.678) [-659.914] -- 0:00:40
344500 -- [-656.482] (-659.034) (-658.082) (-656.549) * (-661.333) [-656.175] (-657.999) (-659.537) -- 0:00:39
345000 -- [-658.849] (-657.232) (-660.349) (-657.449) * (-660.238) (-656.756) [-657.419] (-657.195) -- 0:00:39
Average standard deviation of split frequencies: 0.009617
345500 -- (-659.880) (-661.252) (-659.265) [-658.806] * (-658.729) (-656.198) (-658.020) [-658.461] -- 0:00:39
346000 -- (-657.250) (-658.794) [-657.462] (-659.027) * [-658.858] (-657.081) (-658.272) (-656.775) -- 0:00:39
346500 -- [-657.463] (-659.480) (-655.901) (-658.995) * (-657.158) (-658.926) [-658.261] (-656.608) -- 0:00:39
347000 -- (-657.727) (-659.853) [-656.914] (-659.163) * (-657.020) [-656.166] (-657.927) (-655.958) -- 0:00:39
347500 -- (-655.971) (-659.916) [-660.063] (-660.653) * (-656.559) (-657.661) [-656.345] (-657.698) -- 0:00:39
348000 -- (-657.530) (-655.685) [-656.115] (-658.647) * (-658.027) [-656.937] (-662.278) (-656.229) -- 0:00:39
348500 -- [-656.930] (-657.160) (-658.865) (-656.316) * [-660.824] (-656.374) (-657.741) (-660.703) -- 0:00:41
349000 -- (-656.079) (-658.036) [-657.686] (-659.574) * (-655.739) [-657.670] (-660.234) (-658.839) -- 0:00:41
349500 -- [-655.831] (-659.055) (-658.239) (-658.574) * [-657.815] (-657.752) (-656.622) (-658.817) -- 0:00:40
350000 -- (-657.223) (-657.152) (-659.251) [-655.887] * (-657.468) (-658.115) [-658.691] (-658.600) -- 0:00:40
Average standard deviation of split frequencies: 0.009964
350500 -- (-659.513) (-657.923) [-659.316] (-657.007) * (-656.359) [-660.495] (-656.048) (-656.882) -- 0:00:40
351000 -- (-663.349) [-658.864] (-657.712) (-656.142) * (-661.718) (-660.374) (-656.121) [-657.865] -- 0:00:40
351500 -- (-659.487) [-659.148] (-656.036) (-658.093) * (-657.674) [-659.310] (-656.196) (-658.964) -- 0:00:40
352000 -- [-658.876] (-663.439) (-657.579) (-662.201) * [-657.951] (-656.638) (-660.121) (-658.851) -- 0:00:40
352500 -- (-655.880) (-659.407) (-660.397) [-657.545] * (-659.544) (-658.727) (-656.221) [-658.249] -- 0:00:40
353000 -- [-659.972] (-657.821) (-657.320) (-657.358) * (-659.339) (-656.101) [-658.439] (-656.348) -- 0:00:40
353500 -- (-658.398) (-658.984) (-657.748) [-657.632] * (-658.323) (-658.307) (-656.497) [-659.556] -- 0:00:40
354000 -- (-656.011) (-661.327) (-657.509) [-659.571] * [-657.584] (-659.324) (-656.426) (-657.013) -- 0:00:40
354500 -- (-657.133) (-659.793) (-659.302) [-655.819] * (-657.930) [-657.415] (-656.781) (-656.891) -- 0:00:40
355000 -- [-658.982] (-656.688) (-658.162) (-657.823) * (-658.336) (-658.422) (-655.815) [-657.694] -- 0:00:39
Average standard deviation of split frequencies: 0.010515
355500 -- (-659.266) [-658.551] (-656.662) (-657.842) * (-657.049) [-657.035] (-656.506) (-663.716) -- 0:00:39
356000 -- (-656.616) (-659.933) [-656.746] (-656.671) * (-657.980) [-655.642] (-665.329) (-658.552) -- 0:00:39
356500 -- (-656.502) [-658.827] (-656.246) (-659.300) * (-657.576) (-655.816) (-662.690) [-657.990] -- 0:00:39
357000 -- (-657.729) (-658.991) (-658.150) [-657.944] * (-662.043) (-659.498) [-661.940] (-657.376) -- 0:00:39
357500 -- (-656.478) [-658.119] (-659.313) (-656.260) * (-657.926) (-657.574) [-657.268] (-656.481) -- 0:00:39
358000 -- (-659.136) (-656.374) (-658.767) [-656.756] * (-662.206) (-659.519) (-657.565) [-658.109] -- 0:00:39
358500 -- (-661.731) [-656.790] (-659.105) (-657.284) * (-660.445) (-662.626) [-658.170] (-660.192) -- 0:00:39
359000 -- (-657.749) (-657.669) (-655.817) [-658.564] * (-658.267) (-658.321) [-656.140] (-657.638) -- 0:00:39
359500 -- [-656.454] (-658.028) (-656.375) (-658.022) * (-659.596) (-657.313) [-656.117] (-656.936) -- 0:00:39
360000 -- [-656.358] (-660.455) (-658.920) (-655.755) * [-658.038] (-656.632) (-656.616) (-658.351) -- 0:00:39
Average standard deviation of split frequencies: 0.010994
360500 -- (-656.506) (-657.493) (-657.114) [-657.955] * (-661.635) (-661.116) [-657.878] (-661.284) -- 0:00:39
361000 -- (-658.308) [-656.685] (-657.265) (-661.071) * [-658.704] (-656.635) (-656.946) (-658.271) -- 0:00:38
361500 -- (-657.277) [-656.673] (-656.540) (-656.073) * [-656.851] (-656.805) (-657.298) (-656.037) -- 0:00:38
362000 -- (-656.567) (-656.162) [-659.518] (-656.488) * (-662.808) (-656.934) [-658.408] (-656.855) -- 0:00:38
362500 -- (-658.057) [-656.831] (-656.365) (-656.175) * (-658.697) (-656.621) (-661.134) [-660.474] -- 0:00:38
363000 -- [-657.425] (-656.381) (-655.566) (-656.756) * [-658.455] (-655.841) (-657.924) (-656.379) -- 0:00:38
363500 -- (-659.855) [-656.956] (-657.007) (-657.764) * (-658.558) (-656.956) [-658.140] (-657.587) -- 0:00:38
364000 -- (-658.369) (-658.449) [-660.114] (-655.886) * (-656.895) [-657.849] (-660.270) (-657.855) -- 0:00:38
364500 -- (-657.448) [-656.934] (-660.098) (-656.315) * (-658.597) (-656.330) (-656.225) [-656.093] -- 0:00:38
365000 -- [-658.521] (-658.066) (-656.247) (-658.735) * (-658.845) (-658.486) (-656.801) [-658.767] -- 0:00:38
Average standard deviation of split frequencies: 0.011137
365500 -- (-658.372) (-657.344) [-656.272] (-659.729) * (-659.518) [-657.817] (-661.105) (-656.815) -- 0:00:39
366000 -- (-658.035) (-657.003) [-656.926] (-656.747) * (-659.670) (-656.368) (-660.254) [-656.180] -- 0:00:39
366500 -- (-656.646) (-656.971) [-657.153] (-658.725) * [-656.035] (-657.683) (-658.898) (-655.634) -- 0:00:39
367000 -- [-658.430] (-656.117) (-660.686) (-658.253) * (-656.496) [-655.817] (-657.977) (-656.881) -- 0:00:39
367500 -- (-658.091) (-659.038) [-656.145] (-659.146) * (-656.465) [-657.588] (-662.537) (-657.605) -- 0:00:39
368000 -- [-658.660] (-658.128) (-658.230) (-660.976) * (-656.936) (-656.834) (-660.243) [-656.960] -- 0:00:39
368500 -- (-658.287) (-656.316) [-656.815] (-660.030) * (-657.628) (-658.706) [-660.695] (-659.221) -- 0:00:39
369000 -- (-660.142) (-657.326) (-658.460) [-658.099] * (-656.626) (-657.035) [-656.069] (-658.302) -- 0:00:39
369500 -- (-659.677) [-656.470] (-657.334) (-658.215) * (-657.754) [-657.169] (-655.792) (-658.734) -- 0:00:39
370000 -- (-657.910) [-656.829] (-658.329) (-657.933) * (-656.323) (-659.363) (-656.473) [-663.625] -- 0:00:39
Average standard deviation of split frequencies: 0.011296
370500 -- [-657.173] (-657.847) (-657.969) (-658.937) * (-657.598) (-657.480) (-659.656) [-657.232] -- 0:00:39
371000 -- (-660.183) (-658.520) [-657.792] (-656.346) * (-657.732) (-657.700) (-657.657) [-656.995] -- 0:00:38
371500 -- [-656.993] (-659.936) (-660.987) (-664.080) * [-658.160] (-657.611) (-659.380) (-657.141) -- 0:00:38
372000 -- (-656.652) (-659.066) (-659.315) [-657.330] * (-659.002) [-658.367] (-657.377) (-659.189) -- 0:00:38
372500 -- (-659.082) (-660.377) [-656.621] (-657.765) * (-656.195) (-656.854) (-657.867) [-661.168] -- 0:00:38
373000 -- (-657.179) (-657.674) (-660.561) [-662.453] * (-656.894) (-657.463) [-658.805] (-657.915) -- 0:00:38
373500 -- [-659.203] (-661.493) (-662.007) (-656.400) * (-665.188) (-656.540) [-662.140] (-658.404) -- 0:00:38
374000 -- (-662.990) (-659.397) (-659.580) [-658.015] * (-667.530) (-656.254) (-656.825) [-655.902] -- 0:00:38
374500 -- (-657.722) [-657.013] (-656.091) (-656.601) * (-661.508) (-658.174) [-658.950] (-657.620) -- 0:00:38
375000 -- (-659.031) [-661.296] (-657.484) (-660.014) * [-659.144] (-659.630) (-657.260) (-657.229) -- 0:00:38
Average standard deviation of split frequencies: 0.011726
375500 -- (-656.546) (-658.589) [-657.079] (-658.055) * (-658.652) (-664.462) (-657.187) [-657.166] -- 0:00:38
376000 -- (-658.541) [-656.591] (-656.905) (-656.355) * (-656.567) (-657.259) [-659.349] (-655.947) -- 0:00:38
376500 -- (-659.059) [-655.521] (-658.165) (-655.940) * (-656.951) [-657.183] (-657.763) (-657.104) -- 0:00:38
377000 -- (-659.062) (-660.969) (-658.202) [-658.660] * (-657.844) (-655.902) [-656.486] (-657.133) -- 0:00:38
377500 -- (-658.781) [-659.104] (-660.575) (-658.679) * (-658.266) (-656.498) (-662.445) [-662.095] -- 0:00:37
378000 -- (-657.220) [-657.036] (-657.674) (-658.405) * (-660.855) (-658.315) (-658.559) [-657.167] -- 0:00:37
378500 -- (-658.318) (-657.476) (-657.366) [-661.069] * (-658.102) [-658.751] (-657.651) (-656.164) -- 0:00:37
379000 -- [-655.940] (-656.119) (-660.399) (-663.271) * (-657.852) (-656.799) [-657.606] (-657.393) -- 0:00:37
379500 -- (-657.118) (-656.271) (-657.438) [-657.780] * (-657.474) [-656.883] (-665.140) (-657.751) -- 0:00:37
380000 -- [-657.616] (-663.129) (-659.792) (-660.801) * (-659.945) (-658.775) [-656.258] (-657.350) -- 0:00:37
Average standard deviation of split frequencies: 0.013112
380500 -- [-661.644] (-659.441) (-660.783) (-658.338) * [-657.611] (-656.774) (-656.081) (-657.153) -- 0:00:37
381000 -- (-657.136) (-656.027) (-657.177) [-658.242] * (-658.493) [-658.683] (-657.606) (-657.475) -- 0:00:37
381500 -- [-658.204] (-664.094) (-658.450) (-657.118) * [-658.461] (-658.296) (-656.986) (-657.424) -- 0:00:37
382000 -- (-657.094) (-659.950) (-662.111) [-657.553] * [-660.117] (-660.574) (-658.235) (-656.524) -- 0:00:38
382500 -- (-656.419) (-658.935) (-658.678) [-655.520] * [-655.949] (-657.424) (-660.584) (-659.147) -- 0:00:38
383000 -- (-658.054) (-657.029) [-658.584] (-659.831) * [-657.278] (-656.950) (-663.742) (-657.426) -- 0:00:38
383500 -- (-658.556) (-655.566) [-658.592] (-655.648) * (-662.260) (-661.278) (-657.290) [-658.592] -- 0:00:38
384000 -- (-656.883) (-655.751) (-660.644) [-660.633] * (-660.200) [-662.526] (-659.261) (-656.766) -- 0:00:38
384500 -- (-658.137) (-655.751) [-657.873] (-656.017) * (-656.697) (-659.544) (-658.582) [-657.171] -- 0:00:38
385000 -- (-657.602) [-656.632] (-657.697) (-660.210) * (-657.294) (-659.879) (-659.974) [-657.212] -- 0:00:38
Average standard deviation of split frequencies: 0.013290
385500 -- (-656.862) [-657.871] (-659.573) (-656.112) * (-656.309) (-656.999) (-656.984) [-655.911] -- 0:00:38
386000 -- (-657.604) [-658.938] (-656.299) (-656.319) * (-656.194) (-658.587) (-656.426) [-656.708] -- 0:00:38
386500 -- [-659.061] (-656.526) (-660.720) (-656.117) * [-659.160] (-657.530) (-657.084) (-660.313) -- 0:00:38
387000 -- (-663.043) (-655.779) [-657.162] (-660.466) * (-664.493) (-663.024) [-656.592] (-658.814) -- 0:00:38
387500 -- (-657.152) [-656.799] (-656.749) (-657.291) * (-657.210) (-658.541) (-656.629) [-656.829] -- 0:00:37
388000 -- (-659.579) (-658.950) (-660.751) [-655.991] * (-655.791) (-659.533) [-657.796] (-657.354) -- 0:00:37
388500 -- (-658.560) (-659.635) (-663.717) [-656.922] * (-656.430) (-662.263) [-658.800] (-655.446) -- 0:00:37
389000 -- [-656.745] (-660.258) (-659.539) (-658.475) * (-657.518) (-659.598) [-657.625] (-655.823) -- 0:00:37
389500 -- [-663.043] (-662.754) (-658.216) (-658.179) * (-660.917) (-658.096) [-658.085] (-662.321) -- 0:00:37
390000 -- (-658.618) [-656.856] (-660.215) (-656.185) * (-658.354) (-657.107) [-657.585] (-656.481) -- 0:00:37
Average standard deviation of split frequencies: 0.012493
390500 -- (-663.136) (-657.407) (-657.604) [-655.909] * (-656.571) [-657.561] (-657.877) (-659.575) -- 0:00:37
391000 -- (-658.856) (-657.748) (-664.769) [-656.250] * [-656.258] (-657.516) (-658.328) (-659.226) -- 0:00:37
391500 -- (-658.057) (-657.544) [-659.655] (-658.801) * (-665.280) (-656.677) (-658.751) [-655.990] -- 0:00:37
392000 -- [-658.579] (-659.446) (-658.024) (-665.680) * (-666.891) (-656.427) (-656.787) [-656.845] -- 0:00:37
392500 -- (-656.103) [-656.304] (-657.642) (-658.205) * (-662.102) (-657.800) (-656.442) [-657.467] -- 0:00:37
393000 -- (-657.373) (-656.231) (-658.804) [-657.740] * [-659.169] (-658.862) (-661.193) (-659.459) -- 0:00:37
393500 -- [-659.098] (-659.542) (-656.688) (-658.724) * [-660.239] (-659.073) (-656.247) (-656.919) -- 0:00:36
394000 -- [-656.979] (-659.042) (-655.673) (-658.389) * (-658.754) [-656.408] (-659.491) (-658.983) -- 0:00:36
394500 -- (-657.138) (-656.545) (-658.651) [-658.102] * (-658.147) (-657.228) (-657.397) [-657.837] -- 0:00:36
395000 -- (-661.101) (-660.352) [-660.384] (-656.466) * (-658.100) (-655.473) (-663.765) [-656.356] -- 0:00:36
Average standard deviation of split frequencies: 0.013585
395500 -- (-656.138) (-662.944) (-656.837) [-657.974] * (-657.385) (-655.711) [-660.350] (-657.583) -- 0:00:36
396000 -- [-656.823] (-659.289) (-656.122) (-655.796) * (-657.584) (-657.011) [-656.928] (-656.450) -- 0:00:36
396500 -- (-656.205) (-657.375) [-655.462] (-660.577) * (-662.623) [-655.982] (-659.610) (-658.760) -- 0:00:36
397000 -- (-657.916) (-657.657) [-661.339] (-661.861) * (-658.296) [-656.942] (-661.172) (-656.542) -- 0:00:36
397500 -- (-657.314) [-656.363] (-661.519) (-658.335) * (-656.002) (-657.876) (-656.801) [-662.339] -- 0:00:36
398000 -- (-657.205) [-659.450] (-662.647) (-665.219) * [-658.747] (-656.330) (-656.926) (-664.854) -- 0:00:36
398500 -- [-658.413] (-658.047) (-662.555) (-661.964) * (-661.448) (-656.724) [-656.791] (-659.148) -- 0:00:36
399000 -- [-658.421] (-655.940) (-664.518) (-661.140) * [-656.241] (-658.091) (-657.668) (-658.246) -- 0:00:37
399500 -- (-656.512) [-657.815] (-660.637) (-659.484) * [-660.194] (-659.846) (-659.040) (-658.613) -- 0:00:37
400000 -- (-658.277) (-657.737) (-658.233) [-660.137] * [-656.064] (-661.371) (-656.992) (-656.389) -- 0:00:37
Average standard deviation of split frequencies: 0.013288
400500 -- (-656.690) (-657.548) (-658.242) [-655.593] * (-658.433) [-658.559] (-657.668) (-656.067) -- 0:00:37
401000 -- (-656.530) (-661.506) (-657.390) [-656.254] * (-658.334) (-659.175) (-657.816) [-656.075] -- 0:00:37
401500 -- (-656.029) (-659.507) [-657.448] (-657.002) * (-655.509) (-658.033) [-657.551] (-656.035) -- 0:00:37
402000 -- (-657.721) (-659.122) [-656.970] (-661.859) * (-656.429) [-657.819] (-656.437) (-655.835) -- 0:00:37
402500 -- (-655.804) (-660.832) [-660.006] (-657.572) * [-655.669] (-658.160) (-658.061) (-655.777) -- 0:00:37
403000 -- (-656.667) (-659.602) [-661.450] (-656.254) * [-656.289] (-656.146) (-658.364) (-658.646) -- 0:00:37
403500 -- (-657.443) [-657.267] (-658.116) (-656.422) * [-656.589] (-659.930) (-660.027) (-656.215) -- 0:00:36
404000 -- (-657.195) [-656.526] (-656.827) (-658.379) * (-657.266) [-659.741] (-658.930) (-660.363) -- 0:00:36
404500 -- (-655.881) (-656.133) [-660.175] (-660.404) * (-655.957) (-661.219) [-658.368] (-657.983) -- 0:00:36
405000 -- [-655.870] (-658.310) (-658.612) (-655.537) * (-658.311) [-660.804] (-658.621) (-656.283) -- 0:00:36
Average standard deviation of split frequencies: 0.013114
405500 -- (-658.556) (-655.942) [-657.692] (-657.738) * [-657.804] (-659.192) (-656.067) (-659.422) -- 0:00:36
406000 -- (-658.761) (-656.095) [-656.330] (-658.698) * (-656.247) [-657.754] (-657.059) (-659.277) -- 0:00:36
406500 -- [-661.981] (-661.596) (-657.124) (-659.743) * (-659.138) (-656.924) [-656.566] (-660.443) -- 0:00:36
407000 -- (-659.956) (-656.910) (-661.727) [-657.823] * (-656.439) [-655.997] (-661.820) (-656.542) -- 0:00:36
407500 -- (-659.914) [-656.340] (-664.106) (-660.250) * [-656.425] (-659.190) (-657.637) (-657.119) -- 0:00:36
408000 -- (-657.095) (-656.014) (-660.146) [-657.553] * (-656.437) (-660.500) (-657.811) [-659.437] -- 0:00:36
408500 -- (-657.399) (-659.902) (-657.916) [-656.929] * (-656.755) (-660.748) (-659.053) [-659.730] -- 0:00:36
409000 -- (-656.499) (-660.429) [-657.983] (-656.886) * [-657.236] (-657.033) (-660.035) (-659.810) -- 0:00:36
409500 -- (-657.866) (-656.199) (-656.440) [-656.686] * (-657.807) [-656.508] (-660.681) (-657.247) -- 0:00:36
410000 -- (-659.363) (-657.293) [-657.712] (-658.483) * (-661.757) (-657.525) [-657.900] (-658.826) -- 0:00:35
Average standard deviation of split frequencies: 0.013775
410500 -- [-658.082] (-658.070) (-657.047) (-657.767) * (-659.166) (-658.582) [-658.491] (-656.703) -- 0:00:35
411000 -- (-659.488) [-659.822] (-656.151) (-659.747) * (-656.477) [-656.781] (-658.513) (-661.317) -- 0:00:35
411500 -- (-663.315) [-661.370] (-656.671) (-657.470) * (-657.964) (-657.848) [-656.865] (-658.206) -- 0:00:35
412000 -- (-656.979) [-659.475] (-657.680) (-659.850) * (-657.144) [-658.140] (-656.738) (-656.370) -- 0:00:35
412500 -- [-656.230] (-658.215) (-661.831) (-660.474) * [-657.955] (-658.974) (-658.533) (-657.028) -- 0:00:35
413000 -- (-658.604) (-658.714) (-661.347) [-657.498] * (-660.030) (-659.797) (-656.865) [-657.985] -- 0:00:35
413500 -- (-657.785) [-658.841] (-658.138) (-657.793) * (-659.446) [-659.356] (-655.458) (-659.993) -- 0:00:35
414000 -- (-657.068) (-656.883) [-656.544] (-657.856) * [-657.233] (-660.268) (-657.827) (-659.033) -- 0:00:35
414500 -- (-656.063) (-657.073) [-662.861] (-662.030) * (-656.904) (-657.906) [-662.418] (-658.850) -- 0:00:35
415000 -- (-655.853) (-660.479) [-661.445] (-664.693) * (-660.789) (-656.970) [-657.125] (-659.181) -- 0:00:35
Average standard deviation of split frequencies: 0.013265
415500 -- [-657.899] (-658.038) (-656.293) (-658.559) * (-658.368) (-657.573) [-659.853] (-657.102) -- 0:00:36
416000 -- [-657.768] (-657.995) (-657.733) (-657.257) * [-657.618] (-658.514) (-656.739) (-656.902) -- 0:00:36
416500 -- (-659.460) (-660.554) [-657.300] (-656.386) * (-658.976) [-657.352] (-657.221) (-660.744) -- 0:00:36
417000 -- (-657.409) [-657.662] (-658.932) (-659.885) * (-658.561) (-658.328) [-657.623] (-659.126) -- 0:00:36
417500 -- (-656.901) (-659.351) [-658.379] (-658.329) * [-656.390] (-657.907) (-656.656) (-659.925) -- 0:00:36
418000 -- (-660.804) (-658.687) [-655.816] (-658.924) * (-656.593) (-659.051) (-656.493) [-656.980] -- 0:00:36
418500 -- (-656.465) [-658.955] (-656.017) (-656.075) * (-656.692) (-660.533) [-657.537] (-656.749) -- 0:00:36
419000 -- (-656.405) (-658.306) [-658.157] (-655.846) * (-660.592) (-658.133) [-659.071] (-657.349) -- 0:00:36
419500 -- (-657.395) (-657.533) [-657.337] (-655.731) * (-658.254) [-660.519] (-659.350) (-660.353) -- 0:00:35
420000 -- (-658.761) (-659.292) (-656.313) [-656.830] * (-658.774) [-659.095] (-656.462) (-656.174) -- 0:00:35
Average standard deviation of split frequencies: 0.013975
420500 -- (-658.116) (-657.955) (-655.739) [-655.943] * (-658.017) (-659.608) (-657.209) [-658.408] -- 0:00:35
421000 -- (-660.509) [-660.423] (-658.703) (-659.621) * (-657.549) (-657.768) (-658.366) [-657.445] -- 0:00:35
421500 -- (-659.945) (-658.097) [-656.596] (-665.277) * (-657.916) (-656.134) (-661.443) [-656.442] -- 0:00:35
422000 -- (-656.150) (-659.200) [-657.209] (-658.676) * [-656.905] (-658.022) (-660.426) (-657.500) -- 0:00:35
422500 -- (-656.851) [-656.170] (-659.315) (-656.482) * (-659.705) (-658.766) [-661.823] (-656.720) -- 0:00:35
423000 -- [-657.369] (-658.698) (-658.121) (-658.813) * [-658.672] (-660.929) (-657.402) (-657.599) -- 0:00:35
423500 -- (-658.023) (-656.952) [-656.088] (-659.074) * (-658.387) (-655.854) (-658.375) [-656.276] -- 0:00:35
424000 -- (-662.905) (-662.277) [-658.034] (-656.250) * [-657.660] (-657.370) (-664.796) (-658.058) -- 0:00:35
424500 -- (-662.052) (-659.403) [-656.640] (-657.244) * [-657.563] (-656.238) (-664.782) (-660.431) -- 0:00:35
425000 -- (-656.246) (-660.510) [-658.169] (-657.705) * (-661.663) [-660.769] (-658.636) (-660.868) -- 0:00:35
Average standard deviation of split frequencies: 0.013800
425500 -- (-657.210) (-657.750) [-659.416] (-658.311) * (-661.233) [-658.104] (-658.234) (-659.252) -- 0:00:35
426000 -- (-661.863) [-655.980] (-656.798) (-656.358) * (-660.120) (-660.969) (-659.643) [-658.373] -- 0:00:35
426500 -- (-657.887) (-660.329) [-661.557] (-658.621) * (-658.429) [-658.687] (-665.126) (-658.321) -- 0:00:34
427000 -- (-657.873) (-661.623) (-657.447) [-655.540] * [-658.158] (-657.087) (-657.791) (-658.507) -- 0:00:34
427500 -- (-657.004) (-658.436) [-659.522] (-656.469) * (-655.469) (-658.993) (-656.884) [-656.701] -- 0:00:34
428000 -- [-657.549] (-657.501) (-662.504) (-656.949) * [-655.833] (-663.248) (-657.321) (-657.664) -- 0:00:34
428500 -- (-659.916) (-656.917) (-655.976) [-655.710] * (-657.264) (-657.583) (-658.379) [-659.164] -- 0:00:34
429000 -- [-661.997] (-662.964) (-661.954) (-657.385) * (-657.767) (-658.070) (-657.828) [-656.722] -- 0:00:34
429500 -- (-663.021) [-658.096] (-658.246) (-659.473) * (-656.576) (-656.832) [-659.530] (-657.697) -- 0:00:34
430000 -- [-659.660] (-657.917) (-662.219) (-658.340) * (-663.440) [-656.070] (-656.539) (-660.320) -- 0:00:34
Average standard deviation of split frequencies: 0.013650
430500 -- [-656.065] (-657.685) (-657.110) (-661.421) * (-659.597) (-658.339) [-657.700] (-657.078) -- 0:00:34
431000 -- (-658.057) [-657.013] (-659.048) (-659.719) * (-657.115) [-656.355] (-656.689) (-656.334) -- 0:00:34
431500 -- (-656.587) (-656.648) [-657.951] (-657.922) * (-657.172) [-661.080] (-655.938) (-656.241) -- 0:00:34
432000 -- [-656.552] (-659.653) (-657.066) (-659.364) * (-657.507) (-656.661) [-655.931] (-656.945) -- 0:00:34
432500 -- (-659.641) [-657.491] (-655.936) (-662.077) * (-656.493) (-656.228) (-656.429) [-656.910] -- 0:00:35
433000 -- (-656.894) (-656.591) [-658.556] (-662.900) * (-658.228) [-659.358] (-660.401) (-657.159) -- 0:00:35
433500 -- (-656.605) (-656.936) [-657.225] (-659.152) * (-664.618) (-658.779) [-655.806] (-660.417) -- 0:00:35
434000 -- (-658.967) [-657.357] (-658.363) (-659.507) * (-662.700) [-655.737] (-657.251) (-660.083) -- 0:00:35
434500 -- (-655.921) (-657.242) (-657.010) [-656.619] * (-658.239) [-658.210] (-655.704) (-657.350) -- 0:00:35
435000 -- (-656.489) [-656.737] (-657.321) (-657.717) * [-660.804] (-657.099) (-655.936) (-658.054) -- 0:00:35
Average standard deviation of split frequencies: 0.013356
435500 -- [-656.376] (-656.950) (-656.978) (-656.924) * [-657.898] (-655.692) (-659.429) (-657.568) -- 0:00:34
436000 -- [-657.458] (-656.960) (-661.046) (-658.085) * (-657.611) (-657.029) (-656.949) [-656.705] -- 0:00:34
436500 -- (-657.108) [-657.001] (-660.138) (-658.751) * (-656.962) (-656.526) [-657.763] (-656.058) -- 0:00:34
437000 -- [-657.618] (-657.145) (-658.405) (-658.950) * (-663.034) (-659.161) (-657.501) [-657.069] -- 0:00:34
437500 -- [-656.949] (-657.818) (-657.955) (-657.304) * (-656.673) (-657.967) (-656.621) [-659.536] -- 0:00:34
438000 -- (-656.525) [-658.023] (-657.059) (-658.746) * (-655.823) (-659.586) [-659.171] (-657.189) -- 0:00:34
438500 -- [-657.157] (-659.649) (-658.486) (-658.048) * (-658.424) (-658.991) [-661.018] (-656.264) -- 0:00:34
439000 -- (-657.360) (-660.266) (-658.388) [-659.341] * (-658.783) (-658.015) [-657.313] (-657.071) -- 0:00:34
439500 -- (-658.056) (-660.890) (-658.478) [-660.703] * [-657.072] (-656.108) (-656.451) (-657.450) -- 0:00:34
440000 -- (-657.836) (-657.815) [-658.090] (-659.810) * (-656.879) (-661.730) (-656.908) [-657.974] -- 0:00:34
Average standard deviation of split frequencies: 0.013529
440500 -- (-657.549) [-656.265] (-659.560) (-655.671) * (-658.629) (-656.167) (-660.981) [-662.092] -- 0:00:34
441000 -- (-655.847) [-658.220] (-661.713) (-656.092) * (-660.998) (-655.679) [-656.519] (-659.814) -- 0:00:34
441500 -- (-657.958) (-656.443) (-658.152) [-659.518] * [-658.803] (-655.790) (-656.509) (-656.602) -- 0:00:34
442000 -- [-657.978] (-658.054) (-656.985) (-660.900) * (-658.259) [-657.669] (-658.270) (-660.448) -- 0:00:34
442500 -- (-662.889) (-658.050) (-659.588) [-660.042] * (-657.896) (-656.870) (-658.683) [-660.471] -- 0:00:34
443000 -- [-659.890] (-659.829) (-659.002) (-658.241) * (-656.814) (-655.890) [-656.518] (-659.467) -- 0:00:33
443500 -- (-655.807) [-657.478] (-657.493) (-658.628) * (-657.050) (-660.768) [-656.642] (-658.386) -- 0:00:33
444000 -- (-658.006) (-657.948) (-656.747) [-662.051] * (-656.106) (-656.723) [-660.187] (-658.119) -- 0:00:33
444500 -- (-657.914) [-657.250] (-658.835) (-659.290) * (-657.029) (-657.827) [-659.640] (-659.070) -- 0:00:33
445000 -- [-661.923] (-661.379) (-657.359) (-656.392) * [-656.740] (-657.845) (-659.127) (-664.583) -- 0:00:33
Average standard deviation of split frequencies: 0.013554
445500 -- [-661.645] (-656.568) (-655.822) (-656.731) * [-661.955] (-657.004) (-660.948) (-665.370) -- 0:00:33
446000 -- (-659.619) (-660.148) (-658.392) [-657.787] * [-657.666] (-660.987) (-657.679) (-658.817) -- 0:00:33
446500 -- (-657.974) (-658.717) (-656.384) [-659.320] * (-659.582) (-655.718) [-656.345] (-656.311) -- 0:00:33
447000 -- (-656.959) (-657.270) (-657.266) [-655.666] * (-656.059) (-659.281) [-656.457] (-657.069) -- 0:00:33
447500 -- (-657.402) [-658.813] (-657.962) (-661.323) * (-657.267) (-657.187) [-656.973] (-662.005) -- 0:00:33
448000 -- (-656.382) (-657.541) (-656.574) [-655.569] * (-659.092) (-658.689) (-658.636) [-655.980] -- 0:00:33
448500 -- [-658.778] (-656.606) (-656.788) (-657.759) * (-656.942) (-656.008) [-657.474] (-659.491) -- 0:00:33
449000 -- (-659.487) [-656.303] (-657.853) (-657.937) * [-658.811] (-661.217) (-657.585) (-658.256) -- 0:00:33
449500 -- (-659.742) [-657.911] (-656.267) (-656.365) * [-656.516] (-662.210) (-657.711) (-662.809) -- 0:00:34
450000 -- (-658.178) (-658.279) [-657.230] (-657.123) * (-656.681) (-661.862) [-658.305] (-659.121) -- 0:00:34
Average standard deviation of split frequencies: 0.013537
450500 -- [-660.356] (-658.069) (-657.034) (-657.282) * (-659.064) (-659.706) (-658.496) [-658.807] -- 0:00:34
451000 -- (-659.462) (-656.918) (-657.716) [-657.052] * (-659.226) [-657.563] (-658.415) (-656.752) -- 0:00:34
451500 -- (-657.417) [-656.995] (-657.514) (-657.358) * (-657.075) (-657.822) [-658.457] (-657.401) -- 0:00:34
452000 -- (-660.071) [-656.145] (-657.501) (-665.721) * (-658.247) (-657.752) (-656.578) [-655.717] -- 0:00:33
452500 -- [-657.937] (-655.498) (-662.662) (-658.804) * (-657.558) (-661.514) [-656.343] (-662.278) -- 0:00:33
453000 -- (-655.678) (-659.044) [-656.188] (-657.775) * (-658.159) (-657.716) [-659.313] (-658.395) -- 0:00:33
453500 -- (-657.239) (-657.429) (-657.615) [-659.017] * (-656.739) [-657.044] (-657.402) (-657.041) -- 0:00:33
454000 -- (-656.516) (-657.316) (-659.604) [-659.043] * (-657.294) [-659.042] (-657.441) (-658.624) -- 0:00:33
454500 -- (-658.606) (-661.001) [-656.060] (-657.743) * (-657.082) (-657.537) (-658.293) [-661.339] -- 0:00:33
455000 -- (-656.533) (-659.808) [-656.141] (-660.506) * [-657.485] (-658.311) (-661.123) (-657.639) -- 0:00:33
Average standard deviation of split frequencies: 0.013378
455500 -- [-656.992] (-656.457) (-656.522) (-656.157) * (-660.017) (-658.416) [-659.111] (-656.499) -- 0:00:33
456000 -- (-657.493) [-656.245] (-658.963) (-656.102) * (-657.760) (-656.315) (-656.100) [-657.081] -- 0:00:33
456500 -- (-658.004) (-657.675) [-657.275] (-658.624) * (-658.715) (-657.285) [-655.813] (-656.762) -- 0:00:33
457000 -- (-658.454) (-658.478) [-657.375] (-661.595) * [-655.939] (-657.110) (-658.742) (-662.098) -- 0:00:33
457500 -- (-659.310) (-660.301) (-656.771) [-657.235] * (-657.305) (-656.970) (-656.053) [-658.015] -- 0:00:33
458000 -- [-656.512] (-658.339) (-655.891) (-661.628) * [-658.238] (-660.138) (-656.772) (-655.741) -- 0:00:33
458500 -- (-656.480) (-657.832) [-656.106] (-661.235) * (-659.488) (-656.137) (-656.049) [-656.252] -- 0:00:33
459000 -- (-658.735) (-656.093) (-658.066) [-657.803] * (-659.810) (-657.841) (-657.886) [-656.176] -- 0:00:33
459500 -- (-662.008) (-662.038) (-657.267) [-661.020] * (-660.396) (-656.323) (-658.041) [-655.508] -- 0:00:32
460000 -- (-660.903) (-659.763) (-657.971) [-655.596] * (-660.280) (-656.449) [-660.182] (-658.089) -- 0:00:32
Average standard deviation of split frequencies: 0.014086
460500 -- (-657.475) (-664.810) [-658.568] (-657.191) * (-656.378) (-659.517) (-656.840) [-657.298] -- 0:00:32
461000 -- (-656.664) [-659.334] (-656.823) (-658.908) * (-656.582) (-656.200) (-656.920) [-660.162] -- 0:00:32
461500 -- [-657.550] (-658.577) (-656.030) (-659.179) * (-656.548) (-657.739) (-660.746) [-658.080] -- 0:00:32
462000 -- [-656.589] (-658.838) (-657.079) (-660.846) * (-656.695) [-657.080] (-657.731) (-657.087) -- 0:00:32
462500 -- [-656.173] (-657.209) (-663.136) (-658.129) * (-661.692) [-656.804] (-657.340) (-657.134) -- 0:00:32
463000 -- [-658.052] (-658.219) (-658.445) (-660.140) * (-661.070) (-658.747) (-657.224) [-657.525] -- 0:00:32
463500 -- (-657.054) [-655.964] (-658.056) (-659.091) * (-658.106) (-657.198) [-658.760] (-657.517) -- 0:00:32
464000 -- (-658.115) (-659.527) [-657.349] (-658.945) * [-657.181] (-658.617) (-656.519) (-657.293) -- 0:00:32
464500 -- [-656.777] (-657.967) (-656.805) (-658.174) * (-659.971) (-660.291) [-656.169] (-660.133) -- 0:00:32
465000 -- (-656.170) (-657.056) [-657.338] (-657.576) * (-660.701) (-657.658) [-659.054] (-658.782) -- 0:00:32
Average standard deviation of split frequencies: 0.013881
465500 -- (-659.141) (-655.948) (-659.293) [-660.939] * (-657.220) (-658.330) (-658.954) [-657.821] -- 0:00:32
466000 -- (-657.957) (-659.297) [-658.152] (-658.955) * (-660.532) [-657.217] (-657.098) (-658.608) -- 0:00:32
466500 -- (-658.815) [-657.064] (-656.754) (-658.966) * [-658.276] (-656.427) (-658.790) (-657.190) -- 0:00:33
467000 -- (-657.054) [-657.870] (-657.173) (-664.355) * (-659.328) [-658.078] (-657.847) (-659.450) -- 0:00:33
467500 -- (-656.692) [-658.340] (-657.010) (-661.205) * (-661.228) [-656.293] (-657.039) (-657.805) -- 0:00:33
468000 -- [-656.565] (-659.530) (-657.059) (-656.378) * (-662.341) [-660.912] (-657.210) (-662.703) -- 0:00:32
468500 -- (-656.694) (-660.504) [-656.438] (-659.389) * [-662.516] (-658.161) (-658.186) (-657.532) -- 0:00:32
469000 -- (-660.452) [-656.774] (-656.119) (-658.852) * (-656.821) [-656.644] (-658.352) (-659.166) -- 0:00:32
469500 -- (-657.585) [-656.473] (-657.792) (-660.663) * [-659.874] (-662.827) (-663.245) (-656.046) -- 0:00:32
470000 -- [-659.234] (-657.154) (-656.835) (-657.382) * (-657.103) [-656.867] (-656.647) (-657.060) -- 0:00:32
Average standard deviation of split frequencies: 0.013374
470500 -- (-659.513) (-658.174) (-657.599) [-657.532] * (-658.818) (-655.605) [-657.500] (-656.511) -- 0:00:32
471000 -- (-656.872) (-660.168) [-656.578] (-659.334) * (-659.146) [-657.092] (-659.123) (-661.726) -- 0:00:32
471500 -- [-656.777] (-657.837) (-664.617) (-661.817) * [-658.824] (-657.273) (-662.357) (-656.855) -- 0:00:32
472000 -- (-661.119) (-660.222) [-661.284] (-658.882) * [-658.844] (-656.559) (-657.909) (-658.437) -- 0:00:32
472500 -- (-655.766) [-659.763] (-663.416) (-658.900) * (-663.541) [-657.504] (-658.718) (-657.258) -- 0:00:32
473000 -- (-656.540) (-655.698) [-658.184] (-657.882) * (-657.978) [-656.804] (-656.460) (-655.912) -- 0:00:32
473500 -- [-656.847] (-656.718) (-663.786) (-660.884) * (-660.672) (-659.786) (-656.314) [-657.503] -- 0:00:32
474000 -- (-658.967) (-657.248) (-657.964) [-658.031] * [-663.242] (-660.161) (-659.564) (-656.952) -- 0:00:32
474500 -- [-656.678] (-657.169) (-660.226) (-657.865) * (-659.164) (-660.782) [-657.161] (-659.971) -- 0:00:32
475000 -- (-656.287) [-659.007] (-656.268) (-659.579) * (-661.329) (-656.186) [-658.910] (-660.665) -- 0:00:32
Average standard deviation of split frequencies: 0.012751
475500 -- (-663.905) (-663.418) [-655.780] (-656.414) * [-659.153] (-658.785) (-658.799) (-658.127) -- 0:00:31
476000 -- (-657.441) (-659.820) (-657.831) [-660.581] * [-657.684] (-659.848) (-658.704) (-656.394) -- 0:00:31
476500 -- (-657.091) (-655.693) (-656.225) [-656.764] * (-656.999) (-660.640) [-661.491] (-655.526) -- 0:00:31
477000 -- (-656.666) [-656.298] (-657.712) (-657.585) * (-658.789) [-660.099] (-659.934) (-657.150) -- 0:00:31
477500 -- [-657.452] (-656.555) (-657.745) (-656.510) * (-660.887) [-655.958] (-657.495) (-657.100) -- 0:00:31
478000 -- (-655.879) [-656.019] (-659.339) (-657.859) * (-657.453) (-657.716) (-656.235) [-656.681] -- 0:00:31
478500 -- [-655.842] (-659.035) (-659.484) (-657.296) * (-658.261) [-663.612] (-659.530) (-655.587) -- 0:00:31
479000 -- (-658.924) [-658.967] (-658.706) (-655.755) * (-658.549) [-657.682] (-660.005) (-663.214) -- 0:00:31
479500 -- (-660.131) (-659.960) (-658.327) [-658.287] * (-657.659) [-655.711] (-664.510) (-657.140) -- 0:00:31
480000 -- (-660.671) (-660.341) (-658.154) [-656.396] * (-662.978) (-656.164) (-659.781) [-659.111] -- 0:00:31
Average standard deviation of split frequencies: 0.012320
480500 -- [-659.940] (-664.895) (-657.700) (-657.391) * [-664.699] (-655.708) (-658.666) (-659.059) -- 0:00:31
481000 -- (-658.045) (-657.767) (-657.861) [-657.234] * (-661.041) [-656.167] (-658.530) (-658.005) -- 0:00:31
481500 -- [-656.917] (-657.740) (-657.333) (-661.958) * (-656.673) [-655.926] (-657.315) (-656.620) -- 0:00:31
482000 -- (-661.913) [-659.906] (-657.948) (-656.771) * [-656.585] (-655.955) (-657.455) (-657.456) -- 0:00:31
482500 -- (-660.830) (-657.980) [-656.991] (-657.010) * (-657.756) (-656.591) (-656.597) [-656.869] -- 0:00:31
483000 -- (-657.657) (-656.945) (-657.484) [-662.005] * (-658.479) (-657.637) (-657.815) [-660.280] -- 0:00:32
483500 -- (-657.019) [-658.048] (-658.120) (-656.061) * (-656.285) (-658.421) (-656.031) [-658.144] -- 0:00:32
484000 -- (-657.920) [-661.108] (-656.813) (-657.924) * (-655.904) [-655.964] (-656.564) (-661.524) -- 0:00:31
484500 -- (-656.762) (-659.100) (-655.984) [-655.944] * (-656.778) (-656.306) [-657.522] (-657.163) -- 0:00:31
485000 -- (-658.542) (-662.001) [-661.486] (-657.115) * (-657.256) (-657.553) [-658.792] (-656.092) -- 0:00:31
Average standard deviation of split frequencies: 0.012852
485500 -- (-656.923) (-660.419) [-659.367] (-657.134) * (-658.689) (-658.305) (-656.065) [-658.505] -- 0:00:31
486000 -- (-656.457) (-656.932) [-660.208] (-659.680) * (-659.332) (-658.944) (-656.642) [-657.499] -- 0:00:31
486500 -- (-658.975) (-656.532) (-659.013) [-656.190] * (-656.891) (-657.366) [-658.205] (-656.178) -- 0:00:31
487000 -- [-656.602] (-657.897) (-660.842) (-657.419) * (-657.001) [-655.383] (-658.800) (-657.097) -- 0:00:31
487500 -- [-656.736] (-662.434) (-657.655) (-656.783) * (-657.645) (-656.994) [-656.733] (-657.392) -- 0:00:31
488000 -- [-656.661] (-656.692) (-659.847) (-660.321) * (-660.242) [-656.948] (-658.627) (-657.340) -- 0:00:31
488500 -- (-655.668) (-655.799) [-657.395] (-657.210) * (-657.793) [-656.745] (-658.367) (-655.710) -- 0:00:31
489000 -- (-658.805) [-657.402] (-657.709) (-659.319) * (-662.395) (-657.065) (-659.247) [-657.365] -- 0:00:31
489500 -- (-657.426) (-656.773) (-660.285) [-660.052] * (-657.155) [-657.290] (-658.598) (-656.906) -- 0:00:31
490000 -- (-658.369) (-659.691) (-656.701) [-657.506] * (-657.308) (-662.935) [-658.969] (-655.851) -- 0:00:31
Average standard deviation of split frequencies: 0.012659
490500 -- (-657.847) (-658.065) (-658.695) [-655.620] * (-659.378) (-664.081) [-657.171] (-658.288) -- 0:00:31
491000 -- [-660.015] (-659.234) (-657.909) (-659.332) * (-657.609) [-657.401] (-657.737) (-657.258) -- 0:00:31
491500 -- (-659.571) [-658.005] (-658.550) (-660.246) * (-657.334) [-657.119] (-657.709) (-657.347) -- 0:00:31
492000 -- (-656.927) [-655.945] (-665.137) (-659.513) * (-659.342) (-659.796) (-657.035) [-657.806] -- 0:00:30
492500 -- (-658.521) [-661.813] (-659.062) (-660.008) * (-659.686) (-656.635) (-660.597) [-657.850] -- 0:00:30
493000 -- (-656.445) (-656.585) [-656.909] (-660.441) * (-656.996) [-658.074] (-658.010) (-659.395) -- 0:00:30
493500 -- (-656.533) (-657.655) [-657.371] (-656.624) * (-658.417) (-661.140) [-658.635] (-657.505) -- 0:00:30
494000 -- (-658.539) (-661.498) [-655.694] (-656.465) * [-656.435] (-660.086) (-657.131) (-656.400) -- 0:00:30
494500 -- (-657.554) (-662.433) [-659.182] (-661.625) * (-655.773) (-656.806) (-657.155) [-657.267] -- 0:00:30
495000 -- (-657.377) (-656.702) [-659.542] (-663.701) * [-656.398] (-659.424) (-660.162) (-657.293) -- 0:00:30
Average standard deviation of split frequencies: 0.012579
495500 -- (-657.784) (-662.337) (-657.083) [-659.968] * (-656.111) (-656.976) (-659.029) [-660.525] -- 0:00:30
496000 -- (-658.433) (-659.954) (-656.128) [-660.241] * (-657.209) (-655.921) [-656.953] (-656.494) -- 0:00:30
496500 -- [-656.611] (-657.272) (-660.022) (-658.586) * (-658.361) (-657.438) (-657.077) [-657.900] -- 0:00:30
497000 -- (-659.351) [-658.644] (-656.538) (-657.066) * [-656.511] (-657.902) (-657.338) (-658.985) -- 0:00:30
497500 -- (-659.028) (-657.936) [-659.388] (-660.267) * [-657.903] (-656.193) (-657.011) (-656.531) -- 0:00:30
498000 -- (-667.920) (-656.287) (-663.306) [-664.839] * (-656.289) (-658.140) (-659.276) [-659.172] -- 0:00:30
498500 -- (-658.824) (-662.008) [-656.565] (-661.450) * (-656.971) [-658.402] (-656.621) (-656.933) -- 0:00:30
499000 -- (-657.049) (-660.685) [-659.609] (-656.937) * (-656.791) [-656.638] (-659.864) (-657.960) -- 0:00:30
499500 -- (-660.121) (-659.155) [-658.005] (-657.157) * (-655.797) (-658.039) (-662.713) [-656.877] -- 0:00:30
500000 -- [-658.020] (-657.028) (-657.581) (-660.642) * (-658.432) (-659.800) [-656.315] (-656.273) -- 0:00:31
Average standard deviation of split frequencies: 0.012240
500500 -- (-659.221) (-660.782) (-659.708) [-659.078] * (-658.176) (-661.269) [-655.780] (-656.460) -- 0:00:30
501000 -- (-659.830) (-670.902) (-659.012) [-656.571] * [-658.192] (-661.327) (-659.097) (-656.071) -- 0:00:30
501500 -- [-657.420] (-659.663) (-663.023) (-656.571) * (-656.928) (-656.360) (-659.062) [-655.764] -- 0:00:30
502000 -- (-656.640) [-658.132] (-658.950) (-657.276) * (-656.648) (-661.485) [-658.158] (-656.865) -- 0:00:30
502500 -- (-657.976) (-656.906) (-659.519) [-656.529] * [-657.740] (-657.014) (-658.631) (-666.782) -- 0:00:30
503000 -- (-656.526) (-656.960) (-656.877) [-658.530] * (-655.876) [-659.591] (-659.639) (-658.791) -- 0:00:30
503500 -- (-656.154) [-657.375] (-657.104) (-658.568) * [-655.970] (-659.739) (-658.465) (-656.740) -- 0:00:30
504000 -- (-658.215) (-656.150) (-656.430) [-658.960] * (-656.238) (-657.013) (-658.204) [-656.038] -- 0:00:30
504500 -- (-658.672) [-656.629] (-656.197) (-657.962) * (-655.733) [-657.719] (-660.754) (-658.592) -- 0:00:30
505000 -- (-658.327) [-656.158] (-657.815) (-656.004) * (-657.127) (-657.016) [-660.277] (-658.959) -- 0:00:30
Average standard deviation of split frequencies: 0.012111
505500 -- (-658.229) [-656.832] (-657.438) (-656.329) * (-660.698) (-655.758) (-659.204) [-655.949] -- 0:00:30
506000 -- [-660.655] (-657.782) (-658.278) (-656.580) * (-663.574) (-656.244) (-659.810) [-657.666] -- 0:00:30
506500 -- (-658.437) (-656.936) (-658.842) [-656.838] * (-658.944) (-659.062) [-657.742] (-658.279) -- 0:00:30
507000 -- [-655.965] (-656.229) (-656.168) (-656.615) * (-658.573) (-659.095) [-657.468] (-657.238) -- 0:00:30
507500 -- (-657.860) (-656.282) [-656.756] (-656.375) * (-661.068) (-661.122) [-656.998] (-658.327) -- 0:00:30
508000 -- (-662.602) [-657.164] (-657.783) (-657.019) * (-656.726) (-659.908) (-657.742) [-656.506] -- 0:00:30
508500 -- (-660.396) (-661.226) [-655.665] (-657.455) * (-657.437) [-657.747] (-660.499) (-656.629) -- 0:00:29
509000 -- [-656.486] (-662.658) (-660.785) (-657.501) * (-657.659) (-657.111) (-660.332) [-656.596] -- 0:00:29
509500 -- (-657.064) [-656.875] (-660.214) (-655.420) * [-656.548] (-657.516) (-656.953) (-659.897) -- 0:00:29
510000 -- (-657.302) [-656.017] (-660.721) (-655.690) * (-658.292) [-656.012] (-659.712) (-657.673) -- 0:00:29
Average standard deviation of split frequencies: 0.012218
510500 -- (-659.668) [-655.710] (-656.332) (-655.941) * (-656.370) [-655.863] (-656.371) (-656.581) -- 0:00:29
511000 -- [-657.551] (-656.094) (-658.127) (-656.356) * (-656.996) (-656.208) (-656.089) [-656.230] -- 0:00:29
511500 -- (-657.793) [-657.584] (-658.343) (-661.728) * [-657.408] (-659.263) (-656.780) (-659.380) -- 0:00:29
512000 -- [-656.635] (-656.705) (-658.193) (-657.620) * [-659.144] (-659.459) (-656.968) (-659.008) -- 0:00:29
512500 -- [-657.689] (-657.397) (-656.237) (-657.653) * (-657.549) (-661.194) (-660.514) [-657.263] -- 0:00:29
513000 -- (-658.947) [-659.296] (-659.422) (-658.296) * (-659.745) (-658.601) [-659.575] (-657.026) -- 0:00:29
513500 -- (-657.066) [-658.614] (-659.129) (-661.804) * (-656.994) [-658.236] (-655.651) (-656.439) -- 0:00:29
514000 -- (-659.656) (-658.881) (-656.924) [-659.461] * [-659.560] (-661.301) (-660.595) (-656.019) -- 0:00:29
514500 -- (-658.402) (-659.529) (-660.839) [-658.143] * (-657.086) (-659.083) [-658.202] (-657.317) -- 0:00:29
515000 -- [-657.165] (-662.788) (-659.135) (-656.031) * (-658.427) (-657.394) [-656.545] (-658.368) -- 0:00:29
Average standard deviation of split frequencies: 0.012091
515500 -- (-657.036) (-660.144) (-656.619) [-659.618] * (-657.411) (-657.711) (-656.319) [-655.668] -- 0:00:29
516000 -- (-657.232) (-658.238) (-659.387) [-657.354] * (-657.523) [-655.840] (-655.866) (-659.403) -- 0:00:29
516500 -- [-661.940] (-657.358) (-659.068) (-662.091) * [-660.952] (-657.807) (-656.222) (-656.908) -- 0:00:29
517000 -- (-655.551) [-657.449] (-657.457) (-657.202) * [-656.069] (-656.358) (-658.617) (-659.365) -- 0:00:29
517500 -- (-656.751) (-657.973) (-659.439) [-659.781] * [-655.989] (-656.369) (-658.440) (-661.039) -- 0:00:29
518000 -- (-659.911) [-656.964] (-659.544) (-660.876) * (-656.010) (-657.647) (-658.029) [-658.479] -- 0:00:29
518500 -- [-656.263] (-657.281) (-657.096) (-662.103) * (-656.746) (-656.140) [-657.354] (-656.448) -- 0:00:29
519000 -- (-657.880) (-656.698) (-657.172) [-658.697] * (-656.508) (-657.373) (-657.097) [-656.939] -- 0:00:29
519500 -- [-660.086] (-656.402) (-657.131) (-660.841) * [-656.184] (-656.582) (-656.999) (-657.783) -- 0:00:29
520000 -- [-657.914] (-660.585) (-658.180) (-660.008) * (-657.432) (-658.317) (-656.956) [-656.810] -- 0:00:29
Average standard deviation of split frequencies: 0.012675
520500 -- (-662.279) [-656.704] (-656.878) (-658.547) * (-657.303) [-657.107] (-658.531) (-656.314) -- 0:00:29
521000 -- (-661.607) (-657.849) [-658.205] (-656.626) * [-658.729] (-658.793) (-658.062) (-658.769) -- 0:00:29
521500 -- (-659.596) [-657.296] (-657.426) (-658.002) * [-656.072] (-658.337) (-656.484) (-662.843) -- 0:00:29
522000 -- [-655.648] (-657.660) (-659.130) (-658.640) * (-656.505) (-663.002) (-656.718) [-657.679] -- 0:00:29
522500 -- (-658.680) (-658.950) (-657.697) [-656.733] * (-657.266) (-665.975) [-658.149] (-657.093) -- 0:00:29
523000 -- [-656.524] (-660.067) (-657.142) (-661.414) * [-656.112] (-665.340) (-659.888) (-658.245) -- 0:00:29
523500 -- (-656.119) (-661.255) [-657.277] (-657.228) * (-658.353) [-659.225] (-657.846) (-659.099) -- 0:00:29
524000 -- (-658.066) (-661.430) [-655.927] (-657.719) * [-655.806] (-657.571) (-657.955) (-658.703) -- 0:00:29
524500 -- (-656.772) [-660.322] (-657.290) (-657.155) * (-657.422) (-657.538) (-659.926) [-657.290] -- 0:00:29
525000 -- (-657.431) (-658.633) (-658.451) [-656.926] * (-660.032) [-657.378] (-656.106) (-656.761) -- 0:00:28
Average standard deviation of split frequencies: 0.012231
525500 -- (-659.840) [-655.934] (-658.970) (-655.931) * [-658.762] (-656.297) (-657.276) (-656.865) -- 0:00:28
526000 -- (-658.830) (-657.118) (-655.785) [-656.301] * [-656.820] (-658.996) (-659.033) (-657.919) -- 0:00:28
526500 -- (-658.614) (-657.004) (-656.217) [-658.689] * [-660.353] (-661.556) (-658.010) (-658.487) -- 0:00:28
527000 -- (-656.269) [-656.385] (-656.290) (-658.062) * [-661.011] (-657.165) (-658.327) (-663.616) -- 0:00:28
527500 -- (-660.517) (-657.442) (-657.069) [-658.390] * [-659.405] (-665.607) (-660.915) (-659.929) -- 0:00:28
528000 -- (-656.489) (-660.183) (-656.366) [-658.348] * (-656.203) (-658.405) (-658.931) [-659.075] -- 0:00:28
528500 -- (-658.163) [-657.593] (-657.062) (-658.685) * (-658.092) (-658.247) (-657.829) [-660.475] -- 0:00:28
529000 -- (-657.425) [-660.555] (-658.443) (-656.814) * (-656.635) [-657.779] (-656.242) (-660.048) -- 0:00:28
529500 -- (-659.383) [-656.300] (-657.157) (-656.710) * (-658.094) (-657.656) (-658.490) [-656.946] -- 0:00:28
530000 -- [-655.596] (-655.984) (-658.319) (-656.180) * (-657.337) (-659.200) [-655.798] (-658.478) -- 0:00:28
Average standard deviation of split frequencies: 0.012239
530500 -- (-655.783) [-656.768] (-656.792) (-660.481) * (-659.126) [-659.858] (-655.450) (-660.284) -- 0:00:28
531000 -- (-656.305) [-656.189] (-660.689) (-658.865) * (-662.330) (-659.070) (-656.898) [-658.206] -- 0:00:28
531500 -- (-656.586) (-660.727) [-661.469] (-659.015) * (-661.370) (-660.153) [-657.005] (-657.270) -- 0:00:28
532000 -- (-660.331) (-656.978) (-659.124) [-656.597] * (-658.817) (-659.840) [-658.508] (-659.361) -- 0:00:28
532500 -- (-655.786) (-658.904) [-659.828] (-659.663) * (-664.844) (-657.874) (-658.050) [-655.842] -- 0:00:28
533000 -- (-657.483) [-658.025] (-658.263) (-660.835) * (-664.254) (-658.674) [-656.183] (-657.944) -- 0:00:28
533500 -- (-660.641) [-658.119] (-657.921) (-659.140) * (-661.247) [-661.007] (-657.547) (-657.409) -- 0:00:28
534000 -- (-662.837) [-660.872] (-664.897) (-655.897) * [-657.661] (-659.462) (-661.190) (-657.090) -- 0:00:28
534500 -- (-659.503) (-656.381) [-657.823] (-659.803) * (-659.483) (-658.589) [-657.858] (-655.982) -- 0:00:28
535000 -- (-656.642) (-658.390) (-655.734) [-660.485] * (-659.514) [-656.748] (-657.858) (-660.006) -- 0:00:28
Average standard deviation of split frequencies: 0.012313
535500 -- (-657.909) [-658.825] (-658.506) (-655.494) * (-657.668) [-657.980] (-657.350) (-656.347) -- 0:00:28
536000 -- [-656.713] (-669.544) (-656.490) (-656.609) * (-659.446) (-655.558) [-656.835] (-660.200) -- 0:00:28
536500 -- (-656.403) [-655.554] (-658.610) (-657.411) * (-656.283) (-656.626) [-655.552] (-661.458) -- 0:00:28
537000 -- (-658.421) (-655.721) [-657.131] (-658.336) * [-656.948] (-657.843) (-656.036) (-659.756) -- 0:00:28
537500 -- (-659.340) [-657.846] (-656.154) (-656.772) * (-661.966) (-657.052) [-657.495] (-662.096) -- 0:00:28
538000 -- [-657.242] (-657.058) (-657.620) (-657.223) * (-657.781) (-656.337) [-657.510] (-658.226) -- 0:00:28
538500 -- (-660.750) (-659.578) [-658.783] (-656.727) * (-657.203) (-656.965) (-659.016) [-659.430] -- 0:00:28
539000 -- (-659.552) [-656.593] (-657.341) (-660.362) * (-656.824) (-656.668) (-657.514) [-657.157] -- 0:00:28
539500 -- (-656.630) (-658.976) (-655.704) [-658.579] * (-657.995) (-659.326) [-657.666] (-659.263) -- 0:00:28
540000 -- (-656.618) (-657.417) (-656.201) [-657.190] * (-656.423) (-658.235) [-659.137] (-659.932) -- 0:00:28
Average standard deviation of split frequencies: 0.012207
540500 -- (-660.679) (-655.726) (-660.137) [-656.979] * (-656.009) [-656.387] (-663.201) (-658.395) -- 0:00:28
541000 -- (-660.188) (-655.472) (-658.016) [-660.278] * (-659.872) (-656.498) (-658.401) [-656.291] -- 0:00:27
541500 -- (-657.170) (-657.351) (-659.157) [-659.557] * [-657.238] (-656.948) (-657.101) (-656.006) -- 0:00:27
542000 -- (-656.967) (-655.847) (-657.534) [-655.957] * [-657.101] (-656.886) (-658.705) (-656.390) -- 0:00:27
542500 -- (-655.684) (-658.445) (-656.300) [-657.545] * (-660.684) (-657.231) [-660.467] (-659.583) -- 0:00:27
543000 -- (-657.991) (-660.878) [-657.300] (-664.484) * (-658.329) (-656.271) (-662.174) [-661.558] -- 0:00:27
543500 -- [-657.133] (-656.429) (-657.439) (-662.415) * [-656.999] (-656.786) (-657.898) (-658.106) -- 0:00:27
544000 -- (-658.044) [-657.384] (-662.621) (-659.068) * (-656.220) [-657.435] (-656.717) (-662.976) -- 0:00:27
544500 -- (-658.244) (-657.427) (-658.864) [-655.571] * (-662.563) (-657.192) [-657.512] (-656.803) -- 0:00:27
545000 -- (-657.450) [-659.761] (-657.811) (-655.630) * (-657.134) (-658.446) [-656.282] (-657.661) -- 0:00:27
Average standard deviation of split frequencies: 0.011608
545500 -- [-658.475] (-660.793) (-657.806) (-658.660) * (-656.637) (-659.599) (-658.073) [-656.485] -- 0:00:27
546000 -- (-658.249) [-656.921] (-656.871) (-657.609) * [-659.277] (-658.803) (-656.156) (-657.922) -- 0:00:27
546500 -- (-659.736) (-658.619) [-657.112] (-657.727) * (-658.285) [-656.849] (-656.426) (-656.120) -- 0:00:27
547000 -- (-656.700) (-659.643) (-655.903) [-657.229] * (-658.108) (-660.789) [-656.570] (-658.620) -- 0:00:27
547500 -- (-656.287) [-656.219] (-657.021) (-662.360) * (-657.404) [-661.224] (-658.750) (-656.833) -- 0:00:27
548000 -- [-657.274] (-658.636) (-657.886) (-659.520) * (-657.082) [-657.951] (-657.857) (-655.935) -- 0:00:27
548500 -- (-658.296) (-660.067) [-656.015] (-659.053) * (-657.573) (-659.898) (-660.481) [-660.917] -- 0:00:27
549000 -- (-659.698) (-657.766) [-656.364] (-657.526) * [-657.402] (-657.687) (-655.954) (-657.748) -- 0:00:27
549500 -- [-658.567] (-655.371) (-656.323) (-657.768) * (-659.953) (-660.120) [-658.050] (-657.309) -- 0:00:27
550000 -- (-662.132) [-656.858] (-657.165) (-656.025) * [-660.200] (-657.100) (-656.848) (-657.326) -- 0:00:27
Average standard deviation of split frequencies: 0.010986
550500 -- (-657.735) (-661.578) (-660.083) [-659.572] * (-656.308) (-657.867) (-658.883) [-657.613] -- 0:00:27
551000 -- [-656.402] (-655.974) (-658.542) (-657.431) * (-658.308) (-661.355) [-656.778] (-656.634) -- 0:00:27
551500 -- (-656.067) [-659.383] (-656.636) (-656.452) * (-656.561) (-657.140) [-657.192] (-657.475) -- 0:00:27
552000 -- [-656.733] (-656.940) (-656.650) (-667.624) * (-656.042) (-658.251) [-658.111] (-659.681) -- 0:00:27
552500 -- (-659.336) (-660.186) [-658.628] (-655.665) * (-660.800) [-656.676] (-655.878) (-659.739) -- 0:00:27
553000 -- (-656.759) (-657.019) (-659.796) [-657.369] * (-659.183) [-658.308] (-659.134) (-657.176) -- 0:00:27
553500 -- (-660.366) [-656.555] (-658.925) (-657.163) * [-658.742] (-657.400) (-656.239) (-658.335) -- 0:00:27
554000 -- (-657.262) [-657.496] (-656.885) (-659.765) * (-657.680) (-657.791) [-657.569] (-656.592) -- 0:00:27
554500 -- (-658.903) (-656.273) (-657.371) [-655.835] * (-659.565) (-656.352) (-656.763) [-656.747] -- 0:00:27
555000 -- [-656.783] (-656.088) (-657.118) (-656.533) * (-657.695) [-656.587] (-659.608) (-657.366) -- 0:00:27
Average standard deviation of split frequencies: 0.010504
555500 -- [-656.628] (-657.787) (-656.672) (-658.405) * (-659.036) (-662.351) [-657.453] (-655.382) -- 0:00:27
556000 -- (-656.889) (-660.516) [-656.259] (-658.034) * (-657.954) [-656.762] (-659.646) (-659.265) -- 0:00:27
556500 -- (-657.888) (-661.685) [-659.372] (-663.427) * (-656.448) (-658.584) (-658.060) [-657.109] -- 0:00:27
557000 -- [-657.522] (-661.992) (-659.859) (-659.446) * (-657.504) (-656.644) [-661.248] (-655.686) -- 0:00:27
557500 -- (-657.105) [-658.010] (-657.156) (-656.356) * (-657.312) (-661.843) (-659.229) [-656.259] -- 0:00:26
558000 -- (-658.074) (-657.482) [-658.699] (-657.013) * (-656.791) (-659.578) (-660.435) [-657.539] -- 0:00:26
558500 -- [-656.261] (-657.747) (-656.675) (-660.792) * (-657.728) (-656.356) (-657.609) [-657.224] -- 0:00:26
559000 -- (-661.955) (-657.475) [-657.163] (-660.097) * [-658.394] (-655.771) (-659.304) (-661.816) -- 0:00:26
559500 -- (-659.944) (-658.914) (-658.497) [-657.189] * (-656.887) [-656.680] (-659.099) (-659.950) -- 0:00:26
560000 -- (-660.255) (-658.090) [-656.910] (-657.262) * (-659.347) [-664.226] (-656.977) (-662.895) -- 0:00:26
Average standard deviation of split frequencies: 0.010510
560500 -- (-659.057) [-656.979] (-656.539) (-657.249) * [-658.387] (-656.032) (-661.502) (-662.972) -- 0:00:26
561000 -- (-657.782) (-660.493) [-656.946] (-658.870) * [-655.977] (-662.685) (-656.703) (-657.511) -- 0:00:26
561500 -- (-657.718) (-658.828) [-656.028] (-656.412) * (-658.567) (-658.375) (-660.497) [-657.498] -- 0:00:26
562000 -- [-656.922] (-656.714) (-659.663) (-658.571) * (-656.794) (-656.581) (-656.351) [-657.342] -- 0:00:26
562500 -- (-658.280) [-655.559] (-655.879) (-660.582) * (-657.771) [-656.674] (-657.797) (-656.425) -- 0:00:26
563000 -- (-656.149) (-657.997) [-655.801] (-658.344) * [-657.867] (-656.818) (-658.617) (-656.610) -- 0:00:26
563500 -- (-659.801) (-657.717) (-655.693) [-659.552] * (-657.788) [-656.437] (-661.330) (-657.195) -- 0:00:26
564000 -- (-658.459) [-656.989] (-656.428) (-659.291) * (-658.090) (-656.710) (-659.629) [-657.410] -- 0:00:26
564500 -- [-660.976] (-656.690) (-656.182) (-657.008) * (-658.860) (-660.570) (-658.165) [-661.260] -- 0:00:26
565000 -- (-656.133) [-656.327] (-658.592) (-657.003) * (-658.381) (-658.253) (-656.578) [-662.888] -- 0:00:26
Average standard deviation of split frequencies: 0.010087
565500 -- [-659.039] (-656.763) (-658.130) (-659.323) * (-657.677) [-657.513] (-657.017) (-660.613) -- 0:00:26
566000 -- (-657.152) (-656.705) [-658.477] (-659.038) * (-661.037) (-658.918) (-656.860) [-658.405] -- 0:00:26
566500 -- (-659.136) [-656.758] (-659.800) (-657.234) * (-659.151) (-662.592) [-656.490] (-656.436) -- 0:00:26
567000 -- (-660.043) (-656.356) [-658.207] (-660.162) * (-666.154) (-659.557) [-655.834] (-657.862) -- 0:00:26
567500 -- (-659.277) (-656.213) [-655.991] (-659.770) * (-665.062) (-658.938) (-657.422) [-657.442] -- 0:00:26
568000 -- (-656.815) (-661.357) [-661.359] (-656.884) * (-658.364) (-658.644) [-659.024] (-659.572) -- 0:00:26
568500 -- (-657.858) (-656.657) (-663.271) [-656.910] * (-656.664) (-659.681) (-660.472) [-656.549] -- 0:00:26
569000 -- (-656.123) [-658.029] (-662.503) (-658.447) * (-659.554) (-656.315) [-659.676] (-656.031) -- 0:00:26
569500 -- (-660.237) [-656.781] (-658.171) (-658.257) * (-658.009) [-657.029] (-656.912) (-656.283) -- 0:00:26
570000 -- (-658.934) [-656.332] (-657.529) (-656.120) * (-657.169) (-657.366) [-656.519] (-658.000) -- 0:00:26
Average standard deviation of split frequencies: 0.010050
570500 -- (-656.874) (-657.900) (-657.989) [-656.809] * (-657.466) (-659.097) [-658.324] (-657.885) -- 0:00:26
571000 -- [-657.575] (-657.856) (-657.490) (-656.621) * (-656.519) [-655.813] (-656.644) (-658.567) -- 0:00:26
571500 -- (-658.551) (-671.507) [-659.769] (-657.472) * [-659.547] (-656.133) (-657.750) (-656.552) -- 0:00:26
572000 -- (-657.330) [-661.128] (-656.898) (-657.617) * (-660.009) [-657.030] (-657.261) (-658.541) -- 0:00:26
572500 -- (-657.221) (-657.192) (-655.781) [-658.421] * (-661.207) [-656.765] (-657.914) (-658.055) -- 0:00:26
573000 -- (-656.672) (-665.306) [-657.945] (-657.330) * (-656.266) (-663.088) (-659.741) [-657.389] -- 0:00:26
573500 -- [-657.002] (-661.639) (-656.683) (-656.336) * (-657.176) (-659.023) (-658.677) [-657.252] -- 0:00:26
574000 -- (-656.250) (-661.551) [-656.606] (-656.625) * (-657.380) [-657.615] (-658.946) (-657.791) -- 0:00:25
574500 -- [-658.043] (-657.816) (-660.671) (-659.235) * (-657.787) (-661.527) [-656.659] (-658.566) -- 0:00:25
575000 -- (-657.897) (-658.038) [-657.848] (-657.456) * (-658.636) [-658.108] (-657.026) (-656.779) -- 0:00:25
Average standard deviation of split frequencies: 0.010976
575500 -- (-657.688) (-655.908) [-656.251] (-655.902) * (-660.025) [-656.228] (-659.601) (-657.943) -- 0:00:25
576000 -- (-663.816) [-655.312] (-656.520) (-660.692) * [-656.377] (-656.773) (-657.146) (-659.553) -- 0:00:25
576500 -- (-655.808) [-655.807] (-661.011) (-655.682) * (-655.853) [-657.186] (-658.294) (-662.137) -- 0:00:25
577000 -- (-655.817) (-655.680) (-662.892) [-657.263] * [-655.671] (-658.731) (-657.687) (-661.113) -- 0:00:25
577500 -- (-658.241) (-655.722) (-657.739) [-660.688] * (-657.602) (-660.420) [-656.220] (-659.410) -- 0:00:25
578000 -- (-658.913) (-660.336) [-659.174] (-659.474) * (-656.498) (-658.147) (-661.668) [-662.463] -- 0:00:25
578500 -- (-657.704) (-657.090) [-658.310] (-657.487) * (-658.411) (-657.472) (-660.618) [-657.344] -- 0:00:25
579000 -- (-663.109) (-655.845) [-658.345] (-656.477) * [-664.140] (-662.011) (-657.117) (-657.478) -- 0:00:25
579500 -- [-657.717] (-659.591) (-657.163) (-659.838) * (-660.043) (-657.641) (-656.073) [-659.053] -- 0:00:25
580000 -- (-659.581) (-658.284) [-660.323] (-658.117) * (-656.301) [-657.475] (-655.546) (-657.083) -- 0:00:25
Average standard deviation of split frequencies: 0.011366
580500 -- (-663.134) (-658.186) [-656.546] (-661.064) * (-657.274) (-657.788) [-657.969] (-657.901) -- 0:00:25
581000 -- (-658.260) (-658.087) (-657.014) [-659.140] * [-657.298] (-657.118) (-657.632) (-655.857) -- 0:00:25
581500 -- [-657.290] (-660.515) (-664.103) (-663.277) * (-659.244) (-657.189) [-656.519] (-657.485) -- 0:00:25
582000 -- (-659.776) [-656.834] (-656.066) (-663.457) * (-658.812) [-660.658] (-657.720) (-656.504) -- 0:00:25
582500 -- (-660.377) (-656.679) (-660.510) [-661.670] * (-660.729) [-657.893] (-655.937) (-657.846) -- 0:00:25
583000 -- (-657.657) [-659.072] (-656.253) (-658.713) * (-658.513) (-661.065) (-657.063) [-655.919] -- 0:00:25
583500 -- (-659.355) (-660.526) (-656.246) [-656.971] * (-658.601) (-657.118) [-657.620] (-656.650) -- 0:00:25
584000 -- (-658.708) [-656.866] (-656.084) (-658.987) * (-659.445) [-656.466] (-656.834) (-655.999) -- 0:00:25
584500 -- (-656.761) (-658.037) (-657.302) [-657.565] * (-657.984) [-656.667] (-656.941) (-656.894) -- 0:00:25
585000 -- (-656.750) (-657.516) [-660.475] (-660.345) * (-660.114) [-656.390] (-657.932) (-658.218) -- 0:00:25
Average standard deviation of split frequencies: 0.011262
585500 -- [-656.064] (-658.247) (-656.973) (-658.019) * (-664.956) (-657.488) (-658.236) [-657.089] -- 0:00:25
586000 -- (-661.312) (-659.263) [-656.608] (-659.507) * [-658.438] (-659.766) (-659.587) (-655.472) -- 0:00:25
586500 -- (-660.330) (-656.418) (-657.882) [-657.040] * (-660.166) (-658.946) (-657.091) [-657.673] -- 0:00:25
587000 -- (-656.257) (-659.407) [-659.343] (-660.339) * (-660.388) (-658.479) [-656.343] (-657.240) -- 0:00:25
587500 -- (-660.051) (-659.746) [-658.260] (-658.217) * (-659.610) (-656.434) [-660.258] (-657.106) -- 0:00:25
588000 -- (-660.192) (-659.224) [-657.310] (-656.781) * [-656.356] (-659.052) (-660.118) (-655.879) -- 0:00:25
588500 -- (-660.640) (-657.273) (-656.531) [-662.700] * (-657.500) (-657.198) [-664.448] (-657.523) -- 0:00:25
589000 -- (-656.275) [-658.819] (-656.164) (-656.615) * (-658.604) (-656.897) [-655.975] (-656.925) -- 0:00:25
589500 -- (-657.551) (-656.341) [-655.875] (-656.557) * (-657.756) (-656.482) (-660.735) [-658.833] -- 0:00:25
590000 -- (-657.643) (-657.888) (-656.413) [-657.718] * (-656.828) (-660.130) [-656.345] (-656.386) -- 0:00:25
Average standard deviation of split frequencies: 0.011267
590500 -- [-659.054] (-660.761) (-660.560) (-659.872) * (-657.198) (-659.512) [-656.574] (-656.186) -- 0:00:24
591000 -- [-659.436] (-657.700) (-660.752) (-657.748) * [-655.825] (-656.080) (-655.940) (-660.011) -- 0:00:24
591500 -- (-661.740) (-660.138) [-657.145] (-655.616) * (-657.926) (-656.793) [-657.404] (-659.198) -- 0:00:24
592000 -- (-658.087) [-656.791] (-656.095) (-657.816) * (-655.579) (-656.730) [-657.861] (-657.729) -- 0:00:24
592500 -- (-656.185) (-656.727) [-655.996] (-659.243) * [-657.287] (-656.704) (-657.399) (-657.169) -- 0:00:24
593000 -- [-658.840] (-657.855) (-659.101) (-661.551) * (-657.533) (-658.132) [-657.231] (-667.304) -- 0:00:24
593500 -- (-655.844) (-660.000) (-660.285) [-658.013] * (-662.233) (-661.906) (-658.309) [-661.065] -- 0:00:24
594000 -- (-656.098) (-659.263) [-658.472] (-660.027) * [-657.758] (-656.705) (-659.821) (-661.617) -- 0:00:24
594500 -- (-656.763) (-662.840) [-658.075] (-658.522) * (-658.416) [-657.133] (-658.364) (-659.636) -- 0:00:24
595000 -- (-657.561) [-658.590] (-659.405) (-658.348) * [-658.737] (-658.268) (-657.315) (-656.275) -- 0:00:24
Average standard deviation of split frequencies: 0.010794
595500 -- [-657.308] (-659.373) (-660.906) (-656.879) * [-657.954] (-655.518) (-656.313) (-657.322) -- 0:00:24
596000 -- (-657.451) [-657.125] (-658.921) (-656.231) * [-659.149] (-658.802) (-658.485) (-657.873) -- 0:00:24
596500 -- (-657.117) [-656.258] (-657.626) (-656.542) * (-658.381) (-658.834) (-657.340) [-657.665] -- 0:00:24
597000 -- [-658.612] (-656.812) (-658.342) (-658.065) * (-660.089) (-658.662) (-657.943) [-659.240] -- 0:00:24
597500 -- (-656.063) (-656.408) (-661.861) [-663.259] * (-657.184) (-657.185) [-657.166] (-658.418) -- 0:00:24
598000 -- [-656.992] (-657.280) (-656.451) (-657.477) * (-658.032) (-656.734) (-657.610) [-658.689] -- 0:00:24
598500 -- (-660.531) (-658.959) (-659.445) [-656.801] * (-658.746) [-656.873] (-657.277) (-658.175) -- 0:00:24
599000 -- (-659.679) (-656.633) [-659.001] (-660.705) * (-657.394) (-658.362) [-656.583] (-658.980) -- 0:00:24
599500 -- (-656.532) (-656.948) [-656.908] (-659.492) * (-662.725) (-662.938) [-656.616] (-657.997) -- 0:00:24
600000 -- (-656.573) (-656.505) [-656.303] (-656.146) * (-662.393) (-659.884) [-657.403] (-657.046) -- 0:00:24
Average standard deviation of split frequencies: 0.010756
600500 -- (-657.981) [-660.506] (-657.564) (-660.855) * (-660.683) (-660.588) (-660.604) [-657.224] -- 0:00:24
601000 -- (-662.315) [-656.105] (-659.148) (-662.090) * (-665.589) (-657.364) [-657.358] (-657.708) -- 0:00:24
601500 -- (-662.114) (-660.677) [-658.245] (-657.864) * [-662.480] (-657.804) (-657.832) (-658.348) -- 0:00:24
602000 -- (-657.191) [-659.663] (-656.857) (-660.410) * (-661.544) [-662.796] (-657.760) (-656.386) -- 0:00:24
602500 -- (-661.553) (-659.387) [-658.094] (-657.205) * (-659.398) [-658.016] (-656.190) (-655.909) -- 0:00:24
603000 -- (-661.702) (-656.582) [-661.005] (-659.180) * [-660.026] (-656.968) (-656.719) (-657.035) -- 0:00:24
603500 -- (-666.210) (-660.449) (-662.611) [-657.497] * (-660.971) [-656.536] (-660.133) (-656.583) -- 0:00:24
604000 -- (-656.415) [-660.278] (-657.497) (-659.226) * [-657.968] (-658.124) (-661.725) (-659.931) -- 0:00:24
604500 -- (-657.171) (-659.587) [-657.019] (-658.208) * (-659.339) [-656.349] (-657.948) (-656.567) -- 0:00:24
605000 -- (-660.795) [-657.290] (-656.484) (-657.434) * [-658.947] (-657.839) (-660.342) (-656.148) -- 0:00:24
Average standard deviation of split frequencies: 0.011074
605500 -- (-659.365) (-655.628) (-660.908) [-658.558] * (-660.487) (-657.552) (-657.613) [-655.487] -- 0:00:24
606000 -- (-657.072) [-655.628] (-660.008) (-658.092) * (-659.403) (-657.635) [-656.070] (-656.137) -- 0:00:24
606500 -- (-656.108) (-655.837) (-656.698) [-657.217] * (-657.844) (-657.636) [-658.490] (-656.033) -- 0:00:24
607000 -- (-656.235) (-657.073) [-657.864] (-657.007) * (-658.288) (-660.533) (-656.781) [-656.852] -- 0:00:23
607500 -- (-656.863) (-657.957) [-659.386] (-657.301) * (-658.239) (-657.903) [-657.454] (-657.686) -- 0:00:23
608000 -- [-655.601] (-657.379) (-656.673) (-657.842) * (-656.882) [-658.842] (-655.819) (-657.912) -- 0:00:23
608500 -- (-657.298) (-656.700) (-657.643) [-658.184] * (-657.934) [-657.435] (-657.706) (-656.444) -- 0:00:23
609000 -- (-656.608) (-661.882) (-656.090) [-657.497] * [-658.144] (-656.935) (-659.650) (-661.452) -- 0:00:23
609500 -- (-657.367) (-658.767) [-656.803] (-656.104) * (-657.814) (-657.130) [-659.566] (-660.153) -- 0:00:23
610000 -- (-658.689) [-659.685] (-659.143) (-656.889) * (-655.621) [-658.557] (-661.791) (-659.931) -- 0:00:23
Average standard deviation of split frequencies: 0.011443
610500 -- (-660.990) (-657.107) (-658.358) [-658.928] * [-655.687] (-655.589) (-656.650) (-660.515) -- 0:00:23
611000 -- (-657.271) (-662.546) [-657.640] (-659.345) * (-657.713) (-656.400) [-659.422] (-658.120) -- 0:00:23
611500 -- (-657.867) (-658.933) [-655.778] (-656.875) * (-660.709) (-660.204) [-658.059] (-659.865) -- 0:00:23
612000 -- [-660.175] (-660.168) (-655.940) (-658.001) * [-658.644] (-656.681) (-658.308) (-657.240) -- 0:00:23
612500 -- (-661.086) (-656.843) (-655.906) [-656.606] * (-661.023) (-656.241) (-658.649) [-657.239] -- 0:00:23
613000 -- (-659.018) (-657.647) (-657.154) [-655.631] * (-660.525) [-656.361] (-661.350) (-656.722) -- 0:00:23
613500 -- (-659.555) (-658.508) (-657.850) [-655.751] * (-655.663) (-656.220) [-657.943] (-657.625) -- 0:00:23
614000 -- [-661.001] (-656.228) (-662.230) (-657.585) * (-656.701) (-657.476) (-655.929) [-657.419] -- 0:00:23
614500 -- [-656.907] (-657.468) (-661.787) (-659.494) * (-656.578) (-658.029) (-656.380) [-655.766] -- 0:00:23
615000 -- (-661.776) (-657.293) (-656.279) [-657.000] * [-656.709] (-658.706) (-658.325) (-655.674) -- 0:00:23
Average standard deviation of split frequencies: 0.010849
615500 -- [-658.802] (-656.670) (-656.630) (-658.791) * (-659.800) [-656.290] (-656.110) (-658.622) -- 0:00:23
616000 -- (-660.056) (-659.551) [-658.111] (-660.122) * (-660.624) [-657.667] (-661.209) (-658.020) -- 0:00:23
616500 -- (-660.899) [-662.299] (-658.227) (-658.415) * (-660.639) [-659.073] (-660.350) (-659.244) -- 0:00:23
617000 -- (-659.412) (-657.314) (-660.342) [-657.153] * (-662.565) [-661.400] (-655.679) (-659.491) -- 0:00:23
617500 -- [-657.038] (-657.956) (-656.536) (-659.856) * (-661.982) (-661.695) (-657.807) [-659.669] -- 0:00:23
618000 -- (-657.749) (-659.393) [-656.914] (-659.992) * (-658.247) (-658.560) [-656.701] (-658.974) -- 0:00:23
618500 -- (-657.699) (-658.603) (-658.548) [-658.615] * (-657.186) (-661.304) (-659.181) [-657.915] -- 0:00:23
619000 -- (-662.008) [-657.112] (-657.359) (-659.089) * (-661.275) [-658.138] (-656.575) (-659.136) -- 0:00:23
619500 -- (-661.556) [-658.237] (-657.340) (-656.310) * (-659.388) [-656.426] (-656.443) (-659.112) -- 0:00:23
620000 -- (-655.806) (-656.387) (-656.084) [-659.014] * (-659.022) (-657.567) [-658.493] (-656.971) -- 0:00:23
Average standard deviation of split frequencies: 0.010767
620500 -- (-657.291) [-656.214] (-661.700) (-659.461) * (-658.492) (-658.488) [-655.887] (-656.962) -- 0:00:23
621000 -- (-658.127) (-656.901) [-656.144] (-657.952) * (-657.119) [-656.055] (-655.946) (-657.146) -- 0:00:23
621500 -- [-657.391] (-657.740) (-658.119) (-658.140) * (-656.751) (-659.301) [-656.864] (-659.516) -- 0:00:23
622000 -- [-656.999] (-657.646) (-659.884) (-655.636) * [-658.993] (-659.023) (-657.006) (-657.150) -- 0:00:23
622500 -- [-656.697] (-657.486) (-658.131) (-658.487) * (-657.941) [-658.615] (-656.888) (-658.327) -- 0:00:23
623000 -- [-655.908] (-658.172) (-658.363) (-656.773) * [-658.658] (-661.538) (-656.054) (-659.415) -- 0:00:22
623500 -- (-656.265) (-660.759) (-657.227) [-655.893] * (-657.265) (-660.318) [-655.670] (-656.646) -- 0:00:22
624000 -- (-662.668) [-657.012] (-658.300) (-656.576) * [-658.382] (-656.544) (-658.576) (-656.943) -- 0:00:22
624500 -- [-657.148] (-655.979) (-658.506) (-661.426) * (-657.471) (-657.453) [-656.477] (-659.324) -- 0:00:22
625000 -- (-657.140) (-658.204) (-662.003) [-659.806] * (-658.994) (-660.306) [-658.659] (-657.304) -- 0:00:22
Average standard deviation of split frequencies: 0.010365
625500 -- (-657.202) (-657.721) [-657.381] (-660.278) * (-658.968) [-656.618] (-660.021) (-657.470) -- 0:00:22
626000 -- (-657.694) (-657.134) (-657.477) [-658.834] * (-657.763) (-659.227) [-662.032] (-659.683) -- 0:00:22
626500 -- (-658.238) (-656.582) [-658.770] (-657.873) * (-664.604) (-657.182) (-658.154) [-657.233] -- 0:00:22
627000 -- (-658.712) (-657.884) (-657.054) [-658.164] * [-659.100] (-657.932) (-660.388) (-656.011) -- 0:00:22
627500 -- (-659.440) [-657.580] (-660.796) (-660.389) * (-656.201) (-660.533) [-656.542] (-657.902) -- 0:00:22
628000 -- (-655.923) [-656.318] (-658.672) (-660.370) * (-657.700) (-658.931) (-659.435) [-657.225] -- 0:00:22
628500 -- (-655.706) (-658.526) [-657.894] (-659.171) * (-658.498) (-657.430) [-657.002] (-658.958) -- 0:00:22
629000 -- (-659.277) (-658.484) [-659.148] (-658.412) * [-657.116] (-659.047) (-657.494) (-655.903) -- 0:00:22
629500 -- [-656.572] (-657.276) (-657.801) (-659.156) * (-658.187) (-655.993) (-660.268) [-655.827] -- 0:00:22
630000 -- (-656.501) (-659.797) [-657.763] (-659.534) * (-658.653) [-657.550] (-661.176) (-656.377) -- 0:00:22
Average standard deviation of split frequencies: 0.010684
630500 -- (-660.006) [-657.642] (-658.107) (-657.763) * (-656.861) (-658.958) [-657.576] (-658.424) -- 0:00:22
631000 -- (-657.414) (-658.393) [-659.508] (-658.915) * (-660.642) [-655.473] (-656.596) (-657.270) -- 0:00:22
631500 -- (-658.371) (-656.983) (-659.697) [-660.779] * (-658.981) (-655.479) (-660.295) [-656.612] -- 0:00:22
632000 -- (-659.265) (-658.227) [-656.807] (-658.437) * (-656.381) (-656.378) [-660.798] (-658.688) -- 0:00:22
632500 -- (-660.733) (-658.019) (-656.554) [-657.126] * (-656.348) (-656.564) [-656.456] (-657.488) -- 0:00:22
633000 -- (-659.124) (-658.607) [-656.567] (-655.518) * [-657.559] (-657.113) (-657.127) (-658.109) -- 0:00:22
633500 -- (-657.021) (-659.575) (-657.079) [-659.325] * (-660.105) [-657.548] (-657.913) (-657.075) -- 0:00:22
634000 -- (-657.624) (-658.494) [-659.565] (-663.417) * (-657.080) (-658.558) [-657.064] (-658.218) -- 0:00:22
634500 -- [-656.542] (-656.646) (-663.515) (-657.265) * [-659.887] (-658.193) (-661.823) (-658.740) -- 0:00:22
635000 -- (-656.685) (-656.274) [-656.365] (-656.604) * (-657.276) [-656.397] (-655.832) (-656.160) -- 0:00:22
Average standard deviation of split frequencies: 0.010508
635500 -- [-656.620] (-657.522) (-659.090) (-658.048) * (-655.888) (-659.058) (-663.022) [-657.982] -- 0:00:22
636000 -- (-656.623) (-660.051) (-660.269) [-659.094] * [-658.319] (-659.488) (-659.012) (-660.498) -- 0:00:22
636500 -- (-656.475) (-660.483) [-661.590] (-658.980) * [-657.252] (-662.232) (-658.098) (-657.214) -- 0:00:22
637000 -- (-659.587) (-661.149) (-662.348) [-660.222] * (-656.254) (-660.452) [-661.728] (-657.607) -- 0:00:22
637500 -- (-658.177) [-657.234] (-657.878) (-656.647) * (-657.361) [-658.092] (-657.007) (-657.825) -- 0:00:22
638000 -- (-657.019) [-660.319] (-661.237) (-664.676) * (-657.259) (-656.171) (-658.255) [-660.540] -- 0:00:22
638500 -- [-661.027] (-658.891) (-658.460) (-660.572) * (-657.458) [-655.920] (-659.273) (-657.734) -- 0:00:22
639000 -- (-657.227) (-658.623) [-659.825] (-658.379) * [-657.522] (-658.704) (-660.625) (-656.603) -- 0:00:22
639500 -- (-657.343) (-657.949) [-658.326] (-659.966) * (-657.306) (-656.999) [-657.823] (-656.921) -- 0:00:21
640000 -- (-657.508) (-659.773) (-662.406) [-655.872] * [-657.829] (-656.427) (-657.151) (-656.199) -- 0:00:21
Average standard deviation of split frequencies: 0.010604
640500 -- [-656.801] (-660.944) (-660.615) (-656.747) * [-657.120] (-657.634) (-657.933) (-657.078) -- 0:00:21
641000 -- (-658.725) (-657.490) (-659.334) [-655.896] * (-657.299) [-655.911] (-656.199) (-656.608) -- 0:00:21
641500 -- (-658.089) (-656.735) [-661.132] (-659.905) * (-657.634) (-656.442) [-656.086] (-656.121) -- 0:00:21
642000 -- (-656.492) (-658.349) (-660.559) [-658.407] * (-657.476) (-656.795) (-658.395) [-656.217] -- 0:00:21
642500 -- (-655.804) (-662.497) [-661.285] (-657.457) * (-656.253) [-657.087] (-657.482) (-657.897) -- 0:00:21
643000 -- (-655.842) (-663.491) [-657.358] (-658.017) * (-658.686) (-657.660) [-659.372] (-658.445) -- 0:00:21
643500 -- (-656.459) [-655.810] (-657.717) (-656.349) * [-659.942] (-661.896) (-655.939) (-655.970) -- 0:00:21
644000 -- (-658.699) [-656.890] (-656.785) (-656.308) * (-658.601) [-658.747] (-657.522) (-656.086) -- 0:00:21
644500 -- [-657.994] (-656.338) (-658.576) (-657.098) * (-660.667) (-658.376) (-656.821) [-657.425] -- 0:00:21
645000 -- [-657.419] (-657.607) (-658.798) (-656.990) * (-656.157) [-658.462] (-662.869) (-655.892) -- 0:00:21
Average standard deviation of split frequencies: 0.011590
645500 -- (-657.118) [-655.905] (-660.669) (-658.398) * (-655.659) (-657.838) (-657.899) [-657.581] -- 0:00:21
646000 -- (-659.615) (-663.982) (-656.649) [-658.033] * (-658.882) (-658.201) [-656.720] (-658.427) -- 0:00:21
646500 -- (-659.090) (-659.252) (-658.081) [-656.770] * (-656.239) [-656.416] (-659.221) (-657.039) -- 0:00:21
647000 -- (-657.231) (-660.822) [-661.410] (-656.922) * (-656.315) [-656.942] (-658.010) (-660.088) -- 0:00:21
647500 -- [-658.451] (-658.128) (-657.958) (-658.065) * (-656.237) [-659.511] (-660.940) (-661.530) -- 0:00:21
648000 -- [-657.065] (-661.094) (-657.122) (-658.548) * (-657.778) [-659.216] (-657.187) (-660.872) -- 0:00:21
648500 -- (-655.921) (-658.388) (-661.010) [-657.140] * [-656.222] (-659.188) (-660.000) (-660.817) -- 0:00:21
649000 -- (-658.954) (-659.102) [-657.128] (-655.534) * (-655.439) (-660.126) (-660.930) [-656.849] -- 0:00:21
649500 -- [-655.898] (-659.801) (-658.390) (-657.325) * [-655.712] (-661.601) (-657.715) (-656.583) -- 0:00:21
650000 -- [-657.073] (-658.383) (-656.654) (-655.770) * (-658.466) (-658.026) [-657.908] (-655.476) -- 0:00:21
Average standard deviation of split frequencies: 0.011507
650500 -- [-657.788] (-659.105) (-658.402) (-655.792) * (-660.286) (-658.157) [-660.901] (-656.018) -- 0:00:21
651000 -- (-660.989) (-658.193) [-657.993] (-656.268) * [-661.077] (-656.249) (-657.325) (-655.916) -- 0:00:21
651500 -- (-655.825) (-659.867) [-657.312] (-656.941) * (-660.683) (-659.639) (-662.359) [-656.561] -- 0:00:21
652000 -- (-658.105) (-657.610) (-657.039) [-658.522] * (-659.524) [-656.565] (-657.592) (-656.585) -- 0:00:21
652500 -- (-659.775) (-657.456) [-657.978] (-657.363) * [-661.847] (-656.106) (-656.282) (-657.522) -- 0:00:21
653000 -- (-658.157) (-661.066) [-657.283] (-659.385) * (-660.294) [-659.733] (-657.282) (-657.530) -- 0:00:21
653500 -- (-657.449) [-659.973] (-663.619) (-661.217) * (-656.826) (-657.319) (-657.032) [-657.382] -- 0:00:21
654000 -- [-660.660] (-656.952) (-658.271) (-656.109) * (-656.815) (-657.764) [-659.323] (-656.398) -- 0:00:21
654500 -- (-659.889) (-659.827) (-659.440) [-656.822] * [-656.004] (-656.899) (-659.422) (-657.566) -- 0:00:21
655000 -- (-657.871) (-660.353) (-656.972) [-658.713] * [-659.472] (-658.629) (-658.155) (-656.087) -- 0:00:21
Average standard deviation of split frequencies: 0.011286
655500 -- (-659.989) [-658.536] (-657.310) (-656.477) * (-657.762) (-656.334) (-657.395) [-657.342] -- 0:00:21
656000 -- (-658.193) (-655.942) [-656.051] (-656.424) * (-657.638) (-656.619) (-657.471) [-658.211] -- 0:00:20
656500 -- (-662.091) (-656.260) [-657.005] (-658.053) * (-658.903) [-656.622] (-657.266) (-659.346) -- 0:00:20
657000 -- (-657.181) (-657.776) [-657.427] (-656.386) * (-658.431) (-655.636) [-655.986] (-655.927) -- 0:00:20
657500 -- (-658.358) [-657.602] (-656.818) (-656.237) * (-659.477) [-656.990] (-656.808) (-656.420) -- 0:00:20
658000 -- (-657.263) (-657.711) (-656.190) [-656.853] * (-657.014) (-658.171) [-656.538] (-656.411) -- 0:00:20
658500 -- (-658.318) [-655.527] (-657.510) (-656.945) * (-656.086) [-661.131] (-658.909) (-659.686) -- 0:00:20
659000 -- (-658.909) (-656.392) (-657.542) [-656.237] * (-657.459) (-656.951) [-656.366] (-662.259) -- 0:00:20
659500 -- (-659.397) [-656.422] (-661.193) (-657.379) * (-660.631) (-659.853) [-655.931] (-659.979) -- 0:00:20
660000 -- (-659.462) (-657.144) (-657.226) [-657.880] * (-661.052) (-662.462) (-657.079) [-659.316] -- 0:00:20
Average standard deviation of split frequencies: 0.010829
660500 -- (-655.804) [-659.767] (-659.632) (-665.392) * (-659.749) (-656.914) [-655.948] (-660.285) -- 0:00:20
661000 -- [-658.733] (-658.004) (-659.157) (-660.450) * (-659.174) [-657.162] (-656.847) (-657.115) -- 0:00:20
661500 -- (-658.343) (-657.019) [-657.042] (-657.162) * [-657.508] (-657.470) (-655.432) (-656.731) -- 0:00:20
662000 -- (-656.543) (-656.664) (-657.421) [-658.894] * [-660.556] (-658.121) (-657.001) (-657.061) -- 0:00:20
662500 -- (-656.248) (-656.551) (-656.249) [-658.145] * (-658.859) (-656.262) [-657.660] (-657.038) -- 0:00:20
663000 -- (-657.958) (-658.633) [-656.234] (-656.898) * [-656.809] (-656.251) (-659.272) (-660.853) -- 0:00:20
663500 -- (-656.859) (-656.534) [-659.202] (-658.858) * (-656.602) (-656.619) (-661.361) [-661.950] -- 0:00:20
664000 -- (-658.375) [-656.709] (-658.362) (-656.764) * (-660.105) (-660.000) (-659.332) [-656.644] -- 0:00:20
664500 -- [-658.161] (-660.119) (-660.374) (-659.338) * [-656.366] (-656.645) (-662.307) (-655.736) -- 0:00:20
665000 -- (-656.678) (-657.415) [-656.050] (-660.074) * (-656.082) (-656.155) (-661.055) [-658.028] -- 0:00:20
Average standard deviation of split frequencies: 0.010326
665500 -- [-659.357] (-656.512) (-656.624) (-659.776) * (-658.369) (-656.358) (-663.495) [-659.445] -- 0:00:20
666000 -- (-656.520) (-657.712) (-657.227) [-658.279] * (-660.239) [-657.896] (-660.553) (-657.272) -- 0:00:20
666500 -- (-656.653) (-656.978) [-656.892] (-655.820) * (-656.031) [-657.933] (-658.199) (-656.605) -- 0:00:20
667000 -- (-656.396) (-655.968) (-656.676) [-655.620] * (-656.197) (-658.454) (-662.031) [-656.189] -- 0:00:20
667500 -- (-659.315) [-656.878] (-659.999) (-658.160) * (-657.812) [-660.559] (-658.896) (-657.684) -- 0:00:20
668000 -- (-657.864) (-655.993) (-657.812) [-658.351] * [-658.900] (-660.475) (-656.311) (-658.053) -- 0:00:20
668500 -- (-657.907) (-657.177) (-656.734) [-656.246] * [-657.324] (-661.590) (-657.892) (-659.725) -- 0:00:20
669000 -- (-660.828) (-659.642) (-656.554) [-659.696] * [-658.827] (-665.233) (-658.333) (-657.037) -- 0:00:20
669500 -- (-658.980) (-659.250) [-658.181] (-657.323) * (-655.838) (-658.393) (-662.719) [-658.292] -- 0:00:20
670000 -- (-658.304) (-660.110) [-657.329] (-657.014) * (-656.543) [-657.335] (-657.369) (-658.308) -- 0:00:20
Average standard deviation of split frequencies: 0.009592
670500 -- (-657.896) (-656.432) [-659.154] (-655.975) * [-658.395] (-658.687) (-659.688) (-656.427) -- 0:00:20
671000 -- [-660.021] (-658.300) (-659.020) (-660.162) * [-663.590] (-657.658) (-659.209) (-657.007) -- 0:00:20
671500 -- [-658.906] (-657.380) (-658.737) (-661.040) * (-662.007) (-655.988) (-656.613) [-659.460] -- 0:00:20
672000 -- (-660.671) (-660.300) (-656.725) [-658.708] * (-658.657) [-659.506] (-659.862) (-658.578) -- 0:00:20
672500 -- [-659.522] (-660.905) (-660.031) (-659.245) * (-660.094) [-657.411] (-656.669) (-657.081) -- 0:00:19
673000 -- (-657.614) [-658.911] (-661.007) (-661.139) * [-657.453] (-655.868) (-659.138) (-658.635) -- 0:00:19
673500 -- (-658.193) (-662.620) (-660.360) [-657.004] * (-661.681) [-656.192] (-659.634) (-658.987) -- 0:00:19
674000 -- (-656.026) [-663.740] (-656.839) (-657.302) * (-662.969) [-659.255] (-658.334) (-661.634) -- 0:00:19
674500 -- [-659.417] (-656.412) (-659.567) (-656.542) * (-658.580) (-658.102) [-657.165] (-658.584) -- 0:00:19
675000 -- (-657.843) (-657.416) (-656.203) [-658.695] * (-658.019) (-663.018) (-656.516) [-657.471] -- 0:00:19
Average standard deviation of split frequencies: 0.009353
675500 -- (-659.030) (-658.237) [-657.422] (-659.452) * (-658.660) (-660.496) (-655.989) [-659.325] -- 0:00:19
676000 -- (-657.001) [-656.953] (-657.852) (-659.150) * [-656.153] (-662.027) (-658.606) (-660.559) -- 0:00:19
676500 -- [-655.688] (-657.077) (-655.596) (-658.278) * (-659.492) [-656.352] (-657.361) (-659.552) -- 0:00:19
677000 -- (-659.621) (-657.501) (-659.041) [-660.676] * [-655.937] (-659.037) (-658.992) (-660.110) -- 0:00:19
677500 -- (-659.110) (-657.536) [-655.578] (-658.170) * (-656.952) (-658.225) [-657.343] (-663.197) -- 0:00:19
678000 -- (-659.595) [-656.575] (-656.985) (-657.946) * (-658.209) [-657.391] (-661.734) (-659.336) -- 0:00:19
678500 -- [-656.744] (-656.500) (-658.947) (-656.640) * [-655.780] (-658.214) (-658.647) (-663.049) -- 0:00:19
679000 -- (-657.314) (-664.277) [-658.085] (-658.172) * (-656.179) [-657.821] (-658.866) (-659.689) -- 0:00:19
679500 -- (-657.060) [-656.855] (-658.004) (-657.737) * [-658.178] (-656.647) (-658.667) (-656.678) -- 0:00:19
680000 -- (-660.725) (-660.792) (-657.259) [-657.996] * (-657.079) [-656.668] (-658.123) (-656.885) -- 0:00:19
Average standard deviation of split frequencies: 0.009003
680500 -- (-657.961) (-660.963) [-657.020] (-657.752) * (-660.148) (-663.847) [-658.130] (-661.986) -- 0:00:19
681000 -- (-659.605) [-657.603] (-657.298) (-660.896) * (-658.332) (-659.236) (-656.737) [-657.773] -- 0:00:19
681500 -- (-659.961) [-655.756] (-656.593) (-658.996) * (-656.917) (-656.517) [-657.913] (-659.179) -- 0:00:19
682000 -- [-656.699] (-656.824) (-658.423) (-657.125) * (-657.608) (-656.788) (-663.413) [-657.773] -- 0:00:19
682500 -- (-663.527) (-658.085) [-658.289] (-655.760) * (-660.151) (-659.248) [-657.833] (-657.713) -- 0:00:19
683000 -- (-658.278) (-660.666) (-657.402) [-658.494] * (-655.916) [-657.428] (-658.020) (-658.131) -- 0:00:19
683500 -- (-660.140) (-657.900) (-657.596) [-657.522] * [-656.118] (-659.849) (-655.915) (-659.347) -- 0:00:19
684000 -- (-657.093) (-659.601) (-658.083) [-656.556] * [-656.913] (-655.717) (-657.071) (-658.231) -- 0:00:19
684500 -- (-656.678) (-659.271) [-657.179] (-657.223) * (-657.283) (-656.821) [-658.434] (-658.805) -- 0:00:19
685000 -- (-657.533) [-657.306] (-658.692) (-657.183) * (-658.871) [-658.349] (-659.208) (-659.438) -- 0:00:19
Average standard deviation of split frequencies: 0.009297
685500 -- [-659.233] (-658.257) (-655.645) (-658.385) * (-655.808) (-656.980) [-657.012] (-657.974) -- 0:00:19
686000 -- (-661.733) (-659.775) (-656.447) [-659.859] * [-655.957] (-658.680) (-656.674) (-659.244) -- 0:00:19
686500 -- (-661.712) (-657.856) [-657.211] (-662.759) * (-656.030) (-658.132) [-657.473] (-661.514) -- 0:00:19
687000 -- (-657.747) (-658.752) [-657.212] (-656.463) * (-655.995) (-658.045) (-657.188) [-659.926] -- 0:00:19
687500 -- (-658.196) (-658.192) (-658.936) [-656.637] * (-658.497) [-655.720] (-662.981) (-667.299) -- 0:00:19
688000 -- [-657.552] (-659.026) (-657.512) (-659.830) * (-661.126) (-655.704) [-656.055] (-656.802) -- 0:00:19
688500 -- (-657.155) (-658.472) (-655.714) [-656.401] * (-658.472) (-656.749) [-656.251] (-657.149) -- 0:00:19
689000 -- (-657.176) (-658.474) [-659.604] (-657.163) * (-658.427) (-658.332) (-656.991) [-658.220] -- 0:00:18
689500 -- (-661.414) [-656.220] (-657.643) (-656.915) * [-657.697] (-659.433) (-656.037) (-657.836) -- 0:00:18
690000 -- (-655.722) (-659.130) (-661.003) [-662.105] * (-657.757) [-656.502] (-658.870) (-657.560) -- 0:00:18
Average standard deviation of split frequencies: 0.008833
690500 -- (-656.047) [-657.778] (-659.630) (-660.183) * [-661.603] (-656.073) (-657.587) (-655.857) -- 0:00:18
691000 -- (-655.928) [-657.115] (-656.944) (-660.011) * (-656.359) (-657.547) (-658.048) [-656.805] -- 0:00:18
691500 -- (-657.797) [-657.041] (-657.059) (-659.093) * (-656.325) [-656.825] (-658.933) (-656.280) -- 0:00:18
692000 -- (-657.326) [-659.460] (-655.775) (-655.925) * (-660.367) [-658.916] (-658.637) (-658.548) -- 0:00:18
692500 -- (-656.215) (-662.503) (-659.241) [-658.066] * (-658.581) (-659.964) [-658.943] (-657.882) -- 0:00:18
693000 -- [-657.255] (-660.922) (-656.768) (-658.981) * (-656.156) [-656.539] (-656.601) (-659.161) -- 0:00:18
693500 -- (-657.469) (-662.117) [-658.342] (-656.791) * (-656.384) (-655.902) (-656.632) [-659.432] -- 0:00:18
694000 -- (-656.144) [-660.200] (-657.103) (-660.574) * (-656.245) (-657.453) (-659.817) [-658.068] -- 0:00:18
694500 -- (-658.741) (-660.073) [-655.515] (-657.541) * (-656.683) [-658.735] (-659.175) (-659.711) -- 0:00:18
695000 -- (-659.406) [-658.197] (-658.045) (-657.568) * [-657.975] (-657.171) (-659.196) (-658.602) -- 0:00:18
Average standard deviation of split frequencies: 0.009084
695500 -- (-656.287) (-657.196) (-659.934) [-659.086] * (-659.555) [-656.404] (-659.211) (-656.976) -- 0:00:18
696000 -- (-656.324) [-658.221] (-656.657) (-659.220) * (-660.233) (-656.489) [-659.008] (-655.590) -- 0:00:18
696500 -- (-656.152) (-656.864) (-658.466) [-658.193] * [-658.652] (-657.997) (-660.416) (-657.005) -- 0:00:18
697000 -- (-656.335) (-656.187) [-657.957] (-657.300) * (-658.360) (-656.502) (-663.808) [-656.280] -- 0:00:18
697500 -- [-657.748] (-660.556) (-657.283) (-656.531) * (-660.143) (-658.198) [-658.948] (-657.069) -- 0:00:18
698000 -- (-657.685) (-655.871) [-656.567] (-657.398) * (-660.594) [-658.114] (-658.658) (-658.238) -- 0:00:18
698500 -- (-657.944) (-656.612) (-657.854) [-657.656] * (-658.864) (-656.667) [-656.395] (-660.180) -- 0:00:18
699000 -- [-656.990] (-659.203) (-655.821) (-663.674) * (-656.593) [-656.258] (-662.302) (-656.516) -- 0:00:18
699500 -- (-657.587) (-662.050) [-657.366] (-656.851) * [-659.106] (-657.041) (-657.894) (-660.041) -- 0:00:18
700000 -- [-659.771] (-655.676) (-662.117) (-658.695) * (-659.291) (-658.749) [-657.733] (-659.168) -- 0:00:18
Average standard deviation of split frequencies: 0.007527
700500 -- (-659.266) [-658.399] (-658.280) (-656.895) * (-663.407) (-661.229) (-657.540) [-658.964] -- 0:00:18
701000 -- (-656.613) (-658.149) (-657.403) [-656.824] * (-659.949) (-661.633) [-656.950] (-659.781) -- 0:00:18
701500 -- (-657.638) (-656.052) [-655.990] (-656.875) * (-658.198) (-657.207) [-657.689] (-656.507) -- 0:00:18
702000 -- (-659.199) (-657.195) [-655.902] (-657.835) * (-655.983) [-656.781] (-656.856) (-659.577) -- 0:00:18
702500 -- (-658.625) (-655.931) (-655.692) [-656.943] * (-655.929) [-657.092] (-657.430) (-660.408) -- 0:00:18
703000 -- (-657.083) (-656.436) (-655.509) [-658.954] * (-659.104) (-657.354) (-660.556) [-660.266] -- 0:00:18
703500 -- (-657.166) (-656.821) [-658.157] (-656.736) * [-660.514] (-657.162) (-660.865) (-658.070) -- 0:00:18
704000 -- [-657.501] (-657.847) (-658.885) (-658.495) * (-657.574) (-655.868) (-656.465) [-658.431] -- 0:00:18
704500 -- (-657.046) [-660.470] (-657.937) (-659.533) * [-658.545] (-659.456) (-657.751) (-657.480) -- 0:00:18
705000 -- (-657.978) [-658.263] (-656.843) (-658.079) * (-659.444) (-661.656) (-659.176) [-657.093] -- 0:00:17
Average standard deviation of split frequencies: 0.008798
705500 -- (-659.103) [-655.604] (-657.134) (-656.824) * (-660.909) (-658.028) (-657.148) [-657.682] -- 0:00:17
706000 -- (-657.598) (-658.335) (-655.967) [-658.587] * (-656.590) [-658.563] (-660.835) (-657.742) -- 0:00:17
706500 -- [-656.773] (-657.781) (-656.250) (-659.790) * (-660.770) (-660.790) (-657.638) [-656.206] -- 0:00:17
707000 -- (-658.841) (-664.898) [-655.902] (-658.454) * (-663.237) (-660.104) [-659.825] (-660.463) -- 0:00:17
707500 -- (-656.014) (-661.951) [-658.605] (-659.108) * (-657.353) (-663.149) (-661.054) [-661.188] -- 0:00:17
708000 -- (-656.090) [-655.751] (-655.963) (-657.267) * (-656.757) (-658.128) (-657.884) [-656.350] -- 0:00:17
708500 -- (-660.138) [-655.728] (-657.269) (-658.854) * (-658.206) (-657.234) (-658.980) [-656.966] -- 0:00:17
709000 -- (-658.437) (-656.304) [-657.573] (-656.475) * (-656.965) [-658.325] (-656.888) (-657.411) -- 0:00:17
709500 -- [-660.376] (-656.805) (-657.126) (-657.294) * (-656.984) [-657.147] (-658.322) (-659.178) -- 0:00:17
710000 -- [-659.294] (-660.193) (-662.589) (-659.305) * (-659.153) [-656.641] (-662.719) (-663.982) -- 0:00:17
Average standard deviation of split frequencies: 0.007545
710500 -- (-658.196) [-655.935] (-658.539) (-658.115) * (-661.488) (-656.867) (-661.754) [-659.321] -- 0:00:17
711000 -- (-659.206) (-657.148) (-656.631) [-658.629] * (-661.108) (-656.113) (-657.645) [-659.707] -- 0:00:17
711500 -- [-659.772] (-655.947) (-656.857) (-660.844) * (-657.326) [-656.020] (-657.027) (-661.843) -- 0:00:17
712000 -- (-656.265) [-659.468] (-658.552) (-659.676) * (-657.192) (-660.996) (-660.316) [-658.361] -- 0:00:17
712500 -- [-656.796] (-656.830) (-655.856) (-657.275) * [-655.753] (-658.166) (-658.610) (-657.911) -- 0:00:17
713000 -- [-656.035] (-662.202) (-656.166) (-664.230) * (-656.438) [-656.798] (-656.888) (-660.585) -- 0:00:17
713500 -- (-656.371) (-658.221) [-656.099] (-657.577) * (-657.109) [-658.318] (-657.493) (-656.496) -- 0:00:17
714000 -- (-657.912) (-659.628) [-657.629] (-667.131) * [-656.181] (-657.064) (-660.690) (-656.043) -- 0:00:17
714500 -- (-658.747) [-658.900] (-656.911) (-657.867) * (-655.413) [-659.162] (-658.076) (-657.011) -- 0:00:17
715000 -- (-658.240) (-658.735) [-658.441] (-656.444) * (-656.075) [-656.630] (-658.887) (-660.869) -- 0:00:17
Average standard deviation of split frequencies: 0.007654
715500 -- (-657.621) (-660.025) (-657.846) [-656.050] * (-657.037) (-656.803) [-658.834] (-656.339) -- 0:00:17
716000 -- [-655.815] (-657.201) (-658.276) (-657.769) * (-657.273) (-657.570) (-663.620) [-657.555] -- 0:00:17
716500 -- [-658.931] (-656.364) (-657.163) (-660.262) * (-657.897) [-657.265] (-659.057) (-657.516) -- 0:00:17
717000 -- [-657.761] (-657.082) (-657.248) (-659.132) * (-659.303) (-658.913) [-656.395] (-660.472) -- 0:00:17
717500 -- (-661.292) [-657.093] (-657.362) (-660.319) * (-658.492) (-662.359) [-656.168] (-656.281) -- 0:00:17
718000 -- (-657.938) (-657.869) [-659.395] (-657.202) * (-661.439) [-657.022] (-660.176) (-656.785) -- 0:00:17
718500 -- [-657.967] (-657.309) (-656.692) (-657.977) * (-659.217) [-657.033] (-657.176) (-656.777) -- 0:00:17
719000 -- (-656.686) (-658.606) (-659.470) [-656.352] * (-658.394) (-658.119) (-658.826) [-657.273] -- 0:00:17
719500 -- [-659.365] (-660.650) (-663.917) (-656.789) * (-657.981) (-657.466) [-658.671] (-656.757) -- 0:00:17
720000 -- (-659.602) (-656.367) [-660.302] (-657.603) * (-655.869) [-657.527] (-658.956) (-657.644) -- 0:00:17
Average standard deviation of split frequencies: 0.007890
720500 -- (-658.197) [-656.683] (-663.326) (-657.784) * (-656.162) [-663.967] (-656.943) (-660.681) -- 0:00:17
721000 -- (-657.739) (-656.627) (-658.797) [-659.652] * (-655.962) [-657.447] (-656.732) (-659.213) -- 0:00:17
721500 -- (-658.049) (-657.317) [-660.487] (-658.273) * (-658.988) (-656.520) [-658.828] (-657.341) -- 0:00:16
722000 -- [-657.901] (-657.276) (-664.633) (-658.814) * (-657.271) (-656.382) [-659.183] (-657.163) -- 0:00:16
722500 -- (-658.094) [-658.951] (-664.161) (-662.554) * [-657.950] (-655.420) (-657.739) (-655.813) -- 0:00:16
723000 -- (-656.887) (-656.000) [-660.400] (-661.577) * (-658.555) (-655.748) (-658.879) [-656.134] -- 0:00:16
723500 -- [-657.917] (-656.768) (-660.669) (-658.421) * [-661.291] (-655.757) (-657.602) (-656.913) -- 0:00:16
724000 -- (-657.043) [-656.254] (-660.133) (-657.920) * [-658.708] (-656.079) (-657.873) (-657.788) -- 0:00:16
724500 -- (-659.158) (-657.847) [-656.475] (-657.677) * [-656.141] (-657.820) (-658.124) (-656.869) -- 0:00:16
725000 -- (-664.058) [-656.367] (-658.290) (-655.955) * (-656.749) (-656.075) [-657.795] (-660.978) -- 0:00:16
Average standard deviation of split frequencies: 0.007792
725500 -- (-663.574) (-656.703) [-657.830] (-656.743) * [-656.791] (-657.590) (-656.597) (-663.527) -- 0:00:16
726000 -- (-658.597) [-658.076] (-658.977) (-658.096) * [-659.028] (-658.649) (-657.753) (-658.242) -- 0:00:16
726500 -- (-658.949) [-657.189] (-657.626) (-658.784) * (-658.579) (-657.212) [-656.345] (-656.858) -- 0:00:16
727000 -- (-657.536) (-656.788) (-661.397) [-657.344] * (-659.642) [-658.011] (-656.116) (-657.984) -- 0:00:16
727500 -- [-655.904] (-658.110) (-656.437) (-658.232) * (-656.558) [-659.119] (-657.126) (-660.300) -- 0:00:16
728000 -- (-662.962) (-662.193) (-657.196) [-656.457] * (-657.443) [-658.374] (-660.547) (-656.895) -- 0:00:16
728500 -- (-657.645) [-656.183] (-657.422) (-656.067) * [-656.539] (-655.895) (-661.429) (-658.397) -- 0:00:16
729000 -- (-658.327) [-659.503] (-657.061) (-656.128) * [-656.712] (-655.661) (-657.676) (-656.162) -- 0:00:16
729500 -- (-655.435) [-658.789] (-657.363) (-661.486) * (-656.614) (-655.620) [-657.255] (-656.582) -- 0:00:16
730000 -- (-657.731) (-660.382) [-659.794] (-657.603) * (-660.851) (-656.387) [-658.366] (-655.963) -- 0:00:16
Average standard deviation of split frequencies: 0.007218
730500 -- (-657.508) (-656.141) [-655.728] (-657.121) * [-660.593] (-657.178) (-658.946) (-656.125) -- 0:00:16
731000 -- [-656.301] (-658.317) (-656.289) (-658.401) * [-660.363] (-657.143) (-658.566) (-657.477) -- 0:00:16
731500 -- (-656.692) [-657.264] (-657.516) (-657.829) * (-658.282) [-658.917] (-656.718) (-659.808) -- 0:00:16
732000 -- [-656.712] (-657.167) (-656.140) (-661.596) * [-658.711] (-663.505) (-657.311) (-655.954) -- 0:00:16
732500 -- [-656.868] (-659.164) (-656.072) (-659.324) * [-659.805] (-659.744) (-656.864) (-658.677) -- 0:00:16
733000 -- (-658.173) (-659.101) (-659.468) [-658.140] * (-658.196) (-657.645) (-656.711) [-658.100] -- 0:00:16
733500 -- (-656.540) (-655.558) (-656.092) [-658.124] * (-660.724) (-656.777) (-657.155) [-659.168] -- 0:00:16
734000 -- (-658.694) (-661.337) [-655.878] (-656.267) * (-661.229) (-657.720) [-658.670] (-657.768) -- 0:00:16
734500 -- (-656.823) (-666.817) (-657.518) [-657.952] * (-656.982) (-655.788) (-660.192) [-656.459] -- 0:00:16
735000 -- [-656.437] (-656.489) (-658.389) (-656.392) * [-658.770] (-657.857) (-661.969) (-657.659) -- 0:00:16
Average standard deviation of split frequencies: 0.007286
735500 -- (-657.659) [-656.773] (-657.688) (-660.301) * (-658.139) [-662.913] (-656.770) (-658.451) -- 0:00:16
736000 -- (-657.807) (-658.403) [-656.467] (-655.591) * (-657.022) (-657.033) [-658.348] (-657.217) -- 0:00:16
736500 -- (-662.196) [-656.988] (-657.896) (-656.548) * [-657.701] (-658.508) (-658.501) (-658.305) -- 0:00:16
737000 -- [-660.202] (-658.308) (-655.930) (-657.189) * (-656.760) [-655.864] (-660.292) (-658.496) -- 0:00:16
737500 -- [-657.184] (-657.793) (-659.584) (-656.233) * (-658.480) [-655.951] (-660.342) (-657.415) -- 0:00:16
738000 -- (-656.728) [-660.720] (-661.114) (-663.244) * (-662.102) [-657.377] (-659.316) (-660.947) -- 0:00:15
738500 -- (-655.806) (-657.366) [-659.903] (-658.329) * (-665.974) [-660.585] (-664.283) (-657.732) -- 0:00:15
739000 -- (-659.084) (-656.620) [-657.084] (-658.241) * (-661.440) [-658.423] (-663.763) (-656.342) -- 0:00:15
739500 -- (-658.245) (-661.360) [-657.754] (-657.351) * (-661.398) (-659.051) (-659.275) [-656.107] -- 0:00:15
740000 -- (-659.858) [-656.909] (-658.818) (-657.743) * [-655.585] (-656.404) (-663.211) (-664.471) -- 0:00:15
Average standard deviation of split frequencies: 0.007081
740500 -- (-660.046) [-656.551] (-659.553) (-658.095) * [-655.802] (-656.153) (-662.195) (-660.318) -- 0:00:15
741000 -- (-664.541) (-656.655) [-658.302] (-660.031) * (-657.255) (-658.453) [-659.123] (-660.472) -- 0:00:15
741500 -- (-657.194) [-657.569] (-660.189) (-661.482) * (-656.123) (-660.534) (-659.109) [-658.543] -- 0:00:15
742000 -- (-657.084) [-656.475] (-656.405) (-655.730) * [-656.499] (-657.024) (-656.277) (-657.262) -- 0:00:15
742500 -- [-658.964] (-656.057) (-656.518) (-656.508) * [-656.256] (-657.323) (-658.355) (-660.704) -- 0:00:15
743000 -- (-656.875) [-657.914] (-659.757) (-658.170) * [-656.046] (-658.614) (-657.314) (-660.348) -- 0:00:15
743500 -- [-658.167] (-655.601) (-657.822) (-663.771) * (-658.256) (-662.144) [-657.879] (-657.325) -- 0:00:15
744000 -- (-656.656) (-656.287) [-657.266] (-660.112) * [-657.073] (-658.223) (-656.044) (-660.104) -- 0:00:15
744500 -- (-656.041) (-656.532) [-657.264] (-658.400) * (-656.098) [-658.994] (-663.243) (-656.510) -- 0:00:15
745000 -- [-656.882] (-657.232) (-657.548) (-658.741) * (-656.978) (-659.168) [-656.057] (-656.355) -- 0:00:15
Average standard deviation of split frequencies: 0.006872
745500 -- (-656.840) (-663.636) (-661.058) [-656.760] * (-658.074) [-658.210] (-660.962) (-657.196) -- 0:00:15
746000 -- (-657.009) [-659.102] (-656.457) (-657.062) * (-657.755) [-659.703] (-661.551) (-657.817) -- 0:00:15
746500 -- (-662.237) [-658.559] (-656.512) (-656.677) * (-657.673) (-657.165) (-656.728) [-659.746] -- 0:00:15
747000 -- (-658.933) [-656.514] (-656.321) (-657.264) * [-656.856] (-657.504) (-658.487) (-661.888) -- 0:00:15
747500 -- (-657.922) [-656.557] (-660.391) (-657.785) * (-657.851) (-657.271) [-656.605] (-660.152) -- 0:00:15
748000 -- (-656.826) [-655.882] (-660.363) (-659.914) * (-657.825) (-659.499) [-657.998] (-663.400) -- 0:00:15
748500 -- (-656.677) (-657.907) [-658.018] (-658.029) * [-657.448] (-657.312) (-656.403) (-657.422) -- 0:00:15
749000 -- (-662.237) [-658.515] (-658.410) (-660.843) * (-657.327) (-662.483) [-656.411] (-659.625) -- 0:00:15
749500 -- (-663.155) [-658.340] (-658.679) (-662.337) * (-658.962) (-658.818) [-656.645] (-656.590) -- 0:00:15
750000 -- (-659.347) (-662.323) [-659.399] (-656.881) * (-659.098) [-656.567] (-655.448) (-655.379) -- 0:00:15
Average standard deviation of split frequencies: 0.007203
750500 -- (-658.636) (-663.431) (-660.722) [-656.498] * (-656.861) (-656.678) (-656.956) [-655.869] -- 0:00:15
751000 -- [-656.814] (-659.265) (-658.514) (-656.627) * (-658.004) (-658.359) (-659.861) [-660.565] -- 0:00:15
751500 -- (-659.858) (-660.225) [-656.374] (-661.565) * (-660.176) (-659.156) [-656.866] (-658.368) -- 0:00:15
752000 -- [-655.665] (-657.133) (-656.932) (-660.245) * (-657.377) [-659.332] (-657.911) (-659.247) -- 0:00:15
752500 -- [-656.015] (-657.691) (-657.090) (-656.842) * (-660.203) [-660.016] (-657.440) (-655.975) -- 0:00:15
753000 -- (-656.670) [-656.841] (-659.957) (-660.309) * (-657.127) (-660.348) (-660.841) [-657.237] -- 0:00:15
753500 -- (-660.448) (-657.496) (-655.703) [-655.934] * (-657.890) (-662.577) [-658.643] (-656.949) -- 0:00:15
754000 -- (-659.531) [-657.196] (-658.766) (-655.564) * (-657.051) (-661.384) [-659.911] (-659.740) -- 0:00:15
754500 -- [-659.899] (-657.522) (-657.050) (-655.807) * (-657.174) [-659.962] (-661.887) (-657.468) -- 0:00:14
755000 -- [-658.626] (-655.386) (-658.673) (-658.547) * (-655.779) [-657.817] (-656.409) (-659.440) -- 0:00:14
Average standard deviation of split frequencies: 0.007483
755500 -- [-656.386] (-656.336) (-657.278) (-659.141) * (-661.639) (-658.055) [-658.437] (-659.766) -- 0:00:14
756000 -- (-659.630) (-656.745) [-658.605] (-656.551) * (-658.633) (-656.101) [-656.185] (-657.005) -- 0:00:14
756500 -- [-661.863] (-657.223) (-657.918) (-656.906) * (-656.202) [-656.375] (-659.054) (-658.770) -- 0:00:14
757000 -- (-657.065) [-656.751] (-656.118) (-656.878) * (-660.595) (-658.845) (-657.175) [-658.123] -- 0:00:14
757500 -- (-657.438) [-656.020] (-661.172) (-657.039) * (-657.637) (-655.738) [-657.052] (-658.447) -- 0:00:14
758000 -- (-657.241) (-656.508) [-656.913] (-656.396) * [-659.296] (-656.145) (-657.093) (-658.630) -- 0:00:14
758500 -- [-658.764] (-657.253) (-658.429) (-658.368) * [-660.707] (-659.256) (-656.151) (-658.537) -- 0:00:14
759000 -- (-659.651) (-657.501) [-660.807] (-655.960) * (-655.658) (-658.733) (-657.336) [-657.674] -- 0:00:14
759500 -- (-657.963) [-657.094] (-659.494) (-659.405) * [-655.975] (-656.144) (-657.204) (-657.878) -- 0:00:14
760000 -- (-657.869) (-657.625) [-657.135] (-663.114) * [-658.160] (-656.970) (-656.470) (-660.659) -- 0:00:14
Average standard deviation of split frequencies: 0.007182
760500 -- (-658.369) [-657.442] (-660.536) (-657.482) * (-657.561) [-658.711] (-656.308) (-658.182) -- 0:00:14
761000 -- (-663.286) [-656.860] (-659.669) (-659.327) * (-662.102) [-657.041] (-657.569) (-656.986) -- 0:00:14
761500 -- (-657.635) (-657.715) (-663.942) [-659.267] * (-658.430) (-655.936) [-657.669] (-657.231) -- 0:00:14
762000 -- (-656.575) [-658.188] (-656.727) (-657.397) * (-657.740) (-658.796) [-659.285] (-660.223) -- 0:00:14
762500 -- (-661.629) (-656.398) (-656.828) [-656.548] * [-656.562] (-657.912) (-658.868) (-657.834) -- 0:00:14
763000 -- (-659.480) (-657.809) [-655.715] (-659.341) * (-656.806) (-660.123) [-657.008] (-661.470) -- 0:00:14
763500 -- (-658.750) (-660.142) [-656.728] (-658.200) * (-657.202) (-657.646) [-657.733] (-657.494) -- 0:00:14
764000 -- [-659.797] (-658.137) (-657.908) (-658.416) * (-662.099) (-656.334) (-659.398) [-665.236] -- 0:00:14
764500 -- (-657.611) [-657.230] (-656.121) (-658.729) * (-658.147) (-656.435) [-656.598] (-661.118) -- 0:00:14
765000 -- [-658.891] (-660.270) (-657.635) (-659.377) * (-657.232) (-660.073) (-658.491) [-656.464] -- 0:00:14
Average standard deviation of split frequencies: 0.008109
765500 -- [-659.238] (-656.882) (-658.760) (-661.005) * (-656.096) (-659.324) (-660.397) [-657.501] -- 0:00:14
766000 -- (-658.903) (-657.802) [-658.108] (-656.621) * (-656.687) (-656.998) [-656.023] (-658.314) -- 0:00:14
766500 -- (-660.010) [-655.946] (-666.886) (-657.848) * (-657.816) (-659.983) (-656.339) [-657.674] -- 0:00:14
767000 -- (-662.096) (-656.433) (-657.945) [-657.245] * (-656.978) [-658.350] (-656.354) (-657.040) -- 0:00:14
767500 -- (-657.567) [-657.511] (-660.213) (-656.472) * (-659.073) (-655.892) [-656.095] (-656.212) -- 0:00:14
768000 -- (-658.714) [-656.892] (-655.475) (-658.476) * (-658.985) (-657.354) [-656.003] (-656.867) -- 0:00:14
768500 -- (-659.249) (-656.311) (-658.096) [-658.937] * (-658.963) (-657.664) (-657.519) [-655.553] -- 0:00:14
769000 -- [-659.578] (-660.158) (-656.330) (-658.710) * (-659.908) (-657.525) (-658.719) [-658.765] -- 0:00:14
769500 -- (-660.852) (-658.439) [-657.973] (-660.435) * (-659.193) (-655.680) (-656.063) [-658.503] -- 0:00:14
770000 -- (-659.734) (-658.196) [-655.600] (-658.134) * [-656.332] (-658.393) (-659.694) (-658.797) -- 0:00:14
Average standard deviation of split frequencies: 0.008204
770500 -- (-657.788) [-657.630] (-658.578) (-658.426) * (-657.900) [-657.704] (-663.864) (-656.485) -- 0:00:13
771000 -- [-657.105] (-658.116) (-656.448) (-656.875) * (-656.207) (-657.424) [-656.067] (-657.372) -- 0:00:13
771500 -- (-656.579) (-661.880) [-656.816] (-656.929) * (-656.919) (-660.754) (-658.195) [-656.878] -- 0:00:13
772000 -- (-658.448) [-659.482] (-658.455) (-660.373) * (-656.713) [-660.466] (-656.423) (-657.323) -- 0:00:13
772500 -- (-658.382) (-659.676) (-659.447) [-657.338] * (-657.089) (-661.427) [-658.639] (-657.197) -- 0:00:13
773000 -- (-658.450) (-658.003) [-655.796] (-660.990) * (-657.105) (-657.757) (-657.578) [-657.603] -- 0:00:13
773500 -- (-658.034) (-658.326) (-655.718) [-664.063] * [-657.687] (-665.204) (-657.700) (-657.572) -- 0:00:13
774000 -- [-657.134] (-656.988) (-658.306) (-660.966) * (-656.512) (-659.847) (-659.237) [-655.813] -- 0:00:13
774500 -- (-655.893) [-657.183] (-657.869) (-656.094) * (-656.171) (-656.356) [-656.651] (-657.131) -- 0:00:13
775000 -- [-658.021] (-656.693) (-655.997) (-658.017) * (-657.588) [-662.233] (-660.927) (-656.239) -- 0:00:13
Average standard deviation of split frequencies: 0.008543
775500 -- (-659.015) [-655.994] (-655.615) (-656.763) * (-660.386) [-663.096] (-657.073) (-658.549) -- 0:00:13
776000 -- (-656.370) (-655.984) (-659.251) [-657.500] * [-658.918] (-657.855) (-656.894) (-657.030) -- 0:00:13
776500 -- (-659.287) (-658.045) (-661.217) [-658.923] * (-662.026) (-657.360) (-657.443) [-663.065] -- 0:00:13
777000 -- (-659.207) [-657.489] (-658.958) (-657.782) * [-661.065] (-656.056) (-657.869) (-659.749) -- 0:00:13
777500 -- [-656.581] (-661.354) (-656.125) (-658.260) * (-657.298) [-657.517] (-658.303) (-658.010) -- 0:00:13
778000 -- (-661.119) [-657.052] (-659.857) (-657.209) * (-657.555) (-657.261) (-655.923) [-656.643] -- 0:00:13
778500 -- (-657.537) [-658.844] (-658.667) (-658.859) * (-657.898) [-655.761] (-657.110) (-657.305) -- 0:00:13
779000 -- (-658.138) (-657.941) [-658.666] (-660.785) * (-659.337) (-662.718) (-655.725) [-658.480] -- 0:00:13
779500 -- (-667.135) (-657.297) (-658.732) [-658.203] * (-657.916) [-657.048] (-659.122) (-658.453) -- 0:00:13
780000 -- (-658.457) (-657.485) [-658.220] (-655.926) * (-655.298) (-657.260) [-659.744] (-659.676) -- 0:00:13
Average standard deviation of split frequencies: 0.008982
780500 -- (-657.812) (-659.301) (-657.632) [-656.574] * (-657.616) [-656.414] (-660.391) (-659.872) -- 0:00:13
781000 -- (-658.089) [-656.965] (-656.396) (-655.851) * (-658.142) [-657.407] (-660.866) (-666.022) -- 0:00:13
781500 -- (-656.847) [-661.895] (-657.969) (-657.217) * (-658.254) [-658.209] (-656.425) (-658.377) -- 0:00:13
782000 -- (-658.681) (-660.784) (-657.111) [-656.228] * (-656.432) [-657.599] (-656.509) (-658.241) -- 0:00:13
782500 -- (-658.251) (-656.022) (-655.745) [-656.587] * (-658.052) (-658.930) (-657.656) [-655.748] -- 0:00:13
783000 -- (-658.883) (-656.031) [-655.480] (-656.003) * (-659.139) [-658.759] (-657.117) (-657.476) -- 0:00:13
783500 -- (-657.478) [-657.344] (-655.738) (-660.014) * [-657.714] (-656.035) (-657.945) (-657.385) -- 0:00:13
784000 -- (-656.597) [-657.680] (-657.469) (-656.905) * (-660.542) (-658.897) [-659.125] (-656.017) -- 0:00:13
784500 -- (-657.937) (-656.624) [-656.276] (-658.267) * (-660.859) (-657.217) (-659.385) [-656.392] -- 0:00:13
785000 -- [-658.843] (-656.346) (-657.339) (-660.097) * (-657.336) (-657.715) [-656.334] (-656.357) -- 0:00:13
Average standard deviation of split frequencies: 0.009420
785500 -- (-658.153) [-656.973] (-657.041) (-658.347) * (-656.849) [-656.848] (-656.795) (-657.251) -- 0:00:13
786000 -- [-661.264] (-657.923) (-657.985) (-656.963) * (-655.783) (-657.034) (-658.763) [-656.252] -- 0:00:13
786500 -- (-658.989) [-659.984] (-656.873) (-656.623) * (-658.331) [-660.659] (-660.128) (-657.719) -- 0:00:13
787000 -- [-658.678] (-658.003) (-655.978) (-659.996) * (-658.390) [-661.106] (-657.228) (-656.279) -- 0:00:12
787500 -- (-658.686) (-659.480) (-657.062) [-661.302] * (-656.810) [-660.008] (-658.370) (-657.642) -- 0:00:12
788000 -- [-658.882] (-659.632) (-656.798) (-657.857) * [-657.876] (-657.574) (-656.773) (-658.275) -- 0:00:12
788500 -- (-656.744) (-657.907) (-656.891) [-657.782] * [-658.124] (-658.618) (-658.214) (-656.535) -- 0:00:12
789000 -- (-660.493) (-657.537) (-657.519) [-659.272] * [-656.457] (-656.831) (-657.535) (-656.550) -- 0:00:12
789500 -- [-657.267] (-657.197) (-657.325) (-659.744) * (-658.496) (-656.898) (-656.774) [-662.087] -- 0:00:12
790000 -- (-657.936) (-657.407) [-657.206] (-658.529) * (-660.254) (-657.948) [-657.713] (-658.886) -- 0:00:12
Average standard deviation of split frequencies: 0.009680
790500 -- [-656.072] (-662.097) (-658.720) (-659.418) * (-658.915) [-657.181] (-657.133) (-658.366) -- 0:00:12
791000 -- (-657.887) (-658.363) [-655.878] (-659.597) * [-656.434] (-657.425) (-656.579) (-658.664) -- 0:00:12
791500 -- (-656.841) (-658.345) [-664.315] (-657.194) * [-656.246] (-655.755) (-660.247) (-656.670) -- 0:00:12
792000 -- (-658.368) [-658.542] (-655.834) (-657.290) * (-657.637) (-656.480) [-660.960] (-658.264) -- 0:00:12
792500 -- (-657.092) (-657.447) [-655.795] (-657.150) * (-661.962) (-658.315) [-660.146] (-657.583) -- 0:00:12
793000 -- (-658.929) [-658.117] (-656.702) (-656.225) * (-662.177) (-665.414) (-658.665) [-659.826] -- 0:00:12
793500 -- [-659.478] (-659.979) (-657.369) (-658.726) * (-660.216) (-659.891) (-660.627) [-659.106] -- 0:00:12
794000 -- (-657.427) (-662.329) (-658.082) [-656.946] * [-659.726] (-658.707) (-657.005) (-658.977) -- 0:00:12
794500 -- [-657.503] (-660.857) (-664.102) (-656.429) * (-657.373) [-658.700] (-657.693) (-660.318) -- 0:00:12
795000 -- (-658.009) [-660.179] (-665.426) (-655.737) * (-657.312) (-657.258) (-655.797) [-656.342] -- 0:00:12
Average standard deviation of split frequencies: 0.009824
795500 -- (-659.094) (-658.241) [-657.604] (-657.812) * (-663.674) (-659.760) [-655.711] (-656.600) -- 0:00:12
796000 -- (-657.483) (-657.099) [-656.641] (-665.403) * (-660.290) [-657.438] (-655.980) (-658.012) -- 0:00:12
796500 -- (-657.052) (-657.810) (-659.090) [-657.749] * (-657.072) [-657.394] (-657.045) (-658.100) -- 0:00:12
797000 -- (-658.391) [-656.921] (-659.296) (-659.472) * [-658.050] (-658.154) (-658.700) (-656.011) -- 0:00:12
797500 -- [-656.594] (-658.742) (-658.354) (-656.350) * (-659.797) [-657.208] (-659.325) (-657.190) -- 0:00:12
798000 -- [-656.994] (-657.262) (-656.737) (-657.864) * (-657.830) (-655.461) [-658.941] (-656.938) -- 0:00:12
798500 -- (-660.326) (-656.046) [-655.830] (-659.262) * (-657.479) (-655.976) (-658.795) [-657.953] -- 0:00:12
799000 -- [-658.912] (-655.775) (-657.975) (-657.061) * (-656.761) [-655.717] (-657.762) (-658.876) -- 0:00:12
799500 -- (-656.729) (-660.199) [-658.223] (-657.251) * (-657.457) (-659.133) [-658.720] (-659.482) -- 0:00:12
800000 -- (-658.955) (-659.415) [-660.986] (-657.983) * (-656.743) [-659.457] (-659.434) (-663.173) -- 0:00:12
Average standard deviation of split frequencies: 0.009236
800500 -- (-658.465) (-658.175) [-656.566] (-657.975) * (-657.591) [-656.527] (-656.308) (-658.525) -- 0:00:12
801000 -- (-656.710) (-657.008) (-656.318) [-655.953] * [-656.998] (-661.522) (-658.021) (-656.205) -- 0:00:12
801500 -- (-655.487) (-657.540) (-657.379) [-655.966] * (-656.789) (-661.179) [-656.689] (-658.266) -- 0:00:12
802000 -- (-655.465) (-658.303) (-662.274) [-656.495] * (-659.122) (-657.066) [-657.162] (-658.126) -- 0:00:12
802500 -- (-655.876) (-657.621) (-662.117) [-656.393] * [-658.647] (-660.889) (-657.144) (-661.268) -- 0:00:12
803000 -- [-656.456] (-655.760) (-655.648) (-658.608) * (-658.431) [-659.880] (-656.808) (-660.427) -- 0:00:12
803500 -- (-657.177) [-658.355] (-655.721) (-657.675) * (-657.111) (-659.678) [-657.576] (-657.205) -- 0:00:11
804000 -- (-659.360) [-659.266] (-659.585) (-661.692) * (-659.403) (-658.409) (-657.298) [-656.771] -- 0:00:11
804500 -- (-659.529) [-657.770] (-662.764) (-659.648) * (-656.876) (-659.193) [-664.331] (-661.007) -- 0:00:11
805000 -- (-660.661) (-658.643) [-663.956] (-658.817) * (-657.836) (-656.549) [-659.211] (-657.171) -- 0:00:11
Average standard deviation of split frequencies: 0.009564
805500 -- (-664.743) [-657.391] (-659.468) (-658.907) * (-658.458) [-656.779] (-659.012) (-656.782) -- 0:00:11
806000 -- [-657.658] (-656.246) (-657.660) (-660.006) * [-658.884] (-656.543) (-656.886) (-660.759) -- 0:00:11
806500 -- (-656.044) (-657.803) (-658.227) [-657.464] * (-660.510) (-656.507) [-659.165] (-657.315) -- 0:00:11
807000 -- (-656.410) (-657.865) [-659.367] (-657.912) * [-657.961] (-658.132) (-656.247) (-663.058) -- 0:00:11
807500 -- (-659.241) (-658.641) [-657.087] (-656.793) * (-656.796) (-659.266) (-657.401) [-656.577] -- 0:00:11
808000 -- (-659.829) (-660.517) [-658.646] (-656.406) * (-660.598) [-656.624] (-658.490) (-656.785) -- 0:00:11
808500 -- [-656.326] (-662.484) (-658.993) (-658.685) * [-664.016] (-657.718) (-659.113) (-657.227) -- 0:00:11
809000 -- [-659.709] (-657.195) (-659.537) (-658.005) * (-662.636) (-657.104) [-657.629] (-657.520) -- 0:00:11
809500 -- (-659.071) (-655.809) (-658.393) [-657.788] * (-656.438) (-656.334) (-660.428) [-660.524] -- 0:00:11
810000 -- (-659.756) (-655.670) (-659.671) [-655.688] * (-657.847) [-656.354] (-656.807) (-657.622) -- 0:00:11
Average standard deviation of split frequencies: 0.009099
810500 -- (-660.156) (-656.324) (-656.432) [-656.460] * [-657.043] (-657.434) (-656.486) (-657.483) -- 0:00:11
811000 -- (-656.549) (-657.808) (-656.291) [-658.933] * (-657.248) (-659.958) (-661.347) [-659.158] -- 0:00:11
811500 -- [-657.046] (-657.543) (-656.411) (-660.686) * (-657.164) (-658.780) (-658.390) [-656.612] -- 0:00:11
812000 -- (-658.389) (-656.835) [-657.497] (-659.058) * (-658.365) (-659.551) (-656.448) [-660.250] -- 0:00:11
812500 -- (-660.760) (-659.027) [-658.137] (-657.246) * (-658.102) [-657.579] (-656.785) (-660.599) -- 0:00:11
813000 -- [-658.721] (-657.865) (-658.127) (-656.866) * (-663.312) (-663.163) (-655.780) [-657.211] -- 0:00:11
813500 -- (-658.357) (-660.339) (-658.501) [-657.206] * (-664.540) (-658.135) [-655.547] (-657.902) -- 0:00:11
814000 -- (-658.327) (-658.930) [-659.772] (-658.595) * [-659.844] (-660.728) (-657.703) (-659.911) -- 0:00:11
814500 -- [-656.077] (-657.847) (-660.734) (-656.833) * [-656.171] (-658.718) (-658.577) (-659.092) -- 0:00:11
815000 -- [-657.383] (-658.129) (-660.056) (-656.244) * (-655.823) [-656.341] (-656.503) (-657.403) -- 0:00:11
Average standard deviation of split frequencies: 0.009063
815500 -- (-657.538) (-659.020) [-660.915] (-659.254) * [-657.230] (-658.512) (-657.661) (-658.488) -- 0:00:11
816000 -- (-657.405) (-656.897) (-661.415) [-656.875] * (-657.031) [-658.490] (-656.363) (-661.338) -- 0:00:11
816500 -- [-659.205] (-659.829) (-657.517) (-657.553) * [-656.355] (-658.414) (-656.350) (-658.193) -- 0:00:11
817000 -- (-657.731) (-657.060) (-660.673) [-656.865] * [-656.298] (-657.108) (-659.980) (-656.642) -- 0:00:10
817500 -- (-657.595) (-657.853) (-662.634) [-656.708] * (-657.187) [-656.841] (-658.187) (-656.178) -- 0:00:11
818000 -- (-656.829) (-661.032) (-659.145) [-656.388] * (-657.087) (-659.328) [-659.071] (-661.590) -- 0:00:11
818500 -- [-657.257] (-659.141) (-660.563) (-656.227) * [-657.857] (-656.151) (-661.543) (-658.879) -- 0:00:11
819000 -- (-659.376) [-658.642] (-657.869) (-658.039) * (-660.152) (-656.268) (-662.285) [-660.649] -- 0:00:11
819500 -- (-658.768) (-656.126) [-657.125] (-656.912) * (-658.662) (-656.994) (-658.996) [-659.321] -- 0:00:11
820000 -- (-657.156) (-658.788) (-657.865) [-659.778] * [-657.608] (-656.410) (-656.328) (-658.978) -- 0:00:10
Average standard deviation of split frequencies: 0.008329
820500 -- (-657.306) [-656.356] (-660.216) (-659.345) * (-656.478) [-656.848] (-661.121) (-656.662) -- 0:00:10
821000 -- [-658.989] (-657.905) (-665.842) (-656.721) * (-655.995) (-657.266) (-658.696) [-659.147] -- 0:00:10
821500 -- [-661.744] (-659.072) (-657.724) (-657.523) * (-660.456) (-656.099) (-657.649) [-655.978] -- 0:00:10
822000 -- (-657.838) (-659.020) [-658.230] (-657.226) * (-664.313) (-657.101) (-657.751) [-657.307] -- 0:00:10
822500 -- [-657.990] (-659.646) (-657.424) (-658.233) * [-656.288] (-657.175) (-656.576) (-658.931) -- 0:00:10
823000 -- (-659.552) (-657.746) (-659.416) [-658.748] * (-658.575) (-658.058) [-656.233] (-658.345) -- 0:00:10
823500 -- (-658.172) (-657.921) [-657.143] (-661.113) * (-657.691) (-656.924) (-657.520) [-655.660] -- 0:00:10
824000 -- (-659.226) (-656.051) (-660.874) [-661.685] * (-662.063) (-656.844) [-656.862] (-658.712) -- 0:00:10
824500 -- [-656.866] (-659.129) (-657.413) (-659.745) * [-657.256] (-656.897) (-659.650) (-658.060) -- 0:00:10
825000 -- (-658.593) [-656.072] (-657.189) (-657.010) * [-657.563] (-658.277) (-660.432) (-658.455) -- 0:00:10
Average standard deviation of split frequencies: 0.008896
825500 -- (-657.132) [-656.559] (-658.461) (-659.252) * [-657.514] (-662.863) (-657.950) (-657.484) -- 0:00:10
826000 -- (-658.348) (-656.643) [-655.671] (-656.880) * (-659.218) (-656.841) (-658.124) [-657.019] -- 0:00:10
826500 -- (-657.084) [-659.094] (-655.888) (-659.776) * [-657.868] (-658.157) (-658.064) (-656.602) -- 0:00:10
827000 -- (-657.486) (-656.304) (-656.508) [-656.927] * (-657.758) [-656.580] (-661.838) (-657.132) -- 0:00:10
827500 -- [-657.743] (-656.975) (-659.754) (-666.380) * (-660.716) (-658.763) (-659.248) [-657.360] -- 0:00:10
828000 -- (-656.484) [-657.242] (-657.985) (-656.812) * (-656.950) (-656.830) (-659.777) [-657.992] -- 0:00:10
828500 -- (-658.880) [-659.603] (-660.193) (-657.942) * (-657.840) [-657.132] (-660.962) (-658.826) -- 0:00:10
829000 -- [-658.596] (-657.352) (-656.874) (-656.682) * (-658.183) [-656.616] (-661.195) (-656.925) -- 0:00:10
829500 -- [-657.652] (-656.006) (-657.319) (-660.037) * (-659.191) [-657.113] (-660.763) (-656.961) -- 0:00:10
830000 -- (-656.867) (-655.533) (-656.588) [-660.643] * [-656.881] (-656.862) (-655.909) (-655.968) -- 0:00:10
Average standard deviation of split frequencies: 0.008613
830500 -- (-658.601) (-661.095) (-659.391) [-656.722] * (-655.831) [-656.313] (-657.321) (-657.829) -- 0:00:10
831000 -- (-658.074) (-660.117) [-658.487] (-657.281) * (-656.129) (-656.422) [-657.461] (-657.330) -- 0:00:10
831500 -- [-658.593] (-658.698) (-659.431) (-657.122) * (-657.170) (-657.261) [-656.845] (-656.822) -- 0:00:10
832000 -- (-658.462) [-656.882] (-655.891) (-662.155) * [-658.923] (-655.996) (-657.636) (-657.872) -- 0:00:10
832500 -- [-656.166] (-656.143) (-660.835) (-657.683) * (-657.076) (-656.175) [-658.286] (-656.778) -- 0:00:10
833000 -- (-657.896) (-656.540) [-655.821] (-657.198) * [-657.658] (-657.547) (-658.234) (-656.975) -- 0:00:10
833500 -- (-658.104) (-655.915) [-658.518] (-658.758) * [-658.141] (-659.171) (-659.000) (-657.536) -- 0:00:09
834000 -- (-659.391) (-656.237) (-658.864) [-657.187] * (-655.961) (-657.601) (-657.410) [-655.761] -- 0:00:10
834500 -- (-656.268) (-657.424) [-658.109] (-658.163) * (-656.667) (-656.873) (-658.290) [-659.278] -- 0:00:10
835000 -- [-658.114] (-656.000) (-657.946) (-659.125) * (-659.206) [-659.183] (-658.157) (-657.617) -- 0:00:10
Average standard deviation of split frequencies: 0.009122
835500 -- [-658.605] (-660.070) (-661.760) (-659.178) * [-656.705] (-658.198) (-658.886) (-662.473) -- 0:00:10
836000 -- (-656.686) [-656.295] (-660.125) (-658.538) * (-657.361) (-658.001) (-657.914) [-659.857] -- 0:00:10
836500 -- [-656.815] (-658.762) (-660.175) (-657.494) * (-658.459) (-656.020) (-657.835) [-656.554] -- 0:00:09
837000 -- (-656.819) (-656.571) (-664.739) [-662.640] * (-657.472) [-657.543] (-658.765) (-656.526) -- 0:00:09
837500 -- (-659.020) (-656.868) (-658.598) [-660.244] * (-658.284) (-658.781) [-659.326] (-659.960) -- 0:00:09
838000 -- [-657.417] (-656.657) (-659.130) (-660.969) * [-657.583] (-658.431) (-661.142) (-664.511) -- 0:00:09
838500 -- (-657.228) [-655.652] (-661.424) (-657.503) * (-662.199) (-662.243) (-656.566) [-664.325] -- 0:00:09
839000 -- [-663.402] (-656.793) (-664.044) (-656.041) * (-659.989) [-657.570] (-665.220) (-658.224) -- 0:00:09
839500 -- [-661.987] (-663.417) (-657.415) (-656.785) * [-661.537] (-657.478) (-661.865) (-658.557) -- 0:00:09
840000 -- (-658.149) [-657.632] (-656.975) (-658.077) * (-660.182) (-656.811) (-660.912) [-656.604] -- 0:00:09
Average standard deviation of split frequencies: 0.009368
840500 -- (-659.509) (-658.326) (-656.999) [-657.920] * [-659.450] (-658.275) (-659.979) (-658.393) -- 0:00:09
841000 -- (-656.609) (-663.897) [-656.764] (-662.867) * (-658.150) (-659.479) [-657.394] (-657.344) -- 0:00:09
841500 -- (-657.953) (-662.074) (-656.319) [-656.711] * (-658.161) [-656.524] (-656.579) (-660.511) -- 0:00:09
842000 -- [-659.451] (-658.620) (-658.108) (-658.296) * [-657.452] (-656.435) (-656.647) (-661.503) -- 0:00:09
842500 -- [-658.587] (-660.386) (-659.284) (-656.925) * [-656.429] (-657.650) (-659.672) (-656.374) -- 0:00:09
843000 -- (-659.354) (-655.814) (-663.027) [-656.484] * (-657.914) (-660.546) (-664.397) [-655.938] -- 0:00:09
843500 -- [-659.093] (-656.974) (-660.936) (-659.581) * [-657.335] (-657.599) (-659.292) (-665.361) -- 0:00:09
844000 -- (-657.493) (-657.359) [-657.244] (-658.352) * [-656.829] (-658.750) (-661.030) (-657.716) -- 0:00:09
844500 -- (-658.836) (-659.414) (-655.787) [-656.112] * (-662.099) (-657.973) (-659.059) [-656.405] -- 0:00:09
845000 -- (-659.860) [-655.768] (-656.321) (-662.766) * [-656.806] (-658.251) (-659.592) (-656.551) -- 0:00:09
Average standard deviation of split frequencies: 0.009538
845500 -- [-658.303] (-656.360) (-658.212) (-657.995) * (-663.419) [-657.915] (-656.491) (-657.890) -- 0:00:09
846000 -- (-658.400) (-655.999) [-656.585] (-658.000) * (-660.332) (-658.719) [-656.137] (-660.676) -- 0:00:09
846500 -- [-658.764] (-659.550) (-663.511) (-656.092) * (-661.613) (-656.967) [-655.619] (-658.568) -- 0:00:09
847000 -- [-657.592] (-657.181) (-656.753) (-655.995) * (-656.322) [-658.175] (-658.347) (-657.324) -- 0:00:09
847500 -- [-657.798] (-657.113) (-657.242) (-660.192) * (-656.725) (-660.294) (-664.634) [-659.476] -- 0:00:09
848000 -- (-658.579) (-659.126) (-656.295) [-659.733] * (-656.656) [-657.732] (-656.497) (-656.951) -- 0:00:09
848500 -- [-658.635] (-656.421) (-657.283) (-657.156) * (-656.593) [-656.461] (-656.587) (-658.899) -- 0:00:09
849000 -- (-658.650) (-665.062) [-659.064] (-657.949) * (-657.993) [-656.404] (-660.484) (-659.458) -- 0:00:09
849500 -- (-659.116) (-662.669) [-656.033] (-659.133) * (-658.275) [-657.878] (-655.856) (-656.107) -- 0:00:09
850000 -- (-662.018) [-656.349] (-657.276) (-658.440) * (-655.771) (-660.150) (-660.785) [-657.076] -- 0:00:09
Average standard deviation of split frequencies: 0.009877
850500 -- (-659.293) (-662.756) (-656.010) [-656.527] * [-657.780] (-658.778) (-657.236) (-657.110) -- 0:00:08
851000 -- (-659.569) [-659.854] (-657.862) (-656.966) * (-655.879) (-655.663) (-657.087) [-657.640] -- 0:00:09
851500 -- [-657.492] (-657.081) (-656.740) (-657.517) * (-655.768) [-657.007] (-658.749) (-656.346) -- 0:00:09
852000 -- (-660.234) (-659.139) (-657.637) [-658.093] * (-656.705) (-662.952) (-662.769) [-657.213] -- 0:00:09
852500 -- [-656.427] (-657.219) (-657.010) (-657.938) * (-655.622) (-657.409) (-657.219) [-657.498] -- 0:00:08
853000 -- (-658.196) (-657.499) (-659.461) [-657.023] * [-657.693] (-656.916) (-660.028) (-658.190) -- 0:00:08
853500 -- (-659.756) (-659.036) (-662.627) [-657.009] * [-656.855] (-657.282) (-657.269) (-658.112) -- 0:00:08
854000 -- (-657.503) (-657.958) [-658.232] (-658.273) * (-657.023) (-656.707) [-657.634] (-658.974) -- 0:00:08
854500 -- (-657.632) [-658.414] (-656.596) (-658.884) * (-657.342) (-658.296) (-659.564) [-656.233] -- 0:00:08
855000 -- (-658.811) [-657.480] (-664.049) (-656.741) * (-657.062) (-657.722) [-657.550] (-660.587) -- 0:00:08
Average standard deviation of split frequencies: 0.009556
855500 -- [-659.631] (-658.718) (-663.514) (-659.986) * (-656.737) [-655.776] (-658.326) (-659.718) -- 0:00:08
856000 -- [-658.922] (-658.887) (-659.630) (-659.722) * (-656.664) [-656.065] (-658.332) (-657.186) -- 0:00:08
856500 -- (-657.206) [-656.328] (-658.651) (-659.775) * (-657.011) (-655.507) [-657.828] (-656.256) -- 0:00:08
857000 -- [-657.429] (-656.420) (-658.565) (-657.644) * (-658.240) [-656.383] (-660.338) (-659.885) -- 0:00:08
857500 -- (-656.164) (-657.601) [-655.697] (-656.327) * (-658.383) (-657.896) [-658.041] (-658.807) -- 0:00:08
858000 -- [-658.289] (-660.618) (-656.093) (-656.312) * (-658.558) (-658.699) [-661.357] (-657.744) -- 0:00:08
858500 -- (-657.245) (-658.761) (-659.532) [-658.851] * (-660.075) [-658.591] (-657.315) (-662.597) -- 0:00:08
859000 -- (-660.048) (-657.440) (-659.733) [-656.600] * (-660.730) [-657.050] (-660.957) (-660.625) -- 0:00:08
859500 -- (-657.025) (-657.233) (-659.867) [-656.398] * (-656.551) [-656.204] (-658.521) (-659.853) -- 0:00:08
860000 -- [-658.882] (-656.820) (-658.302) (-656.320) * [-657.409] (-655.405) (-656.848) (-659.839) -- 0:00:08
Average standard deviation of split frequencies: 0.009730
860500 -- (-656.796) (-656.724) (-663.379) [-656.807] * (-660.168) [-655.981] (-660.175) (-662.784) -- 0:00:08
861000 -- (-656.339) (-657.009) (-659.568) [-656.396] * (-657.968) (-657.191) (-657.837) [-660.180] -- 0:00:08
861500 -- [-657.509] (-657.902) (-661.696) (-656.068) * [-657.789] (-657.395) (-656.472) (-658.962) -- 0:00:08
862000 -- [-659.134] (-658.519) (-657.397) (-655.984) * [-658.076] (-656.076) (-657.083) (-665.548) -- 0:00:08
862500 -- (-660.424) [-657.253] (-656.920) (-656.675) * (-656.902) [-657.698] (-657.831) (-656.853) -- 0:00:08
863000 -- [-660.227] (-655.892) (-655.963) (-656.695) * (-658.450) (-656.544) (-658.272) [-656.494] -- 0:00:08
863500 -- [-658.040] (-657.532) (-663.399) (-659.237) * (-659.604) (-655.976) [-657.858] (-659.149) -- 0:00:08
864000 -- (-658.442) [-656.772] (-657.444) (-660.595) * [-659.615] (-658.552) (-657.003) (-657.529) -- 0:00:08
864500 -- (-659.342) (-658.795) [-656.213] (-658.529) * (-660.145) (-661.317) [-656.673] (-656.379) -- 0:00:08
865000 -- (-660.391) (-656.991) [-658.745] (-662.300) * (-655.638) (-660.199) (-657.261) [-656.205] -- 0:00:08
Average standard deviation of split frequencies: 0.009894
865500 -- [-657.179] (-659.669) (-658.428) (-656.835) * (-657.769) (-657.870) [-655.384] (-658.180) -- 0:00:08
866000 -- (-659.850) [-658.984] (-658.398) (-657.730) * (-658.004) [-656.448] (-656.312) (-665.257) -- 0:00:08
866500 -- [-660.966] (-659.186) (-656.525) (-655.676) * (-656.414) (-655.630) (-655.754) [-657.688] -- 0:00:08
867000 -- (-659.509) (-657.916) (-657.176) [-655.526] * (-658.578) [-659.278] (-659.794) (-658.939) -- 0:00:07
867500 -- (-661.687) (-656.305) (-656.037) [-657.620] * (-660.139) [-658.626] (-656.885) (-659.785) -- 0:00:08
868000 -- (-656.974) [-657.233] (-658.291) (-658.567) * [-656.945] (-656.035) (-658.490) (-657.352) -- 0:00:08
868500 -- (-656.732) (-655.976) [-661.385] (-656.734) * (-656.117) [-657.344] (-658.383) (-659.008) -- 0:00:08
869000 -- (-657.395) (-657.180) (-656.020) [-658.604] * (-661.149) [-658.490] (-656.393) (-660.548) -- 0:00:07
869500 -- (-657.668) (-656.302) (-657.495) [-657.072] * (-655.876) [-658.901] (-657.299) (-660.966) -- 0:00:07
870000 -- [-657.271] (-655.547) (-659.614) (-657.088) * (-657.969) (-658.716) (-660.084) [-660.980] -- 0:00:07
Average standard deviation of split frequencies: 0.010192
870500 -- (-656.848) (-656.550) [-656.735] (-657.841) * [-659.372] (-656.210) (-660.289) (-658.061) -- 0:00:07
871000 -- (-655.774) [-657.892] (-660.136) (-657.374) * [-656.893] (-657.874) (-659.753) (-657.684) -- 0:00:07
871500 -- (-664.811) (-659.020) (-660.434) [-657.037] * (-657.542) (-656.569) (-657.360) [-656.202] -- 0:00:07
872000 -- (-657.267) (-657.994) (-658.837) [-659.368] * (-658.194) (-656.773) (-656.727) [-657.026] -- 0:00:07
872500 -- [-656.322] (-656.995) (-657.982) (-657.536) * (-659.611) [-656.703] (-667.535) (-656.993) -- 0:00:07
873000 -- (-658.165) (-657.592) [-662.038] (-658.568) * (-658.668) (-660.137) [-657.001] (-661.793) -- 0:00:07
873500 -- (-655.865) [-657.878] (-659.310) (-659.527) * (-656.781) (-656.454) [-656.379] (-658.107) -- 0:00:07
874000 -- (-656.570) (-658.006) (-659.222) [-657.297] * (-659.139) [-658.891] (-657.926) (-658.462) -- 0:00:07
874500 -- [-656.269] (-663.005) (-660.755) (-656.568) * (-660.163) (-657.912) (-658.496) [-658.739] -- 0:00:07
875000 -- (-657.511) [-655.938] (-656.279) (-657.654) * (-659.631) [-657.528] (-656.312) (-656.771) -- 0:00:07
Average standard deviation of split frequencies: 0.009940
875500 -- (-656.997) (-658.432) [-656.752] (-659.189) * (-657.814) [-655.974] (-657.978) (-656.661) -- 0:00:07
876000 -- (-655.893) [-658.114] (-659.759) (-658.448) * (-656.788) [-656.567] (-657.122) (-657.464) -- 0:00:07
876500 -- (-657.004) (-656.686) [-657.438] (-656.428) * [-656.087] (-658.139) (-657.818) (-658.718) -- 0:00:07
877000 -- (-656.045) (-655.791) (-656.924) [-657.463] * [-657.200] (-659.760) (-657.405) (-658.043) -- 0:00:07
877500 -- [-656.241] (-655.834) (-656.377) (-658.219) * [-660.213] (-657.146) (-656.513) (-662.890) -- 0:00:07
878000 -- [-657.685] (-656.246) (-658.409) (-655.691) * (-659.004) [-661.709] (-657.236) (-658.298) -- 0:00:07
878500 -- (-658.048) (-658.111) (-659.688) [-656.217] * (-658.043) [-657.986] (-659.054) (-661.641) -- 0:00:07
879000 -- [-655.878] (-657.156) (-656.247) (-657.165) * (-658.922) (-655.937) (-659.326) [-656.694] -- 0:00:07
879500 -- (-655.685) [-657.133] (-658.108) (-656.837) * (-657.145) [-657.313] (-657.614) (-657.606) -- 0:00:07
880000 -- (-656.214) (-658.209) (-658.225) [-657.597] * (-657.203) (-662.587) (-656.940) [-659.029] -- 0:00:07
Average standard deviation of split frequencies: 0.010044
880500 -- (-658.108) (-659.914) [-660.988] (-657.526) * (-657.672) [-658.449] (-655.689) (-656.894) -- 0:00:07
881000 -- (-658.123) (-657.735) (-658.193) [-659.916] * [-657.876] (-658.722) (-658.969) (-660.515) -- 0:00:07
881500 -- (-657.663) (-656.932) [-658.177] (-659.514) * [-656.556] (-656.481) (-660.717) (-660.568) -- 0:00:07
882000 -- [-656.014] (-659.054) (-663.486) (-658.965) * (-660.394) [-657.093] (-656.371) (-657.417) -- 0:00:07
882500 -- [-658.157] (-656.847) (-662.833) (-656.178) * (-655.809) (-656.155) [-657.337] (-659.988) -- 0:00:07
883000 -- (-660.894) (-657.753) (-660.040) [-660.675] * (-658.182) (-656.091) [-657.640] (-659.568) -- 0:00:07
883500 -- [-657.636] (-659.249) (-658.652) (-661.150) * (-660.312) (-657.916) [-655.662] (-658.662) -- 0:00:06
884000 -- (-658.866) (-661.045) [-656.572] (-658.925) * [-659.644] (-659.323) (-655.645) (-660.357) -- 0:00:06
884500 -- (-655.829) (-658.017) (-656.707) [-655.612] * (-661.738) [-657.628] (-658.529) (-657.953) -- 0:00:07
885000 -- (-656.810) (-657.640) [-656.852] (-655.672) * (-658.732) (-663.982) (-659.693) [-659.916] -- 0:00:07
Average standard deviation of split frequencies: 0.010047
885500 -- (-657.179) [-658.270] (-660.275) (-655.550) * [-657.253] (-655.740) (-659.960) (-659.000) -- 0:00:06
886000 -- [-661.326] (-657.376) (-657.325) (-655.616) * (-656.582) (-657.969) (-658.336) [-658.127] -- 0:00:06
886500 -- [-656.624] (-657.194) (-657.333) (-656.114) * (-658.508) (-661.401) [-660.802] (-659.438) -- 0:00:06
887000 -- (-655.596) [-656.840] (-656.883) (-660.144) * (-657.585) (-658.606) [-657.939] (-658.165) -- 0:00:06
887500 -- [-656.656] (-656.510) (-659.086) (-657.007) * [-658.885] (-659.518) (-659.031) (-656.285) -- 0:00:06
888000 -- (-656.440) [-660.580] (-658.578) (-664.278) * [-658.248] (-656.964) (-659.198) (-657.316) -- 0:00:06
888500 -- (-657.928) [-659.131] (-656.499) (-659.142) * (-657.531) (-657.072) [-659.902] (-658.105) -- 0:00:06
889000 -- (-660.521) [-658.385] (-656.674) (-658.819) * (-658.465) [-662.281] (-658.406) (-660.122) -- 0:00:06
889500 -- (-655.781) (-657.595) [-658.131] (-656.265) * (-659.728) (-658.032) [-657.502] (-656.340) -- 0:00:06
890000 -- (-656.673) [-656.667] (-657.003) (-661.054) * (-657.170) [-657.270] (-660.974) (-658.830) -- 0:00:06
Average standard deviation of split frequencies: 0.009589
890500 -- (-656.086) (-657.176) [-656.553] (-655.994) * (-657.768) (-658.158) [-662.630] (-655.394) -- 0:00:06
891000 -- (-658.014) [-657.398] (-655.891) (-655.918) * (-657.975) [-657.502] (-660.792) (-662.729) -- 0:00:06
891500 -- (-656.361) [-657.575] (-657.268) (-665.336) * (-656.862) [-656.833] (-660.687) (-659.336) -- 0:00:06
892000 -- (-656.257) (-656.905) [-660.454] (-656.860) * (-659.991) (-658.579) [-655.759] (-657.693) -- 0:00:06
892500 -- (-661.223) [-656.512] (-659.092) (-656.452) * (-658.679) (-658.404) (-658.651) [-656.309] -- 0:00:06
893000 -- (-657.423) (-658.144) [-656.323] (-656.479) * (-656.063) (-658.656) (-658.291) [-660.998] -- 0:00:06
893500 -- (-657.740) (-657.062) (-659.921) [-656.398] * (-657.982) (-658.731) [-656.709] (-662.114) -- 0:00:06
894000 -- [-659.938] (-662.218) (-656.551) (-656.430) * (-658.723) (-660.995) [-657.847] (-656.564) -- 0:00:06
894500 -- (-658.094) (-656.392) [-658.615] (-661.181) * (-662.909) (-656.676) [-656.334] (-660.355) -- 0:00:06
895000 -- (-663.331) (-657.534) [-658.146] (-659.632) * (-658.559) (-656.989) [-658.264] (-657.352) -- 0:00:06
Average standard deviation of split frequencies: 0.009625
895500 -- [-657.347] (-658.722) (-660.010) (-659.170) * (-656.240) (-655.934) (-656.646) [-657.895] -- 0:00:06
896000 -- [-657.458] (-660.512) (-656.042) (-657.992) * (-658.706) (-656.291) (-656.074) [-655.755] -- 0:00:06
896500 -- (-659.744) (-658.105) [-659.789] (-662.151) * (-658.015) (-656.217) (-657.193) [-655.415] -- 0:00:06
897000 -- [-658.069] (-658.469) (-659.831) (-663.844) * (-659.909) (-656.189) (-656.542) [-655.676] -- 0:00:06
897500 -- [-658.405] (-656.363) (-658.110) (-659.944) * (-657.719) (-657.492) (-655.483) [-656.225] -- 0:00:06
898000 -- (-660.067) (-658.781) [-656.253] (-659.505) * (-661.179) (-657.901) [-657.654] (-659.115) -- 0:00:06
898500 -- (-658.023) (-658.950) (-656.894) [-656.128] * [-656.356] (-655.717) (-659.695) (-657.379) -- 0:00:06
899000 -- (-660.079) (-656.486) [-656.333] (-657.420) * [-655.789] (-656.485) (-656.197) (-659.745) -- 0:00:06
899500 -- (-658.238) (-656.578) [-655.919] (-656.081) * (-658.123) (-658.018) [-656.077] (-657.275) -- 0:00:06
900000 -- (-657.435) [-655.698] (-657.414) (-659.128) * (-656.972) [-661.069] (-655.974) (-659.383) -- 0:00:06
Average standard deviation of split frequencies: 0.009852
900500 -- [-655.961] (-656.755) (-658.355) (-655.784) * [-658.424] (-657.232) (-658.249) (-658.003) -- 0:00:05
901000 -- [-656.054] (-658.058) (-656.890) (-657.305) * (-657.915) (-656.499) [-659.091] (-658.338) -- 0:00:06
901500 -- [-656.907] (-656.506) (-656.768) (-660.353) * (-663.610) (-659.332) (-659.737) [-655.490] -- 0:00:06
902000 -- [-659.471] (-660.435) (-659.021) (-657.686) * (-661.274) (-660.415) [-658.477] (-656.656) -- 0:00:05
902500 -- (-658.524) (-659.542) (-656.926) [-658.378] * (-658.377) (-660.274) [-655.431] (-656.088) -- 0:00:05
903000 -- (-656.562) (-659.497) [-655.910] (-658.915) * (-657.431) [-657.406] (-656.590) (-656.695) -- 0:00:05
903500 -- (-655.544) [-658.254] (-657.951) (-663.333) * (-660.417) [-657.440] (-656.008) (-658.796) -- 0:00:05
904000 -- (-658.665) (-657.587) [-657.269] (-659.997) * [-656.329] (-657.475) (-656.351) (-656.986) -- 0:00:05
904500 -- (-658.854) (-659.221) (-656.687) [-655.996] * [-658.462] (-656.965) (-657.022) (-657.713) -- 0:00:05
905000 -- (-659.610) (-659.308) [-661.074] (-659.376) * (-657.365) (-657.834) (-660.468) [-655.999] -- 0:00:05
Average standard deviation of split frequencies: 0.009641
905500 -- [-656.965] (-658.459) (-657.966) (-659.202) * [-657.381] (-655.921) (-663.204) (-656.635) -- 0:00:05
906000 -- [-657.412] (-660.111) (-659.563) (-658.895) * (-656.849) [-658.522] (-659.585) (-660.194) -- 0:00:05
906500 -- (-664.646) [-659.015] (-657.617) (-656.915) * (-656.175) (-658.209) (-660.417) [-658.395] -- 0:00:05
907000 -- (-656.565) [-656.208] (-658.700) (-659.007) * [-657.651] (-657.973) (-664.336) (-657.997) -- 0:00:05
907500 -- (-657.692) (-657.498) (-657.452) [-662.162] * [-655.966] (-656.262) (-659.881) (-657.026) -- 0:00:05
908000 -- (-661.885) [-658.377] (-657.714) (-664.163) * (-658.659) [-655.638] (-659.219) (-656.766) -- 0:00:05
908500 -- [-659.020] (-664.013) (-657.292) (-656.109) * (-657.634) (-655.474) [-657.371] (-658.990) -- 0:00:05
909000 -- [-656.390] (-657.836) (-657.457) (-656.913) * [-660.035] (-656.921) (-658.146) (-657.681) -- 0:00:05
909500 -- (-656.138) (-658.322) (-656.194) [-656.243] * [-658.422] (-658.343) (-659.321) (-658.177) -- 0:00:05
910000 -- (-656.779) (-659.979) (-656.918) [-657.204] * [-657.638] (-659.406) (-657.451) (-659.493) -- 0:00:05
Average standard deviation of split frequencies: 0.009683
910500 -- (-659.245) (-656.944) [-658.658] (-657.962) * (-656.836) (-658.494) [-658.944] (-656.704) -- 0:00:05
911000 -- (-658.397) (-656.554) (-658.829) [-658.135] * (-656.075) [-657.046] (-659.283) (-657.400) -- 0:00:05
911500 -- (-662.825) [-657.253] (-660.356) (-658.642) * [-656.849] (-656.472) (-658.952) (-659.090) -- 0:00:05
912000 -- (-655.758) (-658.291) [-658.048] (-659.624) * [-656.703] (-656.312) (-655.755) (-659.071) -- 0:00:05
912500 -- [-657.775] (-660.028) (-657.485) (-658.569) * [-657.774] (-664.073) (-659.414) (-659.295) -- 0:00:05
913000 -- (-658.856) [-658.369] (-658.226) (-660.639) * (-658.628) (-660.707) (-656.720) [-656.819] -- 0:00:05
913500 -- (-659.440) (-658.010) [-658.534] (-660.876) * (-658.611) (-658.185) [-657.265] (-659.511) -- 0:00:05
914000 -- (-663.262) [-656.678] (-657.009) (-660.023) * [-659.614] (-658.180) (-656.581) (-655.509) -- 0:00:05
914500 -- (-656.209) (-663.441) (-661.151) [-658.332] * (-655.985) (-659.872) (-656.844) [-655.445] -- 0:00:05
915000 -- (-657.015) (-657.412) (-666.226) [-657.339] * [-656.748] (-657.449) (-656.004) (-657.305) -- 0:00:05
Average standard deviation of split frequencies: 0.009627
915500 -- [-658.179] (-655.957) (-655.723) (-657.351) * [-658.631] (-659.336) (-658.299) (-657.472) -- 0:00:05
916000 -- (-661.995) (-657.454) (-658.331) [-656.891] * (-662.059) (-657.277) [-656.697] (-656.215) -- 0:00:05
916500 -- (-659.368) (-656.482) [-661.163] (-658.191) * (-658.092) (-660.095) (-656.633) [-657.950] -- 0:00:05
917000 -- (-661.606) (-659.514) (-656.867) [-660.536] * (-659.470) (-659.419) [-656.260] (-661.296) -- 0:00:04
917500 -- (-657.018) (-657.839) (-657.308) [-656.711] * (-661.287) [-658.128] (-660.375) (-662.629) -- 0:00:04
918000 -- (-657.033) (-661.257) (-661.282) [-658.110] * (-658.835) [-658.921] (-656.527) (-662.783) -- 0:00:05
918500 -- [-656.160] (-659.305) (-658.092) (-656.534) * (-658.218) (-659.936) [-659.050] (-656.876) -- 0:00:04
919000 -- (-655.568) (-661.415) [-660.625] (-658.442) * [-658.427] (-659.925) (-658.020) (-655.772) -- 0:00:04
919500 -- (-655.925) (-657.545) (-658.250) [-656.805] * (-656.340) (-660.414) (-656.173) [-656.753] -- 0:00:04
920000 -- (-656.213) (-661.102) [-656.600] (-658.430) * (-660.799) (-657.387) (-656.277) [-660.911] -- 0:00:04
Average standard deviation of split frequencies: 0.009879
920500 -- (-656.114) [-656.905] (-656.237) (-657.541) * (-658.461) (-660.084) [-660.841] (-656.916) -- 0:00:04
921000 -- [-658.792] (-656.413) (-656.416) (-660.234) * (-659.925) (-656.121) (-661.564) [-656.884] -- 0:00:04
921500 -- [-656.555] (-658.679) (-659.419) (-656.832) * [-657.527] (-659.537) (-656.707) (-655.993) -- 0:00:04
922000 -- (-658.699) (-655.579) (-657.319) [-657.760] * (-658.305) [-659.988] (-658.729) (-655.919) -- 0:00:04
922500 -- (-658.016) (-656.738) [-655.506] (-658.024) * (-657.765) (-659.570) [-663.856] (-660.166) -- 0:00:04
923000 -- (-656.886) [-657.795] (-660.940) (-656.744) * (-655.997) (-656.605) [-657.595] (-658.029) -- 0:00:04
923500 -- [-657.770] (-656.969) (-656.564) (-657.074) * (-656.281) (-656.463) (-656.899) [-658.156] -- 0:00:04
924000 -- [-657.090] (-658.201) (-658.376) (-657.391) * [-660.601] (-658.045) (-659.598) (-658.534) -- 0:00:04
924500 -- (-659.145) (-657.494) [-656.802] (-656.695) * (-656.900) (-658.337) (-656.730) [-658.590] -- 0:00:04
925000 -- (-658.370) (-660.682) [-656.882] (-658.065) * (-656.513) [-659.676] (-659.016) (-658.113) -- 0:00:04
Average standard deviation of split frequencies: 0.010062
925500 -- [-657.592] (-656.975) (-658.861) (-657.709) * [-657.819] (-656.507) (-658.285) (-656.887) -- 0:00:04
926000 -- (-659.178) (-659.100) (-658.183) [-659.069] * [-656.232] (-659.775) (-664.821) (-658.174) -- 0:00:04
926500 -- (-656.646) (-657.328) (-657.535) [-655.651] * (-656.725) [-657.706] (-665.514) (-658.478) -- 0:00:04
927000 -- (-661.506) (-656.253) [-656.944] (-658.662) * (-659.236) [-657.771] (-667.095) (-656.904) -- 0:00:04
927500 -- (-660.947) [-656.296] (-657.419) (-656.558) * (-659.734) [-659.211] (-661.127) (-657.334) -- 0:00:04
928000 -- (-660.938) [-656.587] (-662.366) (-659.352) * (-657.271) [-659.217] (-661.934) (-656.292) -- 0:00:04
928500 -- (-655.836) (-657.372) (-661.694) [-661.289] * [-659.032] (-660.175) (-666.279) (-657.891) -- 0:00:04
929000 -- (-655.550) [-658.445] (-657.265) (-660.510) * (-656.714) [-660.717] (-663.814) (-657.152) -- 0:00:04
929500 -- [-658.698] (-657.380) (-662.059) (-657.329) * (-661.836) [-660.201] (-658.008) (-657.416) -- 0:00:04
930000 -- (-657.991) (-658.784) [-657.154] (-659.434) * (-656.769) (-661.606) (-657.527) [-656.525] -- 0:00:04
Average standard deviation of split frequencies: 0.009981
930500 -- (-656.961) (-657.840) (-655.650) [-661.506] * (-657.058) [-656.200] (-657.281) (-656.288) -- 0:00:04
931000 -- (-657.783) (-658.566) [-656.718] (-661.116) * (-656.479) [-661.119] (-656.405) (-656.248) -- 0:00:04
931500 -- (-658.322) (-657.683) [-656.267] (-660.784) * [-657.665] (-656.642) (-660.888) (-657.232) -- 0:00:04
932000 -- (-658.858) (-656.996) [-659.073] (-657.538) * (-659.266) (-658.629) (-656.273) [-659.974] -- 0:00:04
932500 -- (-663.983) (-658.437) [-655.930] (-657.016) * (-659.040) [-658.689] (-655.756) (-658.179) -- 0:00:04
933000 -- [-661.823] (-657.595) (-658.230) (-659.926) * (-658.775) [-657.833] (-656.753) (-658.816) -- 0:00:04
933500 -- [-660.949] (-656.976) (-658.882) (-657.786) * (-656.388) (-663.183) (-660.100) [-656.905] -- 0:00:03
934000 -- (-659.563) (-656.375) [-657.123] (-656.917) * (-656.360) [-661.369] (-662.173) (-657.729) -- 0:00:03
934500 -- (-657.237) [-657.107] (-660.402) (-658.408) * (-659.821) [-658.746] (-660.034) (-656.497) -- 0:00:03
935000 -- (-659.164) (-656.273) (-655.862) [-658.888] * (-662.058) (-662.619) [-656.673] (-659.202) -- 0:00:03
Average standard deviation of split frequencies: 0.010162
935500 -- (-660.624) (-657.901) [-657.000] (-658.330) * (-660.220) (-659.374) (-657.023) [-656.020] -- 0:00:03
936000 -- (-658.397) [-658.775] (-657.675) (-657.142) * (-660.496) (-662.856) [-658.580] (-657.270) -- 0:00:03
936500 -- [-655.607] (-657.050) (-656.638) (-659.907) * (-660.245) (-658.235) (-658.417) [-656.615] -- 0:00:03
937000 -- (-660.955) (-661.372) [-658.591] (-658.871) * (-656.628) [-660.925] (-657.719) (-657.451) -- 0:00:03
937500 -- (-659.623) [-657.552] (-659.291) (-657.384) * (-657.525) (-657.893) (-657.688) [-659.535] -- 0:00:03
938000 -- (-657.150) (-657.222) (-660.667) [-658.425] * (-656.928) [-662.312] (-658.352) (-659.583) -- 0:00:03
938500 -- (-658.640) (-657.002) [-657.689] (-658.787) * (-657.285) (-657.763) [-657.715] (-660.292) -- 0:00:03
939000 -- [-658.719] (-657.476) (-656.382) (-657.963) * (-656.236) (-658.878) [-658.834] (-657.329) -- 0:00:03
939500 -- (-656.545) [-657.276] (-665.854) (-664.819) * (-656.239) (-657.974) [-656.680] (-656.582) -- 0:00:03
940000 -- (-662.647) [-658.458] (-658.375) (-659.926) * (-661.125) [-659.440] (-656.578) (-656.480) -- 0:00:03
Average standard deviation of split frequencies: 0.010111
940500 -- (-658.285) (-657.405) (-660.858) [-656.984] * (-657.339) (-658.301) [-658.777] (-657.278) -- 0:00:03
941000 -- [-656.945] (-660.216) (-661.935) (-659.682) * [-657.599] (-656.272) (-659.124) (-659.889) -- 0:00:03
941500 -- [-656.969] (-658.651) (-657.947) (-660.254) * (-657.102) (-658.597) (-660.218) [-661.919] -- 0:00:03
942000 -- (-658.733) (-658.918) [-658.353] (-657.143) * (-657.574) (-657.957) (-662.946) [-657.032] -- 0:00:03
942500 -- [-659.038] (-662.483) (-656.500) (-660.405) * (-661.287) (-657.678) [-658.274] (-659.911) -- 0:00:03
943000 -- (-657.692) [-656.791] (-659.366) (-658.038) * (-658.531) (-658.468) (-657.624) [-657.411] -- 0:00:03
943500 -- [-661.351] (-657.351) (-656.865) (-660.820) * (-660.585) (-659.174) (-656.344) [-658.955] -- 0:00:03
944000 -- [-659.545] (-657.255) (-658.406) (-658.202) * (-656.554) (-657.733) (-657.587) [-658.463] -- 0:00:03
944500 -- (-658.566) [-656.372] (-655.814) (-656.800) * (-660.848) (-657.573) (-658.268) [-657.735] -- 0:00:03
945000 -- (-658.964) (-659.298) (-661.177) [-656.006] * (-658.066) (-657.734) [-657.143] (-658.154) -- 0:00:03
Average standard deviation of split frequencies: 0.009761
945500 -- [-658.742] (-656.308) (-658.790) (-656.039) * (-657.166) (-660.482) [-659.371] (-656.911) -- 0:00:03
946000 -- [-657.280] (-655.670) (-661.551) (-657.954) * [-659.917] (-659.652) (-657.673) (-657.731) -- 0:00:03
946500 -- (-658.012) (-658.666) (-661.480) [-655.935] * (-660.203) (-662.696) [-656.257] (-658.735) -- 0:00:03
947000 -- (-656.885) [-657.550] (-656.940) (-655.991) * [-656.532] (-657.684) (-656.307) (-658.861) -- 0:00:03
947500 -- (-661.070) (-659.530) (-656.982) [-656.546] * (-657.453) (-658.315) [-658.805] (-658.827) -- 0:00:03
948000 -- (-657.344) [-656.607] (-657.207) (-656.022) * (-656.246) (-657.466) (-659.657) [-659.900] -- 0:00:03
948500 -- (-659.883) (-656.305) [-656.815] (-657.408) * [-656.308] (-656.673) (-657.704) (-657.348) -- 0:00:03
949000 -- (-660.557) (-656.748) [-656.973] (-657.730) * (-657.279) (-656.544) [-660.960] (-659.917) -- 0:00:03
949500 -- (-659.748) (-656.042) [-656.998] (-656.362) * [-657.265] (-660.224) (-658.766) (-662.390) -- 0:00:03
950000 -- [-660.135] (-660.147) (-659.415) (-657.163) * (-656.149) (-656.568) (-663.105) [-657.109] -- 0:00:03
Average standard deviation of split frequencies: 0.009451
950500 -- [-656.963] (-659.695) (-659.519) (-656.996) * (-656.492) (-655.752) [-657.398] (-664.151) -- 0:00:02
951000 -- (-656.678) (-660.833) [-658.635] (-658.542) * (-658.002) (-657.085) [-657.309] (-657.138) -- 0:00:02
951500 -- (-656.577) [-658.469] (-659.440) (-657.331) * (-657.103) (-656.616) [-657.986] (-663.287) -- 0:00:02
952000 -- (-661.295) (-656.150) [-656.763] (-656.619) * (-658.761) [-657.747] (-659.426) (-657.273) -- 0:00:02
952500 -- (-657.291) [-656.373] (-658.297) (-662.103) * [-656.619] (-659.055) (-657.699) (-655.901) -- 0:00:02
953000 -- (-659.590) [-658.192] (-659.915) (-656.242) * (-657.521) (-657.203) [-656.152] (-656.137) -- 0:00:02
953500 -- (-658.918) (-660.692) [-656.681] (-656.596) * (-657.675) (-656.993) (-656.198) [-655.926] -- 0:00:02
954000 -- (-658.804) (-661.255) (-657.324) [-657.804] * (-656.708) [-656.062] (-658.043) (-661.882) -- 0:00:02
954500 -- (-656.642) (-661.573) (-659.579) [-656.199] * (-656.139) [-658.585] (-656.759) (-657.818) -- 0:00:02
955000 -- (-658.900) (-663.967) (-657.437) [-657.086] * (-656.673) (-658.826) (-657.400) [-657.080] -- 0:00:02
Average standard deviation of split frequencies: 0.009485
955500 -- (-659.591) (-657.567) [-659.346] (-656.689) * [-657.183] (-656.776) (-657.196) (-656.985) -- 0:00:02
956000 -- (-657.339) (-657.679) (-656.019) [-658.261] * (-659.708) (-657.908) [-657.592] (-659.308) -- 0:00:02
956500 -- (-657.176) [-658.201] (-658.355) (-658.615) * (-657.057) (-656.564) [-659.381] (-658.660) -- 0:00:02
957000 -- [-657.764] (-655.582) (-657.437) (-660.220) * (-658.008) (-657.789) [-655.648] (-663.220) -- 0:00:02
957500 -- (-661.357) (-660.831) [-655.983] (-657.901) * [-657.649] (-660.880) (-658.360) (-662.491) -- 0:00:02
958000 -- [-657.439] (-658.663) (-656.959) (-660.081) * (-656.492) (-658.709) (-656.872) [-658.219] -- 0:00:02
958500 -- [-657.639] (-657.028) (-657.206) (-659.160) * [-656.661] (-655.946) (-657.688) (-660.416) -- 0:00:02
959000 -- (-657.797) [-657.623] (-658.381) (-658.895) * [-657.304] (-657.240) (-656.579) (-658.008) -- 0:00:02
959500 -- (-656.974) (-656.999) (-656.645) [-659.067] * (-657.319) (-658.220) (-656.527) [-658.947] -- 0:00:02
960000 -- (-659.476) (-657.277) [-656.087] (-656.222) * (-657.098) (-660.966) [-655.818] (-662.933) -- 0:00:02
Average standard deviation of split frequencies: 0.009525
960500 -- [-656.902] (-659.277) (-656.306) (-657.384) * [-656.531] (-658.774) (-656.912) (-660.453) -- 0:00:02
961000 -- [-656.320] (-656.835) (-656.074) (-657.684) * (-656.630) [-657.910] (-659.613) (-659.520) -- 0:00:02
961500 -- (-656.887) (-657.796) (-657.865) [-656.797] * (-660.711) [-658.184] (-661.871) (-658.182) -- 0:00:02
962000 -- (-658.987) [-657.753] (-657.400) (-656.262) * (-659.102) (-659.100) (-657.458) [-661.082] -- 0:00:02
962500 -- (-658.233) (-657.984) (-656.607) [-658.163] * (-657.024) (-656.728) [-655.877] (-656.740) -- 0:00:02
963000 -- (-657.148) (-658.205) [-657.925] (-657.911) * [-656.886] (-658.932) (-657.561) (-658.031) -- 0:00:02
963500 -- (-656.036) (-657.892) [-657.838] (-662.599) * [-655.810] (-656.116) (-657.303) (-660.755) -- 0:00:02
964000 -- [-657.271] (-657.312) (-659.603) (-657.770) * (-656.961) [-657.276] (-658.165) (-659.819) -- 0:00:02
964500 -- (-655.817) (-662.272) [-661.124] (-656.342) * [-656.254] (-657.220) (-657.761) (-660.656) -- 0:00:02
965000 -- (-657.566) (-661.969) (-656.949) [-658.913] * (-658.162) (-657.836) [-658.344] (-656.565) -- 0:00:02
Average standard deviation of split frequencies: 0.009502
965500 -- [-656.412] (-659.024) (-657.087) (-658.264) * [-656.762] (-660.397) (-656.647) (-657.175) -- 0:00:02
966000 -- [-657.401] (-657.790) (-658.451) (-659.069) * (-656.772) (-658.210) [-658.673] (-656.381) -- 0:00:02
966500 -- [-656.472] (-656.611) (-657.913) (-662.441) * (-658.438) (-657.413) (-659.386) [-656.716] -- 0:00:02
967000 -- (-658.516) [-657.851] (-659.467) (-663.136) * (-656.664) (-656.956) (-660.925) [-657.462] -- 0:00:01
967500 -- [-655.387] (-659.550) (-657.265) (-663.255) * (-660.360) (-656.208) (-658.281) [-657.350] -- 0:00:01
968000 -- (-660.829) (-659.175) (-659.091) [-658.140] * [-656.951] (-658.112) (-656.524) (-657.692) -- 0:00:01
968500 -- (-656.866) (-658.902) (-662.288) [-656.732] * (-665.311) [-659.473] (-656.911) (-657.402) -- 0:00:01
969000 -- [-658.445] (-658.065) (-659.900) (-656.158) * (-657.868) (-658.292) (-659.275) [-658.926] -- 0:00:01
969500 -- [-658.451] (-659.404) (-658.572) (-656.879) * (-656.686) (-658.720) [-660.022] (-658.375) -- 0:00:01
970000 -- (-657.395) (-658.432) (-658.098) [-660.609] * (-658.142) (-657.000) [-656.842] (-657.400) -- 0:00:01
Average standard deviation of split frequencies: 0.009856
970500 -- [-656.775] (-658.391) (-656.481) (-659.790) * (-659.914) [-656.590] (-655.640) (-657.744) -- 0:00:01
971000 -- (-658.532) (-655.476) (-656.317) [-656.826] * (-656.298) [-659.498] (-659.173) (-660.477) -- 0:00:01
971500 -- (-660.400) (-658.955) (-656.772) [-656.363] * (-657.014) (-657.094) [-658.863] (-658.666) -- 0:00:01
972000 -- [-658.463] (-657.361) (-657.349) (-656.190) * (-658.392) (-656.595) (-656.964) [-657.315] -- 0:00:01
972500 -- (-656.738) (-657.207) [-659.783] (-656.338) * (-659.542) (-661.657) (-657.669) [-657.120] -- 0:00:01
973000 -- [-657.313] (-659.981) (-660.946) (-662.087) * (-656.822) (-657.435) [-656.770] (-658.218) -- 0:00:01
973500 -- (-656.542) (-657.917) [-658.650] (-658.992) * (-660.740) (-660.089) [-657.035] (-656.658) -- 0:00:01
974000 -- (-656.086) [-660.949] (-657.319) (-658.771) * (-658.588) (-660.174) [-659.127] (-655.981) -- 0:00:01
974500 -- (-658.336) (-658.949) (-656.768) [-659.907] * (-659.318) (-657.028) [-657.943] (-656.536) -- 0:00:01
975000 -- (-664.494) (-658.360) [-657.575] (-657.687) * [-656.722] (-656.768) (-657.714) (-657.966) -- 0:00:01
Average standard deviation of split frequencies: 0.010058
975500 -- [-657.347] (-660.167) (-657.634) (-656.233) * (-659.021) [-657.941] (-657.671) (-658.791) -- 0:00:01
976000 -- (-655.614) (-656.428) (-660.830) [-658.751] * (-658.362) (-658.841) (-657.309) [-656.799] -- 0:00:01
976500 -- (-657.095) (-656.583) [-658.163] (-656.091) * [-657.796] (-657.350) (-659.911) (-656.314) -- 0:00:01
977000 -- (-658.680) (-657.390) (-659.604) [-660.799] * (-658.513) [-656.915] (-657.633) (-658.425) -- 0:00:01
977500 -- [-656.992] (-665.510) (-657.397) (-657.329) * (-657.777) [-657.470] (-656.848) (-661.279) -- 0:00:01
978000 -- (-657.009) (-656.300) [-657.808] (-657.639) * (-656.932) [-655.800] (-659.994) (-655.763) -- 0:00:01
978500 -- (-657.412) [-657.103] (-657.047) (-659.970) * (-658.345) [-657.772] (-660.131) (-656.548) -- 0:00:01
979000 -- (-657.368) (-657.426) [-656.748] (-659.666) * (-655.509) (-657.808) [-658.077] (-658.285) -- 0:00:01
979500 -- (-659.006) (-656.471) (-656.367) [-660.590] * (-658.040) [-659.084] (-657.948) (-659.972) -- 0:00:01
980000 -- (-659.335) [-657.783] (-656.639) (-655.389) * (-657.691) [-657.000] (-658.579) (-657.606) -- 0:00:01
Average standard deviation of split frequencies: 0.009840
980500 -- [-657.071] (-661.249) (-655.882) (-655.463) * [-659.642] (-660.427) (-658.679) (-657.356) -- 0:00:01
981000 -- (-659.056) [-658.345] (-658.722) (-658.555) * (-657.132) (-656.768) [-662.409] (-661.194) -- 0:00:01
981500 -- (-656.590) (-656.435) (-658.490) [-656.729] * [-658.714] (-657.387) (-659.207) (-659.196) -- 0:00:01
982000 -- [-657.214] (-657.119) (-657.102) (-656.215) * (-657.466) (-656.324) (-659.646) [-660.154] -- 0:00:01
982500 -- (-657.386) [-656.689] (-656.827) (-660.979) * (-656.028) (-658.433) (-661.394) [-657.726] -- 0:00:01
983000 -- (-660.488) (-657.278) (-659.596) [-656.678] * (-656.725) (-660.904) (-656.277) [-659.195] -- 0:00:01
983500 -- (-659.227) (-656.472) (-658.765) [-656.496] * [-656.947] (-656.690) (-656.860) (-658.818) -- 0:00:00
984000 -- [-661.773] (-656.370) (-658.365) (-657.440) * (-661.107) [-656.247] (-656.907) (-660.597) -- 0:00:00
984500 -- [-656.484] (-656.584) (-657.607) (-657.287) * (-662.153) (-657.651) (-658.438) [-657.448] -- 0:00:00
985000 -- [-656.434] (-656.687) (-656.602) (-657.547) * (-660.073) (-659.035) (-658.220) [-657.216] -- 0:00:00
Average standard deviation of split frequencies: 0.009646
985500 -- (-656.878) (-658.342) [-657.357] (-655.686) * (-658.400) (-659.604) [-657.204] (-656.994) -- 0:00:00
986000 -- (-661.291) [-656.167] (-658.283) (-655.574) * (-661.720) (-659.240) (-656.118) [-656.719] -- 0:00:00
986500 -- (-660.565) (-657.842) (-659.005) [-656.542] * (-656.995) [-656.643] (-656.349) (-655.919) -- 0:00:00
987000 -- [-657.394] (-663.102) (-659.026) (-657.317) * (-655.956) (-657.367) (-656.149) [-657.471] -- 0:00:00
987500 -- (-657.064) [-656.452] (-663.078) (-660.004) * [-658.650] (-659.705) (-656.917) (-658.203) -- 0:00:00
988000 -- (-657.574) (-657.713) [-660.738] (-659.943) * (-658.143) (-658.079) [-657.232] (-658.057) -- 0:00:00
988500 -- (-656.979) (-656.864) [-657.942] (-666.999) * (-656.330) (-659.380) [-655.772] (-657.938) -- 0:00:00
989000 -- [-658.101] (-657.570) (-659.234) (-661.140) * [-657.225] (-661.830) (-655.732) (-658.755) -- 0:00:00
989500 -- [-659.837] (-657.659) (-658.055) (-659.202) * (-657.060) (-659.426) [-656.223] (-657.546) -- 0:00:00
990000 -- (-658.178) [-656.555] (-659.431) (-659.094) * [-656.002] (-659.017) (-657.719) (-657.094) -- 0:00:00
Average standard deviation of split frequencies: 0.009489
990500 -- (-659.728) (-659.426) (-656.934) [-658.122] * (-657.009) (-657.932) (-660.769) [-657.034] -- 0:00:00
991000 -- (-658.668) (-656.161) [-657.811] (-659.281) * [-658.938] (-655.933) (-658.281) (-658.332) -- 0:00:00
991500 -- [-656.850] (-662.396) (-661.034) (-657.356) * (-657.175) (-657.428) [-659.304] (-658.046) -- 0:00:00
992000 -- [-661.510] (-658.688) (-658.840) (-658.599) * [-657.693] (-657.763) (-658.874) (-661.532) -- 0:00:00
992500 -- [-658.694] (-658.384) (-659.071) (-657.678) * (-656.617) (-656.301) [-657.964] (-658.702) -- 0:00:00
993000 -- (-661.078) (-656.874) (-658.336) [-657.465] * (-659.528) (-655.921) [-658.046] (-657.416) -- 0:00:00
993500 -- (-660.593) (-658.856) [-658.339] (-657.609) * [-658.076] (-657.178) (-656.542) (-657.060) -- 0:00:00
994000 -- (-658.264) (-657.627) [-659.926] (-659.505) * (-660.907) (-656.807) (-658.479) [-656.700] -- 0:00:00
994500 -- [-658.896] (-658.947) (-657.762) (-656.601) * (-660.957) (-659.753) [-657.228] (-656.590) -- 0:00:00
995000 -- (-658.314) [-658.320] (-659.775) (-656.587) * (-657.761) (-660.788) (-658.985) [-656.651] -- 0:00:00
Average standard deviation of split frequencies: 0.009911
995500 -- (-657.152) (-659.484) (-659.730) [-656.994] * [-660.355] (-656.857) (-658.752) (-656.657) -- 0:00:00
996000 -- (-659.076) [-656.763] (-657.738) (-658.733) * (-658.528) [-658.674] (-656.755) (-659.301) -- 0:00:00
996500 -- [-656.322] (-656.371) (-657.676) (-655.891) * (-662.745) (-663.117) (-656.299) [-656.804] -- 0:00:00
997000 -- (-660.669) [-657.462] (-659.999) (-661.917) * (-660.298) (-658.451) [-661.243] (-657.655) -- 0:00:00
997500 -- (-655.992) [-656.684] (-659.058) (-659.271) * (-658.865) [-657.314] (-661.621) (-657.183) -- 0:00:00
998000 -- (-656.227) [-657.069] (-658.576) (-655.852) * (-658.162) (-657.394) (-657.313) [-658.242] -- 0:00:00
998500 -- (-656.276) [-656.028] (-656.688) (-655.851) * (-660.340) [-658.722] (-657.855) (-659.180) -- 0:00:00
999000 -- (-658.614) [-657.527] (-661.277) (-658.901) * (-659.920) (-657.088) [-657.492] (-658.265) -- 0:00:00
999500 -- (-659.763) (-658.622) (-656.818) [-657.870] * (-661.645) (-657.961) (-657.451) [-656.215] -- 0:00:00
1000000 -- (-658.694) (-659.963) [-657.081] (-659.616) * (-659.624) [-659.387] (-659.899) (-656.673) -- 0:00:00
Average standard deviation of split frequencies: 0.010364
Analysis completed in 60 seconds
Analysis used 58.62 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -655.28
Likelihood of best state for "cold" chain of run 2 was -655.28
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.2 % ( 28 %) Dirichlet(Pi{all})
32.5 % ( 28 %) Slider(Pi{all})
78.4 % ( 49 %) Multiplier(Alpha{1,2})
77.2 % ( 52 %) Multiplier(Alpha{3})
23.5 % ( 29 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.3 % ( 33 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.9 % ( 31 %) Dirichlet(Pi{all})
33.0 % ( 28 %) Slider(Pi{all})
78.7 % ( 48 %) Multiplier(Alpha{1,2})
77.9 % ( 42 %) Multiplier(Alpha{3})
23.7 % ( 27 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.3 % ( 23 %) Multiplier(V{all})
97.5 % ( 93 %) Nodeslider(V{all})
30.2 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167007 0.82 0.67
3 | 166007 167558 0.84
4 | 166623 166582 166223
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166748 0.82 0.66
3 | 166014 166979 0.84
4 | 166951 166762 166546
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -657.12
| 1 * |
| 1 |
| 1 2 |
| 12 1 2 1 * 2 2 2 |
| 121 2 2 1 2 2 2 2 1 1 |
| 2 1 1 1 212* 1 21 |
| 22 11 2 22 1 2 1 2 1 1 |
| 1 1 2 2 1 21 2 12 11 1 1 22|
|2 2 1 1 12 1 1 2 1|
|1 2 122 1 1 1 1 1 |
| 2 1 1 1 2 2 2 1 1 |
| 21 2 2 2 2 1 2 1 |
| 2 2 1 |
| 1 2 2 2 |
| 1 1 2 2 22 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -658.53
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -657.05 -659.70
2 -657.06 -660.17
--------------------------------------
TOTAL -657.06 -659.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894974 0.095486 0.326824 1.483618 0.860603 1498.01 1499.50 1.000
r(A<->C){all} 0.171374 0.021002 0.000090 0.466220 0.134652 195.38 229.25 1.001
r(A<->G){all} 0.160108 0.020157 0.000061 0.454692 0.120828 186.05 204.28 1.001
r(A<->T){all} 0.173888 0.021338 0.000116 0.468051 0.134026 106.18 144.63 1.002
r(C<->G){all} 0.170217 0.020452 0.000007 0.462935 0.131695 266.05 272.88 1.000
r(C<->T){all} 0.163257 0.019881 0.000107 0.447042 0.121575 288.98 337.37 1.013
r(G<->T){all} 0.161156 0.018685 0.000011 0.436556 0.123389 251.16 282.95 1.001
pi(A){all} 0.234487 0.000368 0.195754 0.270343 0.234136 1366.80 1403.17 1.000
pi(C){all} 0.317929 0.000446 0.277452 0.359201 0.317442 1285.55 1290.79 1.000
pi(G){all} 0.285542 0.000435 0.248687 0.329915 0.284919 1338.59 1343.06 1.000
pi(T){all} 0.162041 0.000265 0.129446 0.193459 0.161721 1164.46 1295.55 1.000
alpha{1,2} 0.443632 0.254147 0.000162 1.456053 0.266268 1305.49 1403.24 1.000
alpha{3} 0.462435 0.250389 0.000248 1.448425 0.304370 1142.59 1222.95 1.001
pinvar{all} 0.996654 0.000017 0.988938 0.999998 0.997888 1096.98 1298.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- .*..*.
9 -- .*...*
10 -- ..*..*
11 -- .**...
12 -- ...*.*
13 -- .*.***
14 -- .****.
15 -- ...**.
16 -- ..**..
17 -- ..*.*.
18 -- .*.*..
19 -- ..****
20 -- .**.**
21 -- ....**
22 -- ...***
23 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.001884 0.150566 0.153231 2
8 445 0.148235 0.019315 0.134577 0.161892 2
9 442 0.147235 0.002827 0.145237 0.149234 2
10 442 0.147235 0.007537 0.141905 0.152565 2
11 441 0.146902 0.015546 0.135909 0.157895 2
12 441 0.146902 0.008009 0.141239 0.152565 2
13 432 0.143904 0.007537 0.138574 0.149234 2
14 430 0.143238 0.002827 0.141239 0.145237 2
15 423 0.140906 0.009893 0.133911 0.147901 2
16 421 0.140240 0.005182 0.136576 0.143904 2
17 420 0.139907 0.004711 0.136576 0.143238 2
18 419 0.139574 0.003298 0.137242 0.141905 2
19 419 0.139574 0.009893 0.132578 0.146569 2
20 410 0.136576 0.022612 0.120586 0.152565 2
21 402 0.133911 0.016959 0.121919 0.145903 2
22 284 0.094604 0.016959 0.082612 0.106596 2
23 267 0.088941 0.021199 0.073951 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096904 0.008945 0.000006 0.284956 0.068227 1.000 2
length{all}[2] 0.100213 0.010089 0.000080 0.308339 0.068262 1.001 2
length{all}[3] 0.098516 0.010154 0.000034 0.296294 0.068963 1.000 2
length{all}[4] 0.099130 0.009668 0.000072 0.294513 0.069681 1.001 2
length{all}[5] 0.099845 0.009801 0.000002 0.305700 0.069843 1.000 2
length{all}[6] 0.100269 0.010146 0.000060 0.300445 0.069347 1.000 2
length{all}[7] 0.101531 0.009833 0.000666 0.309932 0.070882 0.998 2
length{all}[8] 0.098852 0.010268 0.000092 0.314130 0.069372 1.002 2
length{all}[9] 0.097875 0.011314 0.000296 0.291510 0.061535 0.998 2
length{all}[10] 0.106914 0.013507 0.000018 0.308108 0.073675 1.000 2
length{all}[11] 0.098666 0.011471 0.000012 0.317525 0.061416 0.999 2
length{all}[12] 0.095632 0.008738 0.000159 0.276613 0.070487 0.999 2
length{all}[13] 0.093660 0.009057 0.000249 0.279590 0.063171 1.004 2
length{all}[14] 0.099222 0.009463 0.000235 0.289696 0.070480 1.000 2
length{all}[15] 0.101291 0.009716 0.000327 0.288519 0.070927 0.998 2
length{all}[16] 0.103631 0.010092 0.000319 0.286950 0.070525 0.998 2
length{all}[17] 0.099420 0.008202 0.000614 0.274841 0.072380 1.001 2
length{all}[18] 0.105100 0.009521 0.000953 0.303803 0.078715 1.000 2
length{all}[19] 0.094918 0.008594 0.000381 0.268085 0.068307 1.002 2
length{all}[20] 0.095893 0.011494 0.000140 0.291403 0.062720 1.002 2
length{all}[21] 0.094660 0.008836 0.000200 0.298294 0.064058 0.998 2
length{all}[22] 0.091202 0.007995 0.000237 0.268771 0.072141 0.997 2
length{all}[23] 0.095506 0.011557 0.000147 0.305115 0.061780 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010364
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 483
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 161 / 161 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 161 / 161 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053545 0.044201 0.066555 0.097363 0.066631 0.050902 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -700.299776
Iterating by ming2
Initial: fx= 700.299776
x= 0.05355 0.04420 0.06655 0.09736 0.06663 0.05090 0.30000 1.30000
1 h-m-p 0.0000 0.0003 385.7689 +++ 658.514479 m 0.0003 14 | 1/8
2 h-m-p 0.0016 0.0078 40.6386 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 354.5920 ++ 653.173143 m 0.0000 45 | 2/8
4 h-m-p 0.0005 0.0131 26.4418 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 317.3009 ++ 651.485570 m 0.0000 76 | 3/8
6 h-m-p 0.0002 0.0166 21.3261 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 274.6402 ++ 645.244178 m 0.0001 106 | 4/8
8 h-m-p 0.0012 0.0231 15.9530 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 224.5439 ++ 645.219811 m 0.0000 137 | 5/8
10 h-m-p 0.0001 0.0355 10.6173 ---------.. | 5/8
11 h-m-p 0.0000 0.0002 158.3593 +++ 640.284113 m 0.0002 167 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 640.284113 m 8.0000 178 | 6/8
13 h-m-p 0.3460 8.0000 0.0000 ------------C 640.284113 0 0.0000 203
Out..
lnL = -640.284113
204 lfun, 204 eigenQcodon, 1224 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058964 0.024797 0.091393 0.054594 0.066465 0.093540 0.299888 0.865224 0.139699
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.800416
np = 9
lnL0 = -698.310452
Iterating by ming2
Initial: fx= 698.310452
x= 0.05896 0.02480 0.09139 0.05459 0.06647 0.09354 0.29989 0.86522 0.13970
1 h-m-p 0.0000 0.0002 347.0032 +++ 677.119569 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0002 528.7859 ++ 654.642826 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 1579.7884 ++ 651.857827 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0002 260.8421 ++ 648.006102 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 2366.0993 ++ 645.741673 m 0.0000 63 | 5/9
6 h-m-p 0.0027 0.0593 5.0721 ------------.. | 5/9
7 h-m-p 0.0000 0.0001 216.7076 ++ 640.605094 m 0.0001 97 | 6/9
8 h-m-p 0.0029 0.0380 5.6501 ------------.. | 6/9
9 h-m-p 0.0000 0.0000 157.6852 ++ 640.284086 m 0.0000 131 | 7/9
10 h-m-p 0.3802 8.0000 0.0000 C 640.284086 0 0.3802 143 | 7/9
11 h-m-p 0.3713 8.0000 0.0000 -Y 640.284086 0 0.0232 158
Out..
lnL = -640.284086
159 lfun, 477 eigenQcodon, 1908 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010871 0.037748 0.044347 0.100202 0.076654 0.043779 0.291711 1.358665 0.332521 0.466955 1.301336
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.873260
np = 11
lnL0 = -688.916722
Iterating by ming2
Initial: fx= 688.916722
x= 0.01087 0.03775 0.04435 0.10020 0.07665 0.04378 0.29171 1.35867 0.33252 0.46695 1.30134
1 h-m-p 0.0000 0.0001 372.1345 ++ 679.044510 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0009 174.5215 ++ 657.945827 m 0.0009 30 | 2/11
3 h-m-p 0.0000 0.0000 1407.4134 ++ 654.368899 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 326.3517 ++ 654.075623 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0002 618.2224 +++ 643.931377 m 0.0002 73 | 5/11
6 h-m-p 0.0000 0.0001 998.9817 ++ 640.284100 m 0.0001 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ++ 640.284100 m 8.0000 101 | 6/11
8 h-m-p 0.0160 8.0000 0.0346 -------Y 640.284100 0 0.0000 127 | 6/11
9 h-m-p 0.0160 8.0000 0.0012 +++++ 640.284100 m 8.0000 149 | 6/11
10 h-m-p 0.0152 1.6766 0.6448 ----------Y 640.284100 0 0.0000 178 | 6/11
11 h-m-p 0.0160 8.0000 0.0000 -----N 640.284100 0 0.0000 202 | 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 640.284100 m 8.0000 224 | 6/11
13 h-m-p 0.0160 8.0000 1.3435 ----------C 640.284100 0 0.0000 253 | 6/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 640.284100 m 8.0000 270 | 6/11
15 h-m-p 0.0035 1.7593 1.0597 -----------Y 640.284100 0 0.0000 300 | 6/11
16 h-m-p 0.0160 8.0000 0.0000 ---Y 640.284100 0 0.0001 317 | 6/11
17 h-m-p 0.0160 8.0000 0.0002 ------Y 640.284100 0 0.0000 342
Out..
lnL = -640.284100
343 lfun, 1372 eigenQcodon, 6174 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -640.293595 S = -640.281996 -0.004439
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:03
did 20 / 49 patterns 0:03
did 30 / 49 patterns 0:03
did 40 / 49 patterns 0:03
did 49 / 49 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109097 0.027620 0.101392 0.071424 0.022980 0.106227 0.259793 0.524153 1.914038
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.631474
np = 9
lnL0 = -706.029800
Iterating by ming2
Initial: fx= 706.029800
x= 0.10910 0.02762 0.10139 0.07142 0.02298 0.10623 0.25979 0.52415 1.91404
1 h-m-p 0.0000 0.0002 350.5868 ++ 686.343560 m 0.0002 14 | 1/9
2 h-m-p 0.0007 0.0035 31.9574 ++ 684.763838 m 0.0035 26 | 2/9
3 h-m-p 0.0000 0.0001 4739.1166 ++ 680.105839 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0006 83.6330 ++ 675.638278 m 0.0006 50 | 4/9
5 h-m-p 0.0000 0.0001 3107.8671 ++ 651.239240 m 0.0001 62 | 5/9
6 h-m-p 0.0018 0.0091 13.6119 ++ 650.235608 m 0.0091 74 | 6/9
7 h-m-p 0.0160 8.0000 10.1287 -------------.. | 6/9
8 h-m-p 0.0000 0.0004 151.7786 +++ 640.284080 m 0.0004 110 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 640.284080 m 8.0000 122 | 7/9
10 h-m-p 0.0800 8.0000 0.0004 ++++ 640.284080 m 8.0000 138 | 7/9
11 h-m-p 0.0160 8.0000 1.3281 +++++ 640.284071 m 8.0000 155 | 7/9
12 h-m-p 1.6000 8.0000 0.3651 ++ 640.284071 m 8.0000 167 | 7/9
13 h-m-p 0.1718 4.9453 16.9993 +++ 640.284069 m 4.9453 182 | 8/9
14 h-m-p 1.6000 8.0000 1.9113 -----------Y 640.284069 0 0.0000 205 | 8/9
15 h-m-p 0.0545 8.0000 0.0000 ---------Y 640.284069 0 0.0000 226
Out..
lnL = -640.284069
227 lfun, 2497 eigenQcodon, 13620 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082011 0.040564 0.059811 0.107481 0.097782 0.011424 0.000100 0.900000 0.931206 1.661768 1.299951
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.291173
np = 11
lnL0 = -699.658505
Iterating by ming2
Initial: fx= 699.658505
x= 0.08201 0.04056 0.05981 0.10748 0.09778 0.01142 0.00011 0.90000 0.93121 1.66177 1.29995
1 h-m-p 0.0000 0.0000 344.9483 ++ 699.247598 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 150.1654 +++ 689.339263 m 0.0005 31 | 2/11
3 h-m-p 0.0002 0.0008 115.8210 ++ 667.517508 m 0.0008 45 | 3/11
4 h-m-p 0.0006 0.0030 89.4100 ++ 655.163839 m 0.0030 59 | 4/11
5 h-m-p 0.0000 0.0000 71233.0323 ++ 645.672499 m 0.0000 73 | 5/11
6 h-m-p 0.0001 0.0003 984.9953 ++ 641.384639 m 0.0003 87 | 6/11
7 h-m-p 0.0000 0.0001 3628.8179 ++ 640.284099 m 0.0001 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0003 ++ 640.284099 m 8.0000 115 | 7/11
9 h-m-p 0.0547 5.3162 0.0370 --------Y 640.284099 0 0.0000 141 | 7/11
10 h-m-p 0.0160 8.0000 0.0001 +++++ 640.284099 m 8.0000 162 | 7/11
11 h-m-p 0.0006 0.2768 1.9159 ----------N 640.284099 0 0.0000 190 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 640.284099 m 8.0000 207 | 7/11
13 h-m-p 0.0132 6.6226 0.4065 ----------Y 640.284099 0 0.0000 235 | 7/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 640.284099 m 8.0000 256 | 7/11
15 h-m-p 0.0130 6.4867 0.4210 ---------C 640.284099 0 0.0000 283 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 -----N 640.284099 0 0.0000 306 | 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 640.284099 m 8.0000 327 | 7/11
18 h-m-p 0.0059 2.9262 0.3005 ---------Y 640.284099 0 0.0000 354 | 7/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 640.284099 m 8.0000 375 | 7/11
20 h-m-p 0.0081 4.0704 0.2315 -------------.. | 7/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 640.284099 m 8.0000 425 | 7/11
22 h-m-p 0.0072 3.5803 0.2115 ---------N 640.284099 0 0.0000 452 | 7/11
23 h-m-p 0.0160 8.0000 0.0026 +++++ 640.284098 m 8.0000 473 | 7/11
24 h-m-p 0.0935 3.5103 0.2189 ------------Y 640.284098 0 0.0000 503 | 7/11
25 h-m-p 0.0160 8.0000 0.0050 +++++ 640.284095 m 8.0000 524 | 7/11
26 h-m-p 0.1864 3.7799 0.2126 -----------Y 640.284095 0 0.0000 553 | 7/11
27 h-m-p 0.0160 8.0000 0.0003 +++++ 640.284095 m 8.0000 574 | 7/11
28 h-m-p 0.0117 4.2320 0.1995 ---------Y 640.284095 0 0.0000 601 | 7/11
29 h-m-p 0.0000 0.0082 24.8840 +++++ 640.284062 m 0.0082 622 | 8/11
30 h-m-p 1.1111 7.7105 0.0559 ++ 640.284050 m 7.7105 636 | 9/11
31 h-m-p 1.6000 8.0000 0.0004 -C 640.284050 0 0.1000 654 | 9/11
32 h-m-p 0.2234 8.0000 0.0002 Y 640.284050 0 0.0558 670 | 9/11
33 h-m-p 0.0962 8.0000 0.0001 C 640.284050 0 0.0240 686 | 9/11
34 h-m-p 0.2352 8.0000 0.0000 C 640.284050 0 0.2352 702 | 9/11
35 h-m-p 0.4468 8.0000 0.0000 ---------------Y 640.284050 0 0.0000 733
Out..
lnL = -640.284050
734 lfun, 8808 eigenQcodon, 48444 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -640.324520 S = -640.284679 -0.017613
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:18
did 20 / 49 patterns 0:19
did 30 / 49 patterns 0:19
did 40 / 49 patterns 0:19
did 49 / 49 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
NC_011896_1_WP_010908138_1_1161_MLBR_RS05445 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
NC_002677_1_NP_301814_1_686_ML1117 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC
**************************************************
NC_011896_1_WP_010908138_1_1161_MLBR_RS05445 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
NC_002677_1_NP_301814_1_686_ML1117 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100 STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV
**************************************************
NC_011896_1_WP_010908138_1_1161_MLBR_RS05445 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
NC_002677_1_NP_301814_1_686_ML1117 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100 SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE
**************************************************
NC_011896_1_WP_010908138_1_1161_MLBR_RS05445 SAELVAFHVPR
NC_002677_1_NP_301814_1_686_ML1117 SAELVAFHVPR
NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305 SAELVAFHVPR
NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955 SAELVAFHVPR
NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980 SAELVAFHVPR
NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100 SAELVAFHVPR
***********
>NC_011896_1_WP_010908138_1_1161_MLBR_RS05445 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC >NC_002677_1_NP_301814_1_686_ML1117 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC >NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC >NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC >NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC >NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100 ATGCGGCATGCGAAGTCGTCGTACCCACGGGGTTTCCCAGACCACATAGC CGACCATGACCGGAGGCTAGCACCCCGCGGGGTCAGGGAAGCTAGCCTGG CAGGTGGTTGGCTTCGCACCAACGTGCCTGCTATAGAAAAAGTGCTGTGT TCAACGGCTATGCGCGCCCGGGAGACCTTGACACACAGCGGCATCGAGGC CCCAGTACGCTACACCGAGCGACTCTACAGGGCCGACCCAGACACAGTGA TCAAGGAGATCAAGGCGATTAGCGACGAGGTCACCACGTCACTCATCGTC AGCCATGAACCAACGATATCTGCCGTAGCGCTCGCCCTGACCGGCTCGGG GACCAACAATGACGCCGCCCAACGCATTTCGACGAAATTCCCGACGTCAG GGATCGCAGTGCTCAATGTAGCTGGTCGCTGGCAACACCTCGAACTAGAG AGTGCAGAGCTGGTCGCCTTCCACGTACCGCGC
>NC_011896_1_WP_010908138_1_1161_MLBR_RS05445 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE SAELVAFHVPR >NC_002677_1_NP_301814_1_686_ML1117 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE SAELVAFHVPR >NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE SAELVAFHVPR >NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE SAELVAFHVPR >NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE SAELVAFHVPR >NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100 MRHAKSSYPRGFPDHIADHDRRLAPRGVREASLAGGWLRTNVPAIEKVLC STAMRARETLTHSGIEAPVRYTERLYRADPDTVIKEIKAISDEVTTSLIV SHEPTISAVALALTGSGTNNDAAQRISTKFPTSGIAVLNVAGRWQHLELE SAELVAFHVPR
#NEXUS
[ID: 5221006030]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908138_1_1161_MLBR_RS05445
NC_002677_1_NP_301814_1_686_ML1117
NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305
NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955
NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980
NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908138_1_1161_MLBR_RS05445,
2 NC_002677_1_NP_301814_1_686_ML1117,
3 NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305,
4 NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955,
5 NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980,
6 NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06822707,2:0.06826207,3:0.06896314,4:0.06968111,5:0.06984329,6:0.06934728);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06822707,2:0.06826207,3:0.06896314,4:0.06968111,5:0.06984329,6:0.06934728);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -657.05 -659.70
2 -657.06 -660.17
--------------------------------------
TOTAL -657.06 -659.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1117/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894974 0.095486 0.326824 1.483618 0.860603 1498.01 1499.50 1.000
r(A<->C){all} 0.171374 0.021002 0.000090 0.466220 0.134652 195.38 229.25 1.001
r(A<->G){all} 0.160108 0.020157 0.000061 0.454692 0.120828 186.05 204.28 1.001
r(A<->T){all} 0.173888 0.021338 0.000116 0.468051 0.134026 106.18 144.63 1.002
r(C<->G){all} 0.170217 0.020452 0.000007 0.462935 0.131695 266.05 272.88 1.000
r(C<->T){all} 0.163257 0.019881 0.000107 0.447042 0.121575 288.98 337.37 1.013
r(G<->T){all} 0.161156 0.018685 0.000011 0.436556 0.123389 251.16 282.95 1.001
pi(A){all} 0.234487 0.000368 0.195754 0.270343 0.234136 1366.80 1403.17 1.000
pi(C){all} 0.317929 0.000446 0.277452 0.359201 0.317442 1285.55 1290.79 1.000
pi(G){all} 0.285542 0.000435 0.248687 0.329915 0.284919 1338.59 1343.06 1.000
pi(T){all} 0.162041 0.000265 0.129446 0.193459 0.161721 1164.46 1295.55 1.000
alpha{1,2} 0.443632 0.254147 0.000162 1.456053 0.266268 1305.49 1403.24 1.000
alpha{3} 0.462435 0.250389 0.000248 1.448425 0.304370 1142.59 1222.95 1.001
pinvar{all} 0.996654 0.000017 0.988938 0.999998 0.997888 1096.98 1298.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1117/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 161
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 0 0 0 0 0 0
CTC 5 5 5 5 5 5 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 7 7 7 7 7 7
CTA 2 2 2 2 2 2 | CCA 5 5 5 5 5 5 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 0 0 0 0 0 0 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 6 6 6 6 6 6 | AAC 2 2 2 2 2 2 | AGC 4 4 4 4 4 4
ATA 3 3 3 3 3 3 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 5 5 5 5 5 5 | AAG 3 3 3 3 3 3 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 4 4 4 4 4 4 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 4 4 4 4 4 4 | GCC 9 9 9 9 9 9 | GAC 7 7 7 7 7 7 | GGC 2 2 2 2 2 2
GTA 4 4 4 4 4 4 | GCA 4 4 4 4 4 4 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 4 4 4 4 4 4 | GCG 3 3 3 3 3 3 | GAG 7 7 7 7 7 7 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908138_1_1161_MLBR_RS05445
position 1: T:0.11180 C:0.26087 A:0.26087 G:0.36646
position 2: T:0.24845 C:0.31056 A:0.24224 G:0.19876
position 3: T:0.12422 C:0.38509 A:0.19876 G:0.29193
Average T:0.16149 C:0.31884 A:0.23395 G:0.28571
#2: NC_002677_1_NP_301814_1_686_ML1117
position 1: T:0.11180 C:0.26087 A:0.26087 G:0.36646
position 2: T:0.24845 C:0.31056 A:0.24224 G:0.19876
position 3: T:0.12422 C:0.38509 A:0.19876 G:0.29193
Average T:0.16149 C:0.31884 A:0.23395 G:0.28571
#3: NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305
position 1: T:0.11180 C:0.26087 A:0.26087 G:0.36646
position 2: T:0.24845 C:0.31056 A:0.24224 G:0.19876
position 3: T:0.12422 C:0.38509 A:0.19876 G:0.29193
Average T:0.16149 C:0.31884 A:0.23395 G:0.28571
#4: NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955
position 1: T:0.11180 C:0.26087 A:0.26087 G:0.36646
position 2: T:0.24845 C:0.31056 A:0.24224 G:0.19876
position 3: T:0.12422 C:0.38509 A:0.19876 G:0.29193
Average T:0.16149 C:0.31884 A:0.23395 G:0.28571
#5: NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980
position 1: T:0.11180 C:0.26087 A:0.26087 G:0.36646
position 2: T:0.24845 C:0.31056 A:0.24224 G:0.19876
position 3: T:0.12422 C:0.38509 A:0.19876 G:0.29193
Average T:0.16149 C:0.31884 A:0.23395 G:0.28571
#6: NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100
position 1: T:0.11180 C:0.26087 A:0.26087 G:0.36646
position 2: T:0.24845 C:0.31056 A:0.24224 G:0.19876
position 3: T:0.12422 C:0.38509 A:0.19876 G:0.29193
Average T:0.16149 C:0.31884 A:0.23395 G:0.28571
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 6
TTC 18 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 24 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 0
CTC 30 | CCC 6 | CAC 24 | CGC 42
CTA 12 | CCA 30 | Gln Q CAA 12 | CGA 6
CTG 24 | CCG 12 | CAG 0 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 12 | Ser S AGT 6
ATC 30 | ACC 36 | AAC 12 | AGC 24
ATA 18 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 30 | AAG 18 | AGG 18
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 24 | Asp D GAT 0 | Gly G GGT 24
GTC 24 | GCC 54 | GAC 42 | GGC 12
GTA 24 | GCA 24 | Glu E GAA 24 | GGA 0
GTG 24 | GCG 18 | GAG 42 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11180 C:0.26087 A:0.26087 G:0.36646
position 2: T:0.24845 C:0.31056 A:0.24224 G:0.19876
position 3: T:0.12422 C:0.38509 A:0.19876 G:0.29193
Average T:0.16149 C:0.31884 A:0.23395 G:0.28571
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -640.284113 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299888 1.299951
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908138_1_1161_MLBR_RS05445: 0.000004, NC_002677_1_NP_301814_1_686_ML1117: 0.000004, NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305: 0.000004, NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955: 0.000004, NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980: 0.000004, NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29989
omega (dN/dS) = 1.29995
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 367.1 115.9 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 367.1 115.9 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 367.1 115.9 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 367.1 115.9 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 367.1 115.9 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 367.1 115.9 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -640.284086 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.291711 0.794991 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908138_1_1161_MLBR_RS05445: 0.000004, NC_002677_1_NP_301814_1_686_ML1117: 0.000004, NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305: 0.000004, NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955: 0.000004, NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980: 0.000004, NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29171
MLEs of dN/dS (w) for site classes (K=2)
p: 0.79499 0.20501
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 367.2 115.8 0.2050 0.0000 0.0000 0.0 0.0
7..2 0.000 367.2 115.8 0.2050 0.0000 0.0000 0.0 0.0
7..3 0.000 367.2 115.8 0.2050 0.0000 0.0000 0.0 0.0
7..4 0.000 367.2 115.8 0.2050 0.0000 0.0000 0.0 0.0
7..5 0.000 367.2 115.8 0.2050 0.0000 0.0000 0.0 0.0
7..6 0.000 367.2 115.8 0.2050 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -640.284100 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.259793 0.623909 0.217361 0.084928 1.403497
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908138_1_1161_MLBR_RS05445: 0.000004, NC_002677_1_NP_301814_1_686_ML1117: 0.000004, NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305: 0.000004, NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955: 0.000004, NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980: 0.000004, NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.25979
MLEs of dN/dS (w) for site classes (K=3)
p: 0.62391 0.21736 0.15873
w: 0.08493 1.00000 1.40350
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 367.5 115.5 0.4931 0.0000 0.0000 0.0 0.0
7..2 0.000 367.5 115.5 0.4931 0.0000 0.0000 0.0 0.0
7..3 0.000 367.5 115.5 0.4931 0.0000 0.0000 0.0 0.0
7..4 0.000 367.5 115.5 0.4931 0.0000 0.0000 0.0 0.0
7..5 0.000 367.5 115.5 0.4931 0.0000 0.0000 0.0 0.0
7..6 0.000 367.5 115.5 0.4931 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908138_1_1161_MLBR_RS05445)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908138_1_1161_MLBR_RS05445)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -640.284069 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 11.871392 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908138_1_1161_MLBR_RS05445: 0.000004, NC_002677_1_NP_301814_1_686_ML1117: 0.000004, NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305: 0.000004, NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955: 0.000004, NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980: 0.000004, NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 11.87139 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.06333 0.07713 0.08618 0.09386 0.10109 0.10840 0.11627 0.12541 0.13740 0.15889
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 370.3 112.7 0.1068 0.0000 0.0000 0.0 0.0
7..2 0.000 370.3 112.7 0.1068 0.0000 0.0000 0.0 0.0
7..3 0.000 370.3 112.7 0.1068 0.0000 0.0000 0.0 0.0
7..4 0.000 370.3 112.7 0.1068 0.0000 0.0000 0.0 0.0
7..5 0.000 370.3 112.7 0.1068 0.0000 0.0000 0.0 0.0
7..6 0.000 370.3 112.7 0.1068 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -640.284050 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.849123 2.535304
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908138_1_1161_MLBR_RS05445: 0.000004, NC_002677_1_NP_301814_1_686_ML1117: 0.000004, NZ_LVXE01000074_1_WP_010908138_1_2635_A3216_RS13305: 0.000004, NZ_LYPH01000021_1_WP_010908138_1_832_A8144_RS03955: 0.000004, NZ_CP029543_1_WP_010908138_1_1181_DIJ64_RS05980: 0.000004, NZ_AP014567_1_WP_010908138_1_1205_JK2ML_RS06100: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.84912
(p1 = 0.00001) w = 2.53530
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.53530
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 370.3 112.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 370.3 112.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 370.3 112.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 370.3 112.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 370.3 112.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 370.3 112.7 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908138_1_1161_MLBR_RS05445)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:19
Model 1: NearlyNeutral -640.284086 Model 2: PositiveSelection -640.2841 Model 0: one-ratio -640.284113 Model 7: beta -640.284069 Model 8: beta&w>1 -640.28405 Model 0 vs 1 5.400000009103678E-5 Model 2 vs 1 2.7999999929306796E-5 Model 8 vs 7 3.80000001314329E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
