--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:43:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0806/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -690.60 -694.94
2 -690.55 -693.52
--------------------------------------
TOTAL -690.58 -694.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883773 0.088044 0.387406 1.499661 0.852219 1301.81 1401.41 1.000
r(A<->C){all} 0.159753 0.018740 0.000060 0.430846 0.120872 296.98 317.77 1.000
r(A<->G){all} 0.158860 0.017650 0.000108 0.426831 0.124811 144.69 221.25 1.002
r(A<->T){all} 0.172706 0.019874 0.000115 0.461718 0.138028 173.03 231.89 1.007
r(C<->G){all} 0.166224 0.019313 0.000115 0.444009 0.129966 198.43 203.59 1.011
r(C<->T){all} 0.166672 0.019627 0.000029 0.438971 0.130942 175.47 239.26 1.000
r(G<->T){all} 0.175785 0.022011 0.000074 0.464345 0.137216 200.15 205.14 1.000
pi(A){all} 0.128102 0.000214 0.100936 0.157676 0.127499 1309.30 1366.54 1.000
pi(C){all} 0.256030 0.000357 0.218508 0.291841 0.256007 1180.12 1210.56 1.000
pi(G){all} 0.361227 0.000423 0.321904 0.402744 0.360532 1220.68 1235.73 1.001
pi(T){all} 0.254640 0.000370 0.219859 0.295383 0.254155 1193.76 1240.07 1.001
alpha{1,2} 0.420807 0.245804 0.000122 1.425032 0.239635 1001.23 1056.14 1.001
alpha{3} 0.444051 0.230367 0.000102 1.427905 0.288359 1087.94 1178.48 1.000
pinvar{all} 0.996874 0.000015 0.989712 0.999999 0.998084 1264.23 1343.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -670.764069
Model 2: PositiveSelection -670.764058
Model 0: one-ratio -670.764068
Model 7: beta -670.764074
Model 8: beta&w>1 -670.764057
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 2.199999994445534E-5
Model 8 vs 7 3.400000014153193E-5
>C1
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C2
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C3
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C4
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C5
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C6
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=173
C1 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C2 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C3 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C4 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C5 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C6 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
**************************************************
C1 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C2 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C3 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C4 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C5 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C6 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
**************************************************
C1 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C2 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C3 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C4 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C5 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C6 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
**************************************************
C1 VRWSAGAYQRSVASSANRKADSR
C2 VRWSAGAYQRSVASSANRKADSR
C3 VRWSAGAYQRSVASSANRKADSR
C4 VRWSAGAYQRSVASSANRKADSR
C5 VRWSAGAYQRSVASSANRKADSR
C6 VRWSAGAYQRSVASSANRKADSR
***********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 173 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 173 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5190]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5190]--->[5190]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.473 Mb, Max= 30.711 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C2 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C3 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C4 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C5 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
C6 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
**************************************************
C1 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C2 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C3 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C4 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C5 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
C6 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
**************************************************
C1 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C2 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C3 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C4 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C5 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
C6 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
**************************************************
C1 VRWSAGAYQRSVASSANRKADSR
C2 VRWSAGAYQRSVASSANRKADSR
C3 VRWSAGAYQRSVASSANRKADSR
C4 VRWSAGAYQRSVASSANRKADSR
C5 VRWSAGAYQRSVASSANRKADSR
C6 VRWSAGAYQRSVASSANRKADSR
***********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
C2 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
C3 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
C4 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
C5 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
C6 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
**************************************************
C1 TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
C2 TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
C3 TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
C4 TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
C5 TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
C6 TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
**************************************************
C1 GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
C2 GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
C3 GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
C4 GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
C5 GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
C6 GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
**************************************************
C1 GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
C2 GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
C3 GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
C4 GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
C5 GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
C6 GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
**************************************************
C1 CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
C2 CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
C3 CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
C4 CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
C5 CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
C6 CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
**************************************************
C1 TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
C2 TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
C3 TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
C4 TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
C5 TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
C6 TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
**************************************************
C1 CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
C2 CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
C3 CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
C4 CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
C5 CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
C6 CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
**************************************************
C1 AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
C2 AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
C3 AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
C4 AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
C5 AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
C6 AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
**************************************************
C1 TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
C2 TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
C3 TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
C4 TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
C5 TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
C6 TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
**************************************************
C1 GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
C2 GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
C3 GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
C4 GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
C5 GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
C6 GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
**************************************************
C1 TCGCAAGGCGGACAGTCGG
C2 TCGCAAGGCGGACAGTCGG
C3 TCGCAAGGCGGACAGTCGG
C4 TCGCAAGGCGGACAGTCGG
C5 TCGCAAGGCGGACAGTCGG
C6 TCGCAAGGCGGACAGTCGG
*******************
>C1
GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
TCGCAAGGCGGACAGTCGG
>C2
GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
TCGCAAGGCGGACAGTCGG
>C3
GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
TCGCAAGGCGGACAGTCGG
>C4
GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
TCGCAAGGCGGACAGTCGG
>C5
GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
TCGCAAGGCGGACAGTCGG
>C6
GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG
TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC
GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT
GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG
CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG
TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG
CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT
AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA
TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT
GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA
TCGCAAGGCGGACAGTCGG
>C1
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C2
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C3
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C4
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C5
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
>C6
VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
VRWSAGAYQRSVASSANRKADSR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 519 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579797718
Setting output file names to "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 246815929
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0577883570
Seed = 283521902
Swapseed = 1579797718
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1161.546806 -- -24.965149
Chain 2 -- -1161.546874 -- -24.965149
Chain 3 -- -1161.546874 -- -24.965149
Chain 4 -- -1161.546806 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1161.546874 -- -24.965149
Chain 2 -- -1161.546806 -- -24.965149
Chain 3 -- -1161.546874 -- -24.965149
Chain 4 -- -1161.546698 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1161.547] (-1161.547) (-1161.547) (-1161.547) * [-1161.547] (-1161.547) (-1161.547) (-1161.547)
500 -- (-714.469) [-703.431] (-703.092) (-715.097) * (-704.045) [-712.631] (-712.966) (-711.261) -- 0:00:00
1000 -- (-699.941) (-701.644) [-704.534] (-705.059) * [-696.192] (-703.336) (-697.201) (-706.909) -- 0:00:00
1500 -- (-696.723) [-698.816] (-701.174) (-693.988) * (-698.861) [-700.037] (-701.824) (-698.157) -- 0:00:00
2000 -- (-697.392) (-698.239) [-702.260] (-699.023) * [-707.791] (-701.648) (-694.337) (-702.737) -- 0:00:00
2500 -- (-705.715) (-695.126) (-698.226) [-705.236] * (-700.214) (-707.177) [-702.177] (-697.415) -- 0:00:00
3000 -- (-707.099) [-698.416] (-700.912) (-697.809) * (-704.437) (-704.826) (-696.750) [-699.754] -- 0:00:00
3500 -- [-699.839] (-701.492) (-703.410) (-698.684) * (-708.316) (-695.759) (-705.205) [-702.200] -- 0:00:00
4000 -- (-696.301) (-700.971) [-696.537] (-703.576) * (-701.878) (-702.558) [-703.651] (-705.447) -- 0:00:00
4500 -- (-696.351) (-704.274) [-695.521] (-702.849) * (-704.676) (-703.070) (-702.483) [-700.148] -- 0:00:00
5000 -- [-701.181] (-701.845) (-695.580) (-702.905) * (-701.488) [-698.967] (-701.333) (-709.037) -- 0:00:00
Average standard deviation of split frequencies: 0.074432
5500 -- [-701.971] (-708.889) (-702.371) (-702.278) * (-703.716) (-699.047) (-704.745) [-700.190] -- 0:00:00
6000 -- [-699.242] (-700.340) (-703.039) (-702.984) * (-702.670) (-698.082) (-701.547) [-706.029] -- 0:00:00
6500 -- (-698.350) (-698.424) [-700.541] (-700.737) * (-696.838) (-702.915) [-699.470] (-700.015) -- 0:00:00
7000 -- [-705.226] (-700.459) (-698.995) (-712.995) * (-689.740) (-695.529) [-698.849] (-711.818) -- 0:00:00
7500 -- (-699.312) (-698.019) [-698.867] (-701.500) * (-689.507) (-700.426) (-701.977) [-694.791] -- 0:00:00
8000 -- [-699.773] (-694.718) (-699.491) (-710.370) * [-691.523] (-703.525) (-697.700) (-700.580) -- 0:00:00
8500 -- [-700.852] (-702.584) (-705.153) (-700.226) * (-691.384) [-700.677] (-701.699) (-704.573) -- 0:00:00
9000 -- [-699.008] (-701.604) (-706.407) (-698.867) * (-693.856) [-704.168] (-707.289) (-704.610) -- 0:00:00
9500 -- [-698.543] (-709.850) (-702.877) (-700.831) * [-691.456] (-702.728) (-700.829) (-704.350) -- 0:00:00
10000 -- (-703.584) (-702.674) [-702.167] (-707.959) * [-692.296] (-697.952) (-695.603) (-704.108) -- 0:00:00
Average standard deviation of split frequencies: 0.090493
10500 -- [-703.992] (-708.301) (-700.431) (-708.243) * (-691.378) (-710.899) [-698.904] (-698.778) -- 0:00:00
11000 -- (-707.719) [-700.690] (-699.210) (-690.564) * (-690.425) [-704.047] (-710.974) (-702.652) -- 0:00:00
11500 -- [-698.906] (-697.710) (-698.801) (-693.802) * [-690.835] (-703.671) (-703.951) (-702.888) -- 0:00:00
12000 -- (-694.324) (-701.547) (-695.103) [-690.692] * [-691.163] (-699.092) (-701.097) (-693.418) -- 0:00:00
12500 -- (-701.948) (-701.472) [-701.853] (-691.073) * (-689.449) [-697.853] (-697.084) (-689.272) -- 0:00:00
13000 -- [-700.458] (-704.364) (-700.014) (-693.163) * [-691.601] (-704.001) (-697.719) (-689.444) -- 0:00:00
13500 -- (-697.486) (-695.358) (-704.580) [-689.762] * (-698.797) (-702.180) [-700.843] (-692.185) -- 0:00:00
14000 -- [-699.600] (-701.472) (-709.241) (-691.209) * (-695.805) (-705.547) [-704.680] (-694.897) -- 0:00:00
14500 -- (-701.883) (-698.862) [-701.523] (-694.176) * (-692.265) (-697.813) (-701.542) [-692.082] -- 0:01:07
15000 -- (-699.159) (-711.588) [-700.736] (-690.479) * (-691.020) (-705.362) (-698.713) [-690.210] -- 0:01:05
Average standard deviation of split frequencies: 0.083478
15500 -- (-707.822) (-703.369) [-700.568] (-691.096) * (-690.658) [-703.171] (-719.151) (-689.514) -- 0:01:03
16000 -- (-697.360) [-702.114] (-696.011) (-692.972) * (-690.527) (-705.393) (-698.049) [-689.556] -- 0:01:01
16500 -- [-703.839] (-698.288) (-703.307) (-692.309) * (-690.974) (-704.285) (-693.078) [-689.940] -- 0:00:59
17000 -- (-700.811) (-708.837) (-697.860) [-689.787] * (-691.504) (-705.668) (-692.943) [-692.997] -- 0:00:57
17500 -- (-696.742) [-696.113] (-698.256) (-690.558) * (-691.826) [-703.365] (-694.922) (-689.776) -- 0:00:56
18000 -- (-702.026) [-698.146] (-695.720) (-693.785) * [-692.740] (-706.760) (-689.853) (-691.160) -- 0:00:54
18500 -- (-700.607) (-698.333) [-701.660] (-690.175) * (-693.169) (-704.741) [-689.460] (-690.549) -- 0:00:53
19000 -- (-701.781) (-699.062) [-699.562] (-690.629) * (-693.086) (-694.927) [-690.032] (-691.276) -- 0:00:51
19500 -- (-701.411) (-696.431) [-697.101] (-691.682) * (-693.296) (-690.352) [-690.025] (-690.979) -- 0:00:50
20000 -- (-705.207) (-703.071) (-698.382) [-691.891] * [-690.224] (-692.525) (-689.568) (-694.043) -- 0:00:49
Average standard deviation of split frequencies: 0.099793
20500 -- (-701.431) [-702.879] (-696.260) (-692.162) * (-692.594) (-690.179) [-689.574] (-689.291) -- 0:00:47
21000 -- [-693.321] (-704.182) (-701.363) (-696.266) * [-694.424] (-689.596) (-691.455) (-692.921) -- 0:00:46
21500 -- [-701.577] (-703.577) (-704.579) (-693.811) * (-691.646) (-692.584) (-693.471) [-692.332] -- 0:00:45
22000 -- [-702.225] (-703.604) (-701.963) (-690.485) * (-694.415) (-691.435) (-692.903) [-692.432] -- 0:00:44
22500 -- [-695.202] (-707.491) (-706.928) (-690.144) * (-689.724) [-691.116] (-691.363) (-694.755) -- 0:00:43
23000 -- [-697.435] (-703.953) (-701.729) (-692.204) * (-690.280) (-695.167) (-689.497) [-690.742] -- 0:00:42
23500 -- (-717.096) (-699.458) [-697.864] (-692.547) * (-690.802) (-693.271) [-689.775] (-690.186) -- 0:00:41
24000 -- (-689.342) (-712.163) (-701.556) [-694.037] * (-690.710) (-690.917) [-689.248] (-692.208) -- 0:00:40
24500 -- [-692.269] (-700.550) (-701.617) (-690.073) * [-689.711] (-691.256) (-691.676) (-689.416) -- 0:00:39
25000 -- (-691.125) (-690.971) [-696.142] (-692.200) * (-690.558) (-691.307) [-692.882] (-690.553) -- 0:00:39
Average standard deviation of split frequencies: 0.056865
25500 -- [-690.353] (-693.968) (-704.920) (-690.890) * (-689.569) (-690.426) [-693.029] (-694.676) -- 0:00:38
26000 -- (-691.333) (-691.540) [-704.097] (-692.197) * (-690.648) [-691.241] (-690.497) (-690.211) -- 0:00:37
26500 -- (-691.546) (-690.269) [-702.860] (-690.959) * (-696.044) (-691.582) [-691.580] (-690.206) -- 0:00:36
27000 -- (-690.417) (-690.074) [-702.383] (-692.002) * (-694.877) [-690.731] (-694.169) (-692.863) -- 0:00:36
27500 -- [-690.023] (-690.178) (-700.419) (-692.070) * (-693.081) (-690.817) [-689.919] (-689.241) -- 0:00:35
28000 -- (-690.078) (-691.566) [-696.133] (-692.224) * (-690.898) (-689.575) (-691.642) [-691.340] -- 0:00:34
28500 -- (-689.756) (-695.698) [-697.337] (-689.630) * (-691.241) (-696.050) (-694.610) [-690.328] -- 0:00:34
29000 -- (-692.276) (-692.069) (-698.184) [-691.243] * [-691.792] (-696.021) (-696.255) (-690.011) -- 0:00:33
29500 -- (-689.383) (-692.723) [-694.164] (-696.548) * (-694.297) (-695.388) [-690.114] (-690.127) -- 0:00:32
30000 -- (-690.668) (-698.913) (-708.820) [-691.232] * (-690.189) [-692.558] (-690.366) (-689.958) -- 0:00:32
Average standard deviation of split frequencies: 0.048828
30500 -- (-694.114) (-692.958) (-724.776) [-690.469] * (-691.551) (-694.623) [-690.018] (-692.325) -- 0:00:31
31000 -- (-689.881) [-689.658] (-715.983) (-690.734) * (-691.655) (-693.079) [-689.795] (-691.078) -- 0:01:02
31500 -- (-690.788) (-691.606) (-696.188) [-690.335] * (-690.561) (-690.578) [-690.685] (-691.540) -- 0:01:01
32000 -- (-691.287) (-692.828) (-691.323) [-691.850] * [-692.262] (-690.075) (-690.716) (-692.278) -- 0:01:00
32500 -- (-692.476) [-691.464] (-691.673) (-696.664) * (-692.810) [-690.486] (-689.776) (-692.245) -- 0:00:59
33000 -- [-692.847] (-690.790) (-691.343) (-692.698) * (-691.984) (-693.317) (-689.242) [-690.077] -- 0:00:58
33500 -- (-689.670) (-691.533) [-689.811] (-694.278) * (-693.245) (-694.279) [-696.303] (-692.515) -- 0:00:57
34000 -- (-691.673) (-690.781) (-691.864) [-693.387] * (-689.818) (-690.825) [-692.325] (-692.098) -- 0:00:56
34500 -- (-692.780) (-689.591) (-690.409) [-689.849] * (-692.254) (-691.011) (-692.526) [-689.675] -- 0:00:55
35000 -- (-694.360) [-691.311] (-690.149) (-689.990) * [-698.526] (-690.054) (-693.579) (-692.495) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- (-690.219) (-689.658) (-691.342) [-689.617] * [-695.981] (-692.986) (-689.605) (-690.281) -- 0:00:54
36000 -- [-693.978] (-695.898) (-691.948) (-689.979) * [-690.102] (-692.864) (-692.256) (-690.629) -- 0:00:53
36500 -- [-693.095] (-690.484) (-690.757) (-691.328) * [-690.090] (-693.636) (-689.278) (-690.346) -- 0:00:52
37000 -- (-694.804) (-690.655) [-689.682] (-689.525) * (-691.100) (-695.646) [-689.041] (-690.769) -- 0:00:52
37500 -- (-694.574) (-692.997) [-691.532] (-691.025) * (-690.290) (-690.657) (-690.951) [-689.868] -- 0:00:51
38000 -- (-698.632) (-693.892) (-691.578) [-692.254] * (-689.531) [-692.500] (-691.868) (-689.536) -- 0:00:50
38500 -- (-693.568) [-695.270] (-698.966) (-695.281) * [-690.958] (-693.428) (-692.884) (-689.535) -- 0:00:49
39000 -- [-692.423] (-691.228) (-690.660) (-691.979) * (-694.314) (-689.992) (-689.779) [-693.145] -- 0:00:49
39500 -- [-690.391] (-693.606) (-693.652) (-691.644) * (-697.365) (-689.335) [-691.366] (-695.029) -- 0:00:48
40000 -- (-690.181) (-689.808) (-690.513) [-693.725] * (-692.558) [-690.375] (-691.029) (-694.735) -- 0:00:48
Average standard deviation of split frequencies: 0.037352
40500 -- (-694.223) (-692.303) [-691.195] (-691.006) * [-692.210] (-697.635) (-689.948) (-692.804) -- 0:00:47
41000 -- (-690.605) (-693.779) [-690.811] (-690.769) * (-691.213) (-693.442) [-692.512] (-693.308) -- 0:00:46
41500 -- (-690.558) [-691.306] (-689.282) (-690.367) * (-699.616) (-689.343) (-698.750) [-690.443] -- 0:00:46
42000 -- (-689.867) (-690.731) [-689.567] (-693.554) * [-696.799] (-689.234) (-692.830) (-690.364) -- 0:00:45
42500 -- [-694.190] (-692.232) (-690.834) (-691.691) * (-693.426) (-690.863) [-692.071] (-692.638) -- 0:00:45
43000 -- (-692.770) (-692.203) [-690.914] (-690.674) * (-691.595) (-693.273) [-691.822] (-691.319) -- 0:00:44
43500 -- (-693.413) [-690.376] (-689.847) (-690.955) * (-690.340) (-690.295) [-691.358] (-693.533) -- 0:00:43
44000 -- (-689.847) (-692.701) (-689.429) [-689.838] * (-689.697) [-691.899] (-692.139) (-693.777) -- 0:00:43
44500 -- (-689.556) (-690.862) (-689.579) [-689.898] * (-689.453) (-691.024) [-690.436] (-693.679) -- 0:00:42
45000 -- (-689.505) [-691.683] (-690.669) (-692.838) * (-692.084) (-691.641) (-692.905) [-689.823] -- 0:00:42
Average standard deviation of split frequencies: 0.033818
45500 -- [-690.040] (-692.484) (-694.394) (-690.647) * [-692.072] (-691.000) (-693.287) (-690.070) -- 0:00:41
46000 -- [-692.834] (-696.378) (-694.006) (-690.161) * (-690.694) [-690.645] (-691.894) (-690.188) -- 0:00:41
46500 -- (-691.696) (-691.704) [-693.876] (-691.946) * [-692.404] (-693.303) (-691.550) (-690.107) -- 0:00:41
47000 -- (-691.192) [-690.988] (-700.302) (-693.392) * [-690.925] (-692.466) (-689.433) (-698.125) -- 0:00:40
47500 -- (-694.203) (-698.792) (-698.394) [-701.466] * (-691.158) (-692.672) [-691.669] (-695.720) -- 0:00:40
48000 -- (-693.279) [-696.581] (-695.628) (-697.859) * (-691.236) [-692.356] (-691.950) (-698.712) -- 0:00:59
48500 -- (-689.963) (-694.697) [-692.255] (-691.539) * (-690.764) (-691.784) [-690.167] (-691.175) -- 0:00:58
49000 -- (-690.884) (-692.769) (-693.582) [-689.831] * [-689.435] (-690.834) (-692.750) (-694.310) -- 0:00:58
49500 -- [-689.420] (-692.203) (-693.152) (-692.526) * (-689.323) (-692.465) (-691.289) [-690.234] -- 0:00:57
50000 -- (-693.267) [-690.431] (-693.499) (-690.363) * [-689.697] (-692.395) (-691.044) (-693.928) -- 0:00:57
Average standard deviation of split frequencies: 0.028798
50500 -- (-693.731) [-689.742] (-691.003) (-692.204) * (-690.597) (-691.004) [-693.517] (-693.939) -- 0:00:56
51000 -- (-693.929) [-689.510] (-692.760) (-690.551) * (-689.637) (-694.510) [-695.808] (-690.487) -- 0:00:55
51500 -- (-696.050) [-689.704] (-697.656) (-691.875) * [-692.870] (-690.867) (-692.615) (-690.443) -- 0:00:55
52000 -- [-691.085] (-689.601) (-692.706) (-694.685) * [-692.128] (-691.751) (-695.483) (-691.377) -- 0:00:54
52500 -- [-691.101] (-689.020) (-690.200) (-690.706) * (-690.627) (-693.251) (-690.214) [-690.418] -- 0:00:54
53000 -- (-690.240) (-690.041) (-690.629) [-690.311] * (-692.751) (-692.699) [-691.224] (-692.177) -- 0:00:53
53500 -- (-699.075) (-689.576) (-691.120) [-689.511] * (-693.631) [-692.813] (-692.455) (-690.201) -- 0:00:53
54000 -- (-691.920) [-690.031] (-694.735) (-691.176) * (-694.308) (-692.773) [-691.797] (-689.593) -- 0:00:52
54500 -- [-693.778] (-691.411) (-696.303) (-691.005) * (-691.448) (-694.218) (-693.958) [-688.924] -- 0:00:52
55000 -- [-690.215] (-691.862) (-693.389) (-691.816) * (-690.799) [-690.926] (-691.736) (-692.116) -- 0:00:51
Average standard deviation of split frequencies: 0.024853
55500 -- (-691.851) (-689.705) [-691.627] (-689.634) * (-692.838) (-690.070) (-691.934) [-691.617] -- 0:00:51
56000 -- (-690.916) (-690.713) [-692.199] (-692.189) * (-692.658) (-693.748) [-692.812] (-692.136) -- 0:00:50
56500 -- [-692.908] (-692.853) (-690.364) (-691.067) * (-692.651) (-691.225) (-689.819) [-691.118] -- 0:00:50
57000 -- (-693.177) (-692.115) [-690.452] (-692.373) * [-692.466] (-690.860) (-690.380) (-691.028) -- 0:00:49
57500 -- (-693.032) [-690.481] (-691.472) (-689.524) * (-693.244) (-692.386) [-690.509] (-693.074) -- 0:00:49
58000 -- (-692.768) (-689.230) [-696.014] (-691.845) * [-691.442] (-694.756) (-691.995) (-691.501) -- 0:00:48
58500 -- (-695.701) (-690.418) [-690.908] (-689.698) * (-693.690) [-691.436] (-690.477) (-690.178) -- 0:00:48
59000 -- (-691.419) (-689.922) (-690.258) [-692.728] * (-693.817) (-692.792) (-693.194) [-691.796] -- 0:00:47
59500 -- (-691.152) (-689.525) [-689.596] (-690.560) * (-693.546) [-691.163] (-696.030) (-690.308) -- 0:00:47
60000 -- (-691.637) [-689.746] (-695.510) (-689.748) * [-696.445] (-690.593) (-692.767) (-690.079) -- 0:00:47
Average standard deviation of split frequencies: 0.029855
60500 -- (-689.844) (-690.442) (-694.060) [-691.246] * (-691.788) (-690.296) (-691.429) [-693.934] -- 0:00:46
61000 -- (-690.116) (-690.853) [-691.204] (-690.025) * (-690.116) (-691.074) [-688.921] (-694.355) -- 0:00:46
61500 -- [-689.731] (-689.217) (-693.401) (-690.464) * (-693.249) [-690.791] (-689.144) (-691.262) -- 0:00:45
62000 -- (-692.339) [-698.918] (-690.484) (-690.904) * [-690.013] (-691.817) (-689.417) (-690.880) -- 0:00:45
62500 -- (-690.927) (-693.659) (-691.729) [-690.748] * (-691.259) (-690.837) [-689.297] (-695.841) -- 0:00:45
63000 -- [-689.838] (-691.378) (-691.023) (-695.130) * (-689.618) [-690.858] (-691.878) (-693.174) -- 0:00:44
63500 -- (-690.452) (-693.825) [-690.672] (-690.518) * (-690.009) (-691.317) (-693.707) [-690.229] -- 0:00:44
64000 -- [-693.498] (-693.753) (-691.460) (-689.277) * (-690.068) (-690.134) (-693.419) [-691.522] -- 0:00:43
64500 -- (-692.011) [-694.794] (-693.037) (-689.548) * (-694.266) (-690.049) (-690.637) [-694.828] -- 0:00:43
65000 -- (-691.938) (-693.450) [-694.739] (-697.508) * (-692.501) [-691.949] (-694.779) (-691.792) -- 0:00:57
Average standard deviation of split frequencies: 0.026427
65500 -- [-691.195] (-691.560) (-691.119) (-691.038) * (-690.553) (-690.594) [-691.759] (-694.453) -- 0:00:57
66000 -- (-693.322) [-690.918] (-690.255) (-696.381) * [-690.226] (-692.913) (-692.286) (-691.555) -- 0:00:56
66500 -- [-689.705] (-691.470) (-691.368) (-690.137) * (-693.478) (-691.967) [-690.830] (-691.750) -- 0:00:56
67000 -- (-690.017) (-690.703) [-689.429] (-689.316) * (-691.160) (-690.055) (-690.991) [-691.669] -- 0:00:55
67500 -- (-690.133) (-693.325) [-690.664] (-690.186) * (-690.483) (-692.893) (-690.563) [-691.644] -- 0:00:55
68000 -- (-689.679) (-690.949) [-691.094] (-689.880) * (-691.749) (-693.408) [-691.313] (-690.843) -- 0:00:54
68500 -- (-690.492) [-691.703] (-692.969) (-690.560) * [-694.083] (-693.381) (-691.023) (-690.851) -- 0:00:54
69000 -- (-690.338) [-690.521] (-690.344) (-689.671) * [-694.312] (-692.751) (-690.779) (-691.769) -- 0:00:53
69500 -- (-689.205) (-693.395) [-690.359] (-691.425) * (-691.046) (-696.060) (-693.717) [-691.167] -- 0:00:53
70000 -- (-695.639) (-690.891) [-691.372] (-692.987) * [-691.903] (-694.427) (-694.928) (-693.375) -- 0:00:53
Average standard deviation of split frequencies: 0.029822
70500 -- (-695.447) (-689.487) [-690.614] (-694.156) * (-691.342) [-691.104] (-692.161) (-692.889) -- 0:00:52
71000 -- (-694.503) (-689.282) [-691.656] (-692.132) * [-690.484] (-690.474) (-691.389) (-692.762) -- 0:00:52
71500 -- (-693.813) (-690.947) (-691.336) [-689.210] * (-692.679) [-690.767] (-694.113) (-693.190) -- 0:00:51
72000 -- (-689.985) (-690.736) [-690.801] (-689.392) * (-693.360) [-692.605] (-690.284) (-693.074) -- 0:00:51
72500 -- (-689.718) [-691.471] (-692.373) (-690.205) * (-691.324) (-691.462) (-693.340) [-696.107] -- 0:00:51
73000 -- (-690.153) (-691.470) (-692.779) [-693.589] * (-690.602) [-692.564] (-696.851) (-693.278) -- 0:00:50
73500 -- [-691.028] (-690.199) (-691.362) (-692.211) * (-689.628) [-692.036] (-691.887) (-691.890) -- 0:00:50
74000 -- (-692.475) (-691.252) [-691.393] (-692.369) * (-691.449) (-691.244) [-690.302] (-692.766) -- 0:00:50
74500 -- [-690.409] (-691.704) (-689.408) (-691.002) * (-689.017) (-691.511) (-690.957) [-689.409] -- 0:00:49
75000 -- (-689.327) (-691.614) (-689.933) [-691.092] * (-689.829) (-689.354) [-693.983] (-694.444) -- 0:00:49
Average standard deviation of split frequencies: 0.029189
75500 -- (-690.781) [-690.875] (-689.498) (-691.924) * [-689.716] (-691.474) (-691.447) (-694.519) -- 0:00:48
76000 -- (-692.334) (-691.631) [-690.746] (-690.087) * (-692.942) [-690.610] (-694.114) (-691.797) -- 0:00:48
76500 -- (-691.227) (-692.739) (-689.571) [-691.299] * [-697.955] (-689.684) (-692.315) (-693.060) -- 0:00:48
77000 -- (-694.402) (-689.867) (-689.600) [-690.129] * [-690.309] (-690.781) (-692.433) (-691.664) -- 0:00:47
77500 -- (-692.630) (-691.379) (-689.789) [-690.477] * (-694.319) (-692.296) (-691.517) [-694.291] -- 0:00:47
78000 -- [-692.854] (-690.615) (-691.414) (-690.447) * (-690.065) [-690.894] (-695.261) (-692.820) -- 0:00:47
78500 -- (-691.334) [-690.589] (-691.235) (-692.267) * [-689.196] (-690.584) (-690.760) (-692.447) -- 0:00:46
79000 -- (-690.868) (-690.427) (-690.664) [-690.070] * [-690.277] (-691.417) (-693.055) (-695.947) -- 0:00:46
79500 -- (-691.640) (-691.560) [-693.582] (-690.003) * (-691.294) [-690.147] (-692.638) (-690.792) -- 0:00:46
80000 -- (-690.883) (-689.641) (-689.517) [-695.084] * (-689.593) (-690.534) [-691.736] (-694.588) -- 0:00:46
Average standard deviation of split frequencies: 0.028532
80500 -- (-691.189) (-692.211) [-690.107] (-691.924) * (-691.499) (-691.661) [-690.843] (-694.278) -- 0:00:45
81000 -- (-696.726) [-692.496] (-690.489) (-692.140) * (-691.689) (-692.921) (-689.585) [-691.126] -- 0:00:45
81500 -- (-692.728) (-693.585) (-690.499) [-691.937] * (-690.303) (-692.446) [-689.632] (-690.396) -- 0:00:56
82000 -- (-690.626) [-689.606] (-691.143) (-689.751) * (-690.918) [-689.681] (-690.263) (-689.711) -- 0:00:55
82500 -- (-689.927) (-690.622) [-692.180] (-689.880) * (-694.410) [-689.822] (-692.811) (-689.637) -- 0:00:55
83000 -- [-694.831] (-689.818) (-690.652) (-694.545) * (-692.123) (-689.463) (-692.572) [-691.753] -- 0:00:55
83500 -- [-692.471] (-689.958) (-690.868) (-691.659) * (-691.965) [-689.284] (-693.293) (-693.287) -- 0:00:54
84000 -- (-692.222) (-691.559) (-692.567) [-690.852] * (-690.048) (-690.465) (-691.031) [-695.864] -- 0:00:54
84500 -- [-695.448] (-690.565) (-691.102) (-692.865) * (-691.799) [-690.749] (-693.139) (-694.517) -- 0:00:54
85000 -- (-694.811) (-689.693) (-690.356) [-690.323] * (-691.634) (-692.157) [-690.064] (-692.508) -- 0:00:53
Average standard deviation of split frequencies: 0.026830
85500 -- (-690.656) (-691.237) (-690.918) [-691.023] * (-693.877) (-691.812) [-691.669] (-692.996) -- 0:00:53
86000 -- [-691.450] (-692.517) (-691.563) (-691.827) * (-690.696) (-692.210) (-691.392) [-690.876] -- 0:00:53
86500 -- (-690.135) [-693.778] (-693.731) (-690.627) * (-690.432) (-693.093) (-689.801) [-690.212] -- 0:00:52
87000 -- (-690.027) (-694.172) (-693.765) [-691.411] * [-691.591] (-691.760) (-690.832) (-692.744) -- 0:00:52
87500 -- (-690.993) (-698.254) [-690.642] (-694.302) * (-696.121) [-693.534] (-695.462) (-690.211) -- 0:00:52
88000 -- (-697.927) (-690.716) [-689.303] (-690.758) * [-692.210] (-691.638) (-694.258) (-690.033) -- 0:00:51
88500 -- (-692.946) [-693.157] (-689.791) (-704.008) * [-693.333] (-692.477) (-692.589) (-690.744) -- 0:00:51
89000 -- [-690.737] (-693.315) (-691.303) (-693.350) * [-691.609] (-690.130) (-691.307) (-693.543) -- 0:00:51
89500 -- [-691.902] (-691.377) (-691.673) (-690.170) * (-691.973) [-691.119] (-693.522) (-689.356) -- 0:00:50
90000 -- (-692.554) (-691.410) [-692.070] (-692.618) * [-691.073] (-691.212) (-692.078) (-692.210) -- 0:00:50
Average standard deviation of split frequencies: 0.027730
90500 -- (-691.989) (-694.281) (-694.552) [-691.880] * (-690.474) (-693.498) (-694.607) [-690.545] -- 0:00:50
91000 -- (-692.815) (-690.206) (-690.940) [-691.808] * (-692.011) (-689.216) (-692.737) [-690.698] -- 0:00:49
91500 -- (-690.530) (-691.744) [-691.055] (-690.691) * (-701.279) (-693.221) [-691.904] (-690.866) -- 0:00:49
92000 -- [-695.764] (-691.775) (-690.008) (-693.730) * (-693.401) (-691.515) (-689.955) [-695.225] -- 0:00:49
92500 -- (-691.373) (-691.337) [-693.594] (-692.044) * (-695.096) (-690.974) (-691.313) [-689.664] -- 0:00:49
93000 -- (-691.546) (-696.056) (-695.178) [-692.259] * (-692.235) [-693.462] (-690.201) (-694.935) -- 0:00:48
93500 -- [-690.576] (-691.610) (-692.138) (-689.874) * (-693.553) [-690.984] (-697.863) (-691.554) -- 0:00:48
94000 -- (-689.886) [-689.988] (-690.858) (-689.698) * (-693.344) [-692.566] (-691.875) (-690.586) -- 0:00:48
94500 -- (-689.495) (-691.102) (-690.660) [-690.542] * (-695.936) [-691.721] (-694.163) (-692.703) -- 0:00:47
95000 -- (-689.543) (-690.677) (-693.831) [-693.688] * (-692.796) (-696.563) (-694.544) [-689.145] -- 0:00:47
Average standard deviation of split frequencies: 0.028235
95500 -- (-690.553) [-689.673] (-693.448) (-690.979) * (-691.893) (-698.644) (-697.188) [-693.510] -- 0:00:47
96000 -- (-690.679) (-689.461) [-696.879] (-690.198) * (-694.061) [-691.208] (-693.927) (-689.812) -- 0:00:47
96500 -- (-691.410) (-693.519) [-691.901] (-695.014) * (-696.730) (-690.636) [-691.056] (-692.009) -- 0:00:46
97000 -- (-689.956) (-691.168) [-692.666] (-692.837) * (-690.526) (-690.630) (-691.402) [-692.560] -- 0:00:46
97500 -- (-690.755) (-690.688) (-695.423) [-692.916] * (-696.054) [-691.016] (-689.994) (-693.566) -- 0:00:46
98000 -- (-691.033) [-693.964] (-693.575) (-690.135) * (-689.574) [-689.193] (-689.133) (-689.146) -- 0:00:46
98500 -- (-692.355) (-691.391) (-693.024) [-692.209] * (-689.403) [-689.790] (-690.106) (-690.779) -- 0:00:54
99000 -- [-690.528] (-694.617) (-691.552) (-690.028) * (-695.974) (-690.241) (-691.446) [-689.803] -- 0:00:54
99500 -- (-690.676) (-689.573) (-691.174) [-693.195] * (-690.377) (-691.710) [-691.175] (-691.053) -- 0:00:54
100000 -- [-695.634] (-690.679) (-690.204) (-691.891) * (-689.722) (-695.168) (-690.568) [-692.380] -- 0:00:54
Average standard deviation of split frequencies: 0.024791
100500 -- (-692.694) [-690.963] (-691.892) (-694.815) * (-689.610) (-695.147) [-690.740] (-692.649) -- 0:00:53
101000 -- (-702.322) [-690.530] (-690.874) (-690.014) * (-692.795) [-695.726] (-693.843) (-690.241) -- 0:00:53
101500 -- (-691.451) [-690.436] (-690.534) (-690.349) * [-690.048] (-692.591) (-691.870) (-691.713) -- 0:00:53
102000 -- (-693.652) (-698.105) [-690.966] (-690.941) * (-689.867) (-692.885) [-690.491] (-693.212) -- 0:00:52
102500 -- (-695.225) (-694.604) [-689.358] (-690.467) * (-690.152) [-689.837] (-692.163) (-692.887) -- 0:00:52
103000 -- (-693.389) (-696.039) [-691.760] (-692.003) * (-690.372) (-693.181) [-694.411] (-692.303) -- 0:00:52
103500 -- (-692.862) (-689.850) (-691.998) [-692.344] * (-690.875) (-691.981) [-689.322] (-692.525) -- 0:00:51
104000 -- (-690.876) (-690.405) (-689.673) [-689.565] * (-691.573) (-693.425) (-691.390) [-691.786] -- 0:00:51
104500 -- (-692.282) (-693.289) [-692.280] (-692.932) * (-692.658) (-694.291) [-690.176] (-694.318) -- 0:00:51
105000 -- (-691.075) (-694.302) (-691.357) [-691.364] * [-689.636] (-694.254) (-690.816) (-692.442) -- 0:00:51
Average standard deviation of split frequencies: 0.022236
105500 -- [-695.425] (-691.480) (-690.244) (-691.683) * (-690.500) (-694.451) (-690.095) [-690.852] -- 0:00:50
106000 -- (-696.507) (-693.708) (-689.590) [-695.039] * [-689.853] (-691.790) (-689.360) (-690.624) -- 0:00:50
106500 -- (-691.232) (-693.206) [-691.168] (-689.232) * [-691.438] (-692.183) (-690.563) (-691.290) -- 0:00:50
107000 -- [-690.360] (-692.149) (-696.447) (-691.399) * [-690.825] (-690.570) (-690.534) (-693.077) -- 0:00:50
107500 -- (-690.171) (-693.314) (-693.502) [-693.023] * (-690.559) (-692.303) (-690.274) [-695.238] -- 0:00:49
108000 -- (-692.331) [-690.901] (-689.685) (-691.588) * (-693.287) (-689.217) (-691.669) [-692.449] -- 0:00:49
108500 -- (-689.914) (-691.544) [-690.346] (-693.355) * (-690.298) [-690.421] (-690.514) (-694.686) -- 0:00:49
109000 -- (-692.495) (-695.876) (-690.735) [-692.776] * (-689.556) [-691.919] (-691.721) (-691.089) -- 0:00:49
109500 -- (-689.639) (-692.026) [-690.670] (-692.537) * [-689.187] (-695.548) (-689.807) (-694.598) -- 0:00:48
110000 -- (-698.885) (-692.425) [-691.955] (-690.980) * (-689.390) (-699.464) [-694.055] (-691.257) -- 0:00:48
Average standard deviation of split frequencies: 0.023554
110500 -- (-691.571) (-692.622) (-690.359) [-691.964] * (-692.363) [-695.339] (-693.977) (-690.589) -- 0:00:48
111000 -- (-691.709) (-691.415) (-691.906) [-689.907] * (-690.095) (-694.291) [-691.579] (-690.898) -- 0:00:48
111500 -- (-692.796) (-690.807) (-689.436) [-691.611] * (-690.903) [-690.901] (-692.810) (-691.421) -- 0:00:47
112000 -- [-689.726] (-690.966) (-690.793) (-694.197) * (-692.557) [-691.104] (-690.966) (-690.220) -- 0:00:47
112500 -- (-690.605) [-692.876] (-690.204) (-693.738) * [-692.210] (-691.723) (-690.488) (-690.325) -- 0:00:47
113000 -- (-691.770) [-692.601] (-690.720) (-693.214) * (-693.299) (-692.476) (-689.571) [-690.256] -- 0:00:47
113500 -- (-689.756) [-691.081] (-696.535) (-693.556) * (-689.944) (-691.594) [-690.067] (-689.981) -- 0:00:46
114000 -- [-689.377] (-690.369) (-692.384) (-690.093) * (-692.287) [-692.560] (-689.887) (-691.474) -- 0:00:46
114500 -- (-689.281) [-690.108] (-691.336) (-690.903) * [-691.674] (-690.611) (-692.345) (-690.073) -- 0:00:46
115000 -- (-689.882) (-691.434) (-689.406) [-692.898] * [-690.674] (-692.949) (-692.587) (-691.727) -- 0:00:46
Average standard deviation of split frequencies: 0.025512
115500 -- [-690.175] (-692.289) (-689.110) (-692.861) * (-693.315) (-691.986) [-693.341] (-695.851) -- 0:00:53
116000 -- (-691.029) (-689.493) (-693.962) [-691.572] * [-691.545] (-690.638) (-689.861) (-691.689) -- 0:00:53
116500 -- (-690.670) [-689.908] (-690.914) (-690.257) * (-692.457) (-691.336) (-693.428) [-691.690] -- 0:00:53
117000 -- (-694.249) (-690.111) (-691.059) [-690.002] * (-692.886) (-693.225) [-692.320] (-689.507) -- 0:00:52
117500 -- (-689.408) (-690.354) [-690.395] (-691.104) * (-690.213) (-692.928) (-691.785) [-692.475] -- 0:00:52
118000 -- (-689.083) (-692.503) [-690.046] (-690.538) * (-692.878) (-689.406) (-691.488) [-692.634] -- 0:00:52
118500 -- (-693.505) (-690.726) (-690.961) [-695.108] * (-690.781) (-689.568) [-690.785] (-691.230) -- 0:00:52
119000 -- [-692.054] (-690.503) (-690.543) (-689.724) * (-693.414) (-691.882) (-692.522) [-693.545] -- 0:00:51
119500 -- (-693.043) (-690.760) (-692.717) [-689.811] * [-691.489] (-693.138) (-689.307) (-693.569) -- 0:00:51
120000 -- (-693.121) [-689.964] (-693.160) (-689.796) * (-689.907) (-689.788) (-694.783) [-691.221] -- 0:00:51
Average standard deviation of split frequencies: 0.022751
120500 -- (-692.664) (-694.809) [-691.637] (-692.472) * [-690.730] (-690.236) (-691.307) (-693.662) -- 0:00:51
121000 -- (-689.970) (-695.543) (-693.980) [-690.918] * [-690.525] (-691.234) (-690.139) (-691.976) -- 0:00:50
121500 -- (-690.327) [-689.904] (-693.162) (-690.813) * (-692.755) [-690.355] (-690.827) (-693.134) -- 0:00:50
122000 -- [-689.671] (-689.292) (-691.116) (-694.746) * (-693.468) [-691.467] (-692.341) (-690.571) -- 0:00:50
122500 -- (-693.649) (-690.052) [-691.972] (-694.252) * (-691.487) [-690.051] (-693.984) (-690.328) -- 0:00:50
123000 -- (-696.696) (-689.461) (-690.085) [-693.340] * (-690.943) (-689.523) (-693.317) [-690.147] -- 0:00:49
123500 -- (-689.516) (-690.492) [-690.051] (-692.931) * (-689.653) [-692.469] (-693.555) (-692.539) -- 0:00:49
124000 -- [-691.618] (-689.760) (-692.058) (-693.755) * (-690.632) (-692.623) [-696.420] (-690.763) -- 0:00:49
124500 -- [-690.507] (-689.108) (-691.178) (-691.943) * (-689.456) [-690.230] (-691.199) (-689.331) -- 0:00:49
125000 -- [-689.714] (-698.778) (-689.307) (-693.620) * (-690.585) (-690.616) [-690.582] (-689.422) -- 0:00:49
Average standard deviation of split frequencies: 0.018083
125500 -- (-689.587) (-693.585) [-691.079] (-691.514) * (-689.624) (-689.721) (-694.292) [-690.750] -- 0:00:48
126000 -- [-692.502] (-692.962) (-692.670) (-695.007) * (-690.747) [-693.833] (-695.277) (-695.143) -- 0:00:48
126500 -- (-691.958) (-692.558) [-690.426] (-689.825) * (-690.085) [-692.342] (-693.264) (-691.393) -- 0:00:48
127000 -- [-691.149] (-691.311) (-690.596) (-692.814) * (-691.713) [-694.908] (-690.350) (-689.704) -- 0:00:48
127500 -- [-690.992] (-690.790) (-693.655) (-692.440) * (-691.877) [-694.239] (-691.122) (-691.738) -- 0:00:47
128000 -- (-689.218) (-692.756) [-690.664] (-691.973) * (-690.104) [-691.247] (-692.335) (-690.721) -- 0:00:47
128500 -- (-691.330) (-695.121) (-689.802) [-690.405] * [-690.728] (-690.445) (-688.937) (-690.548) -- 0:00:47
129000 -- (-690.553) (-694.599) (-691.612) [-690.195] * (-691.818) (-691.947) [-692.745] (-690.797) -- 0:00:47
129500 -- (-689.381) (-690.287) [-693.769] (-691.318) * [-691.015] (-694.778) (-691.264) (-690.671) -- 0:00:47
130000 -- (-689.069) (-689.972) (-692.623) [-691.416] * [-692.588] (-690.255) (-691.208) (-693.053) -- 0:00:46
Average standard deviation of split frequencies: 0.019041
130500 -- [-691.405] (-695.701) (-689.903) (-689.925) * [-692.108] (-690.677) (-690.917) (-691.613) -- 0:00:46
131000 -- (-692.511) (-690.929) [-690.207] (-691.641) * (-695.240) (-689.727) [-690.674] (-690.399) -- 0:00:46
131500 -- [-689.531] (-690.285) (-694.263) (-693.065) * (-693.225) (-690.222) (-690.458) [-690.924] -- 0:00:46
132000 -- (-689.913) (-689.912) [-693.177] (-694.665) * (-691.690) (-689.132) [-690.141] (-690.685) -- 0:00:46
132500 -- [-691.076] (-690.988) (-692.897) (-689.910) * (-692.485) (-689.211) [-690.377] (-691.879) -- 0:00:52
133000 -- [-693.946] (-690.833) (-691.173) (-690.237) * (-689.905) (-689.890) [-690.527] (-691.214) -- 0:00:52
133500 -- (-693.929) [-692.828] (-691.084) (-690.667) * (-690.323) [-690.452] (-691.562) (-690.758) -- 0:00:51
134000 -- [-690.519] (-692.266) (-689.381) (-695.751) * (-689.702) (-691.611) (-689.808) [-691.518] -- 0:00:51
134500 -- (-692.484) [-689.941] (-689.881) (-695.539) * (-693.013) (-691.030) [-689.339] (-690.542) -- 0:00:51
135000 -- (-694.831) (-690.765) [-692.002] (-689.522) * (-691.603) [-690.158] (-689.336) (-691.059) -- 0:00:51
Average standard deviation of split frequencies: 0.017524
135500 -- (-690.151) (-690.829) (-689.996) [-690.175] * (-692.248) (-690.158) (-691.678) [-689.765] -- 0:00:51
136000 -- (-693.729) [-690.387] (-690.221) (-689.862) * (-691.314) (-690.510) (-694.096) [-689.376] -- 0:00:50
136500 -- [-693.353] (-691.800) (-692.157) (-694.818) * (-690.206) (-689.898) [-692.865] (-690.871) -- 0:00:50
137000 -- (-694.285) (-690.752) [-690.601] (-690.535) * [-693.154] (-690.951) (-691.257) (-689.397) -- 0:00:50
137500 -- [-694.205] (-692.463) (-690.559) (-698.567) * (-690.020) (-691.529) [-690.160] (-690.432) -- 0:00:50
138000 -- (-692.395) [-689.886] (-690.832) (-694.576) * (-692.272) (-691.377) [-695.723] (-689.957) -- 0:00:49
138500 -- (-690.493) (-691.990) [-689.119] (-689.491) * (-692.167) [-694.806] (-695.323) (-692.641) -- 0:00:49
139000 -- (-692.028) (-691.120) (-689.705) [-689.861] * (-690.755) [-690.817] (-695.377) (-690.515) -- 0:00:49
139500 -- (-690.260) (-689.923) (-690.349) [-691.976] * (-690.738) (-692.825) (-690.022) [-689.304] -- 0:00:49
140000 -- (-690.485) (-689.869) [-690.517] (-690.805) * (-690.049) (-691.511) (-695.340) [-689.382] -- 0:00:49
Average standard deviation of split frequencies: 0.016384
140500 -- [-691.499] (-694.300) (-692.157) (-690.694) * (-690.141) [-694.578] (-692.134) (-689.124) -- 0:00:48
141000 -- (-690.685) [-692.149] (-690.242) (-691.411) * (-693.215) [-691.429] (-693.575) (-691.024) -- 0:00:48
141500 -- (-691.262) (-689.397) (-692.990) [-691.883] * (-695.623) [-692.399] (-694.162) (-692.218) -- 0:00:48
142000 -- [-693.530] (-690.662) (-691.791) (-692.452) * (-696.241) (-691.398) (-693.179) [-690.063] -- 0:00:48
142500 -- (-692.058) (-691.090) [-691.324] (-691.499) * (-694.936) [-689.764] (-694.947) (-689.358) -- 0:00:48
143000 -- (-690.668) (-691.344) (-692.313) [-690.900] * (-691.520) [-690.241] (-690.156) (-691.036) -- 0:00:47
143500 -- (-689.647) (-692.025) (-696.058) [-690.361] * [-692.795] (-691.815) (-690.662) (-690.398) -- 0:00:47
144000 -- (-690.250) (-695.902) [-690.177] (-691.885) * [-696.516] (-692.049) (-689.868) (-690.392) -- 0:00:47
144500 -- [-695.390] (-697.355) (-689.573) (-691.589) * (-694.430) (-690.540) [-691.492] (-689.887) -- 0:00:47
145000 -- (-694.284) (-692.230) [-691.779] (-691.781) * (-690.421) (-690.554) (-690.223) [-690.135] -- 0:00:47
Average standard deviation of split frequencies: 0.018013
145500 -- (-690.779) (-695.330) (-696.712) [-690.371] * (-691.745) [-691.246] (-693.427) (-692.116) -- 0:00:46
146000 -- (-694.512) (-690.201) (-694.356) [-691.470] * (-694.183) (-692.169) (-691.468) [-690.903] -- 0:00:46
146500 -- [-690.745] (-692.798) (-691.076) (-690.388) * (-692.231) [-689.727] (-691.620) (-694.943) -- 0:00:46
147000 -- [-690.148] (-692.758) (-692.097) (-693.668) * (-690.894) (-694.698) (-692.190) [-690.755] -- 0:00:46
147500 -- (-692.984) (-690.148) [-691.106] (-694.598) * (-691.709) [-692.291] (-694.204) (-691.628) -- 0:00:46
148000 -- [-690.409] (-691.217) (-690.406) (-690.307) * (-690.495) (-690.817) [-691.845] (-690.326) -- 0:00:46
148500 -- (-692.384) (-692.019) (-689.503) [-690.389] * [-694.773] (-690.798) (-696.693) (-691.270) -- 0:00:45
149000 -- (-694.783) [-690.609] (-691.496) (-690.781) * (-689.761) [-693.983] (-692.492) (-691.487) -- 0:00:45
149500 -- [-690.850] (-693.911) (-691.002) (-692.338) * (-693.211) [-692.153] (-693.075) (-689.284) -- 0:00:51
150000 -- (-689.585) (-695.641) [-689.574] (-691.581) * (-693.472) (-695.248) (-690.869) [-689.757] -- 0:00:51
Average standard deviation of split frequencies: 0.016861
150500 -- [-693.214] (-690.299) (-693.598) (-690.087) * (-693.629) (-689.980) [-692.040] (-692.183) -- 0:00:50
151000 -- [-692.600] (-691.081) (-693.335) (-690.357) * (-691.237) (-691.844) [-694.360] (-689.817) -- 0:00:50
151500 -- [-689.833] (-690.000) (-690.657) (-691.557) * (-690.621) (-692.202) [-691.442] (-690.400) -- 0:00:50
152000 -- (-689.746) [-689.465] (-693.991) (-692.214) * (-691.215) [-693.852] (-692.975) (-691.316) -- 0:00:50
152500 -- (-689.731) [-691.184] (-692.439) (-690.358) * (-691.605) (-691.046) [-693.090] (-690.694) -- 0:00:50
153000 -- (-691.817) [-690.124] (-691.643) (-690.434) * (-690.088) (-689.655) [-691.258] (-691.444) -- 0:00:49
153500 -- (-690.951) (-690.365) [-689.720] (-691.044) * (-691.446) [-689.069] (-690.290) (-691.064) -- 0:00:49
154000 -- (-690.785) (-691.099) (-690.069) [-691.690] * (-690.163) [-689.211] (-689.874) (-692.282) -- 0:00:49
154500 -- (-693.310) (-690.214) [-690.316] (-691.410) * [-689.031] (-690.150) (-689.716) (-691.629) -- 0:00:49
155000 -- (-693.180) (-690.185) [-692.032] (-692.166) * (-689.548) [-689.856] (-689.586) (-690.052) -- 0:00:49
Average standard deviation of split frequencies: 0.015781
155500 -- [-690.616] (-690.200) (-690.233) (-690.263) * (-694.644) (-689.575) (-692.359) [-691.892] -- 0:00:48
156000 -- (-692.498) (-691.028) (-693.038) [-689.799] * [-694.499] (-689.297) (-691.924) (-692.939) -- 0:00:48
156500 -- (-692.529) (-692.057) [-689.622] (-691.091) * [-692.496] (-689.133) (-692.206) (-692.134) -- 0:00:48
157000 -- [-691.507] (-691.484) (-690.216) (-693.100) * [-689.940] (-691.444) (-692.206) (-693.130) -- 0:00:48
157500 -- (-691.793) (-692.035) (-694.384) [-693.396] * (-692.226) (-689.733) [-691.370] (-691.693) -- 0:00:48
158000 -- [-689.863] (-692.158) (-694.386) (-697.232) * [-690.202] (-689.277) (-690.333) (-690.361) -- 0:00:47
158500 -- (-689.853) (-689.647) [-689.579] (-691.548) * [-692.910] (-689.290) (-690.777) (-692.212) -- 0:00:47
159000 -- (-690.823) (-691.310) (-691.943) [-690.229] * [-691.844] (-690.927) (-691.466) (-691.052) -- 0:00:47
159500 -- (-692.378) (-689.937) (-690.323) [-690.305] * (-689.815) [-691.105] (-690.459) (-694.635) -- 0:00:47
160000 -- (-691.548) (-690.876) (-691.527) [-690.958] * [-692.321] (-690.747) (-691.753) (-689.587) -- 0:00:47
Average standard deviation of split frequencies: 0.016626
160500 -- [-692.037] (-691.598) (-690.602) (-695.071) * (-690.525) [-690.302] (-691.371) (-689.981) -- 0:00:47
161000 -- (-697.549) [-690.867] (-691.507) (-696.356) * (-690.182) (-692.634) [-691.140] (-691.227) -- 0:00:46
161500 -- (-693.407) (-689.712) [-689.501] (-694.553) * (-690.940) [-689.345] (-691.085) (-693.128) -- 0:00:46
162000 -- (-690.554) [-691.810] (-690.599) (-690.419) * [-691.013] (-689.969) (-691.913) (-690.433) -- 0:00:46
162500 -- (-693.632) (-694.748) [-692.014] (-690.358) * (-691.434) [-689.405] (-691.814) (-690.029) -- 0:00:46
163000 -- (-689.339) (-694.656) (-691.440) [-689.132] * (-692.341) (-689.303) [-691.990] (-692.631) -- 0:00:46
163500 -- (-689.614) (-692.746) (-691.246) [-690.046] * (-689.450) [-688.931] (-690.716) (-690.034) -- 0:00:46
164000 -- [-689.749] (-694.601) (-691.298) (-691.013) * [-690.650] (-689.012) (-690.841) (-691.298) -- 0:00:45
164500 -- (-692.095) (-689.430) [-689.441] (-689.628) * (-697.344) [-690.024] (-690.633) (-693.420) -- 0:00:45
165000 -- (-693.865) [-691.070] (-689.272) (-691.440) * [-692.569] (-694.996) (-689.346) (-693.047) -- 0:00:45
Average standard deviation of split frequencies: 0.014199
165500 -- (-693.012) (-691.117) (-690.484) [-690.876] * [-690.444] (-691.795) (-689.042) (-690.548) -- 0:00:45
166000 -- [-689.339] (-692.682) (-693.246) (-694.151) * [-691.749] (-693.650) (-691.182) (-691.086) -- 0:00:45
166500 -- (-689.993) (-691.681) [-693.043] (-692.406) * (-692.338) (-692.316) (-693.804) [-689.482] -- 0:00:50
167000 -- (-690.131) [-691.710] (-690.951) (-693.218) * (-691.689) (-689.260) (-692.031) [-691.113] -- 0:00:49
167500 -- (-690.475) (-692.766) [-689.429] (-693.165) * (-690.338) [-691.020] (-691.313) (-689.657) -- 0:00:49
168000 -- (-691.435) [-693.764] (-690.764) (-691.945) * (-692.610) [-690.163] (-689.903) (-697.316) -- 0:00:49
168500 -- (-693.636) (-691.456) (-692.770) [-694.142] * [-691.084] (-691.740) (-693.049) (-692.106) -- 0:00:49
169000 -- [-690.128] (-691.486) (-695.437) (-690.741) * (-690.272) (-692.257) (-695.298) [-690.496] -- 0:00:49
169500 -- (-691.090) (-692.795) [-690.552] (-690.331) * (-694.281) (-688.964) (-693.850) [-689.825] -- 0:00:48
170000 -- [-689.527] (-695.093) (-690.326) (-691.363) * (-689.943) [-688.968] (-694.158) (-690.825) -- 0:00:48
Average standard deviation of split frequencies: 0.015846
170500 -- (-689.887) [-692.795] (-693.305) (-690.552) * (-689.444) (-689.079) (-698.753) [-693.632] -- 0:00:48
171000 -- (-691.612) (-693.025) (-691.108) [-689.619] * (-690.780) (-690.215) (-696.739) [-694.484] -- 0:00:48
171500 -- [-691.277] (-691.204) (-689.431) (-691.731) * (-690.279) (-691.269) (-691.115) [-691.219] -- 0:00:48
172000 -- (-690.216) [-691.429] (-693.386) (-690.549) * [-693.191] (-695.218) (-691.330) (-689.818) -- 0:00:48
172500 -- [-690.226] (-691.647) (-691.957) (-692.151) * (-690.744) (-697.045) (-689.503) [-690.633] -- 0:00:47
173000 -- (-690.682) [-695.255] (-691.863) (-690.662) * [-690.257] (-693.992) (-691.253) (-694.363) -- 0:00:47
173500 -- (-690.745) (-698.059) (-690.985) [-693.199] * [-689.530] (-691.086) (-691.843) (-693.597) -- 0:00:47
174000 -- [-691.619] (-691.891) (-690.184) (-691.860) * (-691.809) (-690.263) (-695.718) [-691.556] -- 0:00:47
174500 -- [-690.868] (-695.884) (-689.580) (-692.019) * (-691.823) (-691.703) (-690.132) [-692.224] -- 0:00:47
175000 -- [-693.565] (-695.682) (-689.497) (-694.698) * (-695.585) (-700.564) (-690.026) [-693.887] -- 0:00:47
Average standard deviation of split frequencies: 0.018303
175500 -- (-699.629) [-692.333] (-689.832) (-689.225) * (-691.651) (-690.530) [-689.899] (-691.264) -- 0:00:46
176000 -- (-691.757) (-694.221) [-690.547] (-692.210) * (-690.985) (-689.805) (-690.819) [-693.089] -- 0:00:46
176500 -- (-695.566) (-695.241) (-690.554) [-690.416] * (-691.023) [-690.493] (-689.830) (-689.690) -- 0:00:46
177000 -- [-692.043] (-696.549) (-689.880) (-690.947) * (-690.513) (-689.816) (-690.775) [-692.094] -- 0:00:46
177500 -- (-691.522) (-691.782) (-701.477) [-692.218] * (-690.910) [-689.445] (-689.378) (-691.805) -- 0:00:46
178000 -- (-691.855) [-689.523] (-692.700) (-691.907) * (-690.167) [-691.573] (-689.533) (-693.104) -- 0:00:46
178500 -- [-693.506] (-690.971) (-689.765) (-691.057) * [-693.426] (-694.846) (-690.395) (-691.362) -- 0:00:46
179000 -- (-691.733) (-690.845) (-691.749) [-692.058] * (-692.153) (-692.564) [-689.029] (-694.824) -- 0:00:45
179500 -- [-689.912] (-693.735) (-691.617) (-691.827) * [-694.448] (-692.335) (-690.161) (-693.122) -- 0:00:45
180000 -- (-691.442) [-690.731] (-691.925) (-691.958) * (-690.971) [-692.357] (-697.038) (-692.893) -- 0:00:45
Average standard deviation of split frequencies: 0.017344
180500 -- (-690.715) (-689.473) [-690.974] (-690.638) * (-689.694) (-690.423) [-695.456] (-690.174) -- 0:00:45
181000 -- (-690.360) (-689.533) [-694.944] (-691.440) * (-689.917) (-690.887) (-693.829) [-689.453] -- 0:00:45
181500 -- (-690.751) (-689.698) [-691.570] (-690.448) * [-689.300] (-692.916) (-690.109) (-691.063) -- 0:00:45
182000 -- [-691.529] (-691.935) (-689.627) (-691.298) * (-689.337) (-694.442) (-692.382) [-689.680] -- 0:00:44
182500 -- (-689.738) [-693.645] (-690.980) (-692.124) * (-693.218) (-693.565) [-693.440] (-689.461) -- 0:00:44
183000 -- [-690.820] (-691.411) (-694.413) (-689.945) * [-690.750] (-691.566) (-694.125) (-693.134) -- 0:00:49
183500 -- [-690.148] (-690.168) (-690.923) (-691.244) * (-691.112) (-691.489) [-689.411] (-692.048) -- 0:00:48
184000 -- (-694.379) (-690.845) (-690.566) [-690.066] * (-696.620) (-691.728) [-689.722] (-690.323) -- 0:00:48
184500 -- (-694.206) (-690.296) (-690.724) [-690.337] * (-693.969) (-690.697) (-689.962) [-689.499] -- 0:00:48
185000 -- (-689.871) [-690.696] (-690.840) (-690.400) * (-690.477) (-690.664) [-691.193] (-689.423) -- 0:00:48
Average standard deviation of split frequencies: 0.016981
185500 -- (-689.466) (-690.049) [-691.239] (-691.378) * (-689.593) (-691.297) (-690.076) [-690.489] -- 0:00:48
186000 -- (-690.976) (-690.866) [-689.803] (-694.372) * [-690.096] (-689.442) (-691.556) (-691.049) -- 0:00:48
186500 -- (-693.524) (-690.162) (-689.940) [-693.599] * [-690.209] (-691.172) (-699.215) (-693.219) -- 0:00:47
187000 -- (-692.569) (-691.718) (-692.241) [-691.733] * (-690.945) [-691.445] (-697.957) (-692.363) -- 0:00:47
187500 -- [-691.023] (-691.185) (-692.962) (-694.457) * (-694.028) (-690.981) (-689.767) [-691.447] -- 0:00:47
188000 -- (-692.511) (-690.243) (-690.386) [-693.705] * (-690.322) (-691.125) [-691.979] (-690.721) -- 0:00:47
188500 -- (-691.021) [-690.142] (-691.622) (-694.718) * (-691.462) [-693.432] (-690.309) (-691.579) -- 0:00:47
189000 -- (-691.601) (-689.889) (-691.141) [-690.829] * [-691.055] (-690.945) (-691.517) (-690.360) -- 0:00:47
189500 -- (-694.253) [-691.810] (-694.829) (-690.548) * (-691.564) [-691.847] (-691.243) (-689.459) -- 0:00:47
190000 -- [-692.149] (-691.635) (-690.968) (-689.528) * (-689.619) [-691.057] (-689.821) (-691.823) -- 0:00:46
Average standard deviation of split frequencies: 0.017856
190500 -- (-691.382) (-691.087) (-692.474) [-689.540] * (-690.848) (-690.805) [-689.347] (-690.993) -- 0:00:46
191000 -- (-696.298) [-695.183] (-691.279) (-690.097) * (-693.184) (-690.120) [-692.452] (-692.511) -- 0:00:46
191500 -- [-693.448] (-694.087) (-690.683) (-689.641) * (-689.980) (-691.351) (-689.453) [-691.455] -- 0:00:46
192000 -- [-690.517] (-690.883) (-692.438) (-692.316) * (-692.984) (-689.780) [-690.855] (-690.663) -- 0:00:46
192500 -- (-690.445) (-692.295) (-690.186) [-691.275] * (-694.875) (-689.793) (-689.594) [-690.353] -- 0:00:46
193000 -- (-690.379) (-694.123) (-694.177) [-692.099] * (-694.692) (-692.939) [-689.668] (-689.877) -- 0:00:45
193500 -- (-690.883) (-694.096) (-693.614) [-692.522] * (-692.637) (-692.333) (-690.202) [-690.350] -- 0:00:45
194000 -- (-691.137) (-691.417) [-689.363] (-691.299) * (-691.183) (-691.118) [-692.773] (-691.274) -- 0:00:45
194500 -- (-689.589) (-692.284) (-690.650) [-690.948] * (-691.918) [-691.597] (-692.441) (-694.546) -- 0:00:45
195000 -- [-691.790] (-690.093) (-692.941) (-690.218) * (-692.599) (-690.486) (-692.612) [-690.305] -- 0:00:45
Average standard deviation of split frequencies: 0.017905
195500 -- (-691.918) [-689.648] (-694.097) (-690.085) * (-695.034) [-689.798] (-693.389) (-691.649) -- 0:00:45
196000 -- (-697.230) [-692.140] (-690.823) (-695.284) * [-690.579] (-690.144) (-689.898) (-689.677) -- 0:00:45
196500 -- (-692.214) (-694.422) (-692.004) [-689.434] * [-691.655] (-689.877) (-692.880) (-691.115) -- 0:00:44
197000 -- (-692.299) [-689.709] (-690.971) (-689.710) * (-692.701) (-689.486) [-696.083] (-691.258) -- 0:00:44
197500 -- (-691.844) (-690.986) [-691.379] (-690.589) * (-691.942) (-689.593) (-690.460) [-692.449] -- 0:00:44
198000 -- (-690.272) [-692.210] (-693.234) (-690.600) * [-692.189] (-693.585) (-692.064) (-693.393) -- 0:00:44
198500 -- [-691.069] (-692.158) (-691.502) (-698.583) * (-690.071) (-692.050) [-692.432] (-690.435) -- 0:00:44
199000 -- (-691.104) (-689.779) [-689.771] (-690.610) * (-693.362) (-689.707) (-694.714) [-691.152] -- 0:00:44
199500 -- (-693.257) [-692.053] (-691.226) (-690.780) * (-692.443) (-691.716) [-692.566] (-691.603) -- 0:00:44
200000 -- (-700.447) [-691.228] (-690.163) (-690.299) * (-693.786) [-693.121] (-692.711) (-690.981) -- 0:00:48
Average standard deviation of split frequencies: 0.017227
200500 -- (-690.570) [-694.480] (-690.921) (-691.550) * (-694.998) (-692.465) [-689.780] (-692.274) -- 0:00:47
201000 -- (-690.206) [-693.670] (-690.909) (-691.004) * [-694.264] (-694.167) (-693.348) (-690.090) -- 0:00:47
201500 -- (-690.956) [-693.252] (-690.917) (-690.743) * (-691.044) (-695.062) [-689.749] (-693.466) -- 0:00:47
202000 -- [-689.964] (-689.585) (-690.117) (-690.374) * (-690.204) (-690.340) [-689.825] (-692.807) -- 0:00:47
202500 -- [-696.051] (-690.377) (-690.724) (-690.788) * [-690.240] (-690.472) (-689.868) (-692.623) -- 0:00:47
203000 -- (-692.226) (-690.666) [-690.496] (-693.998) * [-693.976] (-690.866) (-690.647) (-690.423) -- 0:00:47
203500 -- (-694.947) [-691.810] (-693.325) (-691.498) * (-692.446) (-691.114) (-689.703) [-689.614] -- 0:00:46
204000 -- (-689.482) (-691.903) [-691.393] (-691.676) * (-691.680) (-690.905) (-697.871) [-689.740] -- 0:00:46
204500 -- [-689.234] (-693.616) (-694.679) (-697.427) * (-693.105) [-694.049] (-694.858) (-689.522) -- 0:00:46
205000 -- (-691.226) [-691.673] (-690.747) (-699.068) * (-696.462) (-690.416) [-693.960] (-692.356) -- 0:00:46
Average standard deviation of split frequencies: 0.018307
205500 -- (-691.856) (-690.434) (-698.455) [-690.389] * (-689.869) (-691.152) [-693.845] (-694.972) -- 0:00:46
206000 -- (-694.238) [-691.402] (-693.943) (-691.944) * (-692.450) [-690.043] (-690.478) (-691.084) -- 0:00:46
206500 -- [-692.201] (-693.380) (-691.987) (-690.927) * (-694.064) (-691.069) [-689.921] (-692.360) -- 0:00:46
207000 -- (-689.762) [-691.742] (-692.919) (-690.739) * (-695.167) (-689.264) (-691.029) [-693.450] -- 0:00:45
207500 -- (-690.572) (-691.926) (-689.339) [-690.686] * (-691.421) (-689.273) (-693.980) [-691.405] -- 0:00:45
208000 -- (-690.167) [-690.838] (-689.579) (-691.467) * (-690.328) [-689.621] (-691.849) (-690.449) -- 0:00:45
208500 -- (-689.551) (-692.371) (-690.749) [-695.492] * (-691.312) (-693.152) (-691.915) [-690.004] -- 0:00:45
209000 -- (-693.142) (-690.361) [-693.670] (-689.918) * (-691.799) (-694.750) [-695.344] (-690.623) -- 0:00:45
209500 -- (-691.087) (-690.177) [-691.067] (-690.155) * (-689.633) (-693.256) (-690.020) [-690.959] -- 0:00:45
210000 -- (-692.424) [-689.155] (-690.973) (-694.065) * (-692.229) [-693.649] (-690.290) (-689.700) -- 0:00:45
Average standard deviation of split frequencies: 0.016363
210500 -- (-691.099) (-694.505) (-690.629) [-693.849] * (-691.885) [-689.654] (-690.375) (-691.541) -- 0:00:45
211000 -- (-694.545) (-690.529) (-690.572) [-693.362] * (-694.907) (-690.790) (-692.461) [-691.068] -- 0:00:44
211500 -- (-691.776) (-690.597) [-694.767] (-693.518) * (-692.861) [-690.148] (-691.309) (-693.263) -- 0:00:44
212000 -- (-690.532) (-692.453) [-693.245] (-691.428) * (-690.514) (-689.828) [-690.281] (-690.915) -- 0:00:44
212500 -- (-691.974) [-692.060] (-690.683) (-692.866) * [-695.705] (-689.060) (-689.655) (-691.456) -- 0:00:44
213000 -- (-689.252) (-691.839) [-690.687] (-689.958) * (-691.347) [-691.993] (-690.471) (-690.306) -- 0:00:44
213500 -- (-692.533) (-692.590) [-691.514] (-689.183) * (-692.769) [-693.408] (-691.070) (-690.253) -- 0:00:44
214000 -- [-691.997] (-694.970) (-692.692) (-690.616) * (-691.649) (-693.390) (-693.237) [-690.161] -- 0:00:44
214500 -- (-692.061) [-693.148] (-692.021) (-693.257) * (-692.247) [-692.533] (-691.241) (-691.143) -- 0:00:43
215000 -- (-691.977) (-690.717) (-690.398) [-690.427] * (-690.359) (-691.957) [-690.339] (-690.927) -- 0:00:43
Average standard deviation of split frequencies: 0.016095
215500 -- (-691.534) (-691.741) [-690.978] (-695.246) * [-690.701] (-690.485) (-691.506) (-691.027) -- 0:00:43
216000 -- (-691.535) (-690.725) (-690.491) [-692.930] * (-691.663) (-691.194) [-691.771] (-693.882) -- 0:00:43
216500 -- [-694.139] (-692.605) (-690.045) (-691.337) * (-690.670) (-692.222) (-690.730) [-690.596] -- 0:00:43
217000 -- (-691.901) (-691.832) (-689.675) [-689.365] * [-691.273] (-690.382) (-692.895) (-690.397) -- 0:00:46
217500 -- (-690.433) (-689.714) (-692.370) [-691.685] * (-690.367) [-696.465] (-690.404) (-690.592) -- 0:00:46
218000 -- (-690.022) (-689.600) [-690.725] (-694.333) * [-690.884] (-694.943) (-693.698) (-690.360) -- 0:00:46
218500 -- (-691.567) (-691.673) (-689.745) [-691.397] * (-692.821) [-692.208] (-689.102) (-690.325) -- 0:00:46
219000 -- (-689.996) (-693.306) [-691.972] (-690.767) * (-690.983) [-691.316] (-689.392) (-691.215) -- 0:00:46
219500 -- (-689.802) (-692.510) (-695.643) [-691.811] * [-693.648] (-690.484) (-691.150) (-693.035) -- 0:00:46
220000 -- (-690.608) (-691.947) (-694.391) [-692.761] * (-693.213) (-690.422) [-693.614] (-691.314) -- 0:00:46
Average standard deviation of split frequencies: 0.014820
220500 -- (-691.944) [-690.194] (-689.324) (-692.151) * (-694.945) (-693.615) [-690.453] (-689.971) -- 0:00:45
221000 -- (-694.351) (-689.481) (-689.577) [-694.327] * [-692.567] (-690.832) (-689.927) (-689.467) -- 0:00:45
221500 -- (-690.868) [-689.497] (-691.754) (-690.401) * (-689.831) [-689.880] (-691.483) (-689.719) -- 0:00:45
222000 -- (-694.699) (-689.349) (-693.280) [-691.797] * [-689.751] (-691.126) (-691.849) (-690.057) -- 0:00:45
222500 -- (-692.167) [-689.742] (-691.248) (-691.196) * (-689.689) (-692.396) [-691.654] (-691.100) -- 0:00:45
223000 -- (-692.031) [-694.285] (-693.718) (-690.124) * (-689.137) (-693.560) (-694.704) [-691.544] -- 0:00:45
223500 -- [-690.154] (-694.040) (-692.266) (-692.017) * (-689.950) (-690.477) [-690.757] (-692.834) -- 0:00:45
224000 -- (-693.004) (-690.882) (-692.548) [-690.508] * [-689.222] (-689.318) (-692.766) (-693.221) -- 0:00:45
224500 -- (-694.486) (-690.443) [-694.859] (-696.168) * (-689.989) (-690.115) (-692.930) [-689.543] -- 0:00:44
225000 -- (-695.586) [-690.533] (-692.969) (-690.219) * (-691.528) (-695.129) [-691.572] (-689.454) -- 0:00:44
Average standard deviation of split frequencies: 0.014949
225500 -- (-691.388) (-691.847) [-692.166] (-690.775) * (-695.710) (-692.934) (-691.327) [-689.592] -- 0:00:44
226000 -- (-691.012) (-689.963) [-692.728] (-689.538) * [-690.261] (-691.350) (-692.841) (-689.806) -- 0:00:44
226500 -- (-690.671) (-690.434) [-692.141] (-689.745) * (-691.732) [-695.140] (-693.512) (-691.737) -- 0:00:44
227000 -- (-692.691) (-692.626) (-694.394) [-694.329] * (-691.408) (-689.821) (-690.682) [-690.739] -- 0:00:44
227500 -- (-698.010) (-695.046) [-694.011] (-690.696) * (-690.485) (-696.650) [-690.673] (-691.280) -- 0:00:44
228000 -- (-692.182) [-693.204] (-694.339) (-691.377) * (-690.632) (-690.237) [-691.180] (-688.967) -- 0:00:44
228500 -- (-689.802) (-694.267) [-690.782] (-689.496) * [-690.600] (-689.144) (-690.041) (-695.445) -- 0:00:43
229000 -- (-690.049) (-695.374) (-695.731) [-693.731] * (-690.306) (-691.442) (-691.258) [-692.537] -- 0:00:43
229500 -- (-689.772) (-693.542) (-691.210) [-690.304] * (-696.857) (-697.184) [-690.286] (-691.578) -- 0:00:43
230000 -- (-690.612) (-693.650) [-691.402] (-693.351) * (-691.138) [-690.633] (-692.842) (-691.230) -- 0:00:43
Average standard deviation of split frequencies: 0.014192
230500 -- (-690.909) (-693.410) (-692.237) [-690.452] * [-690.732] (-689.517) (-691.147) (-691.560) -- 0:00:43
231000 -- (-689.648) (-690.517) (-690.324) [-690.097] * (-692.703) (-689.746) (-689.262) [-690.928] -- 0:00:43
231500 -- (-690.287) (-693.130) [-692.533] (-691.125) * (-691.317) (-692.842) (-690.971) [-693.550] -- 0:00:43
232000 -- (-689.990) (-689.759) (-689.890) [-689.435] * (-689.834) [-690.721] (-691.028) (-689.995) -- 0:00:43
232500 -- (-690.493) [-692.200] (-691.000) (-692.689) * (-692.179) (-691.289) (-690.590) [-692.570] -- 0:00:42
233000 -- (-691.424) (-698.344) (-690.266) [-689.637] * (-693.924) (-690.563) (-691.199) [-690.844] -- 0:00:42
233500 -- [-695.929] (-692.969) (-692.067) (-690.452) * (-692.264) [-692.994] (-691.673) (-693.283) -- 0:00:42
234000 -- (-690.397) [-691.741] (-694.884) (-690.059) * [-690.735] (-692.983) (-691.007) (-690.952) -- 0:00:45
234500 -- (-690.770) (-696.291) (-692.028) [-690.966] * (-690.619) (-694.398) [-690.571] (-690.867) -- 0:00:45
235000 -- (-689.535) (-690.167) (-692.827) [-689.637] * (-689.605) [-690.267] (-691.160) (-691.916) -- 0:00:45
Average standard deviation of split frequencies: 0.012925
235500 -- [-690.293] (-691.947) (-689.740) (-690.136) * (-690.592) [-694.975] (-690.542) (-690.882) -- 0:00:45
236000 -- [-690.211] (-692.984) (-690.474) (-690.092) * (-692.151) (-691.258) (-692.017) [-691.996] -- 0:00:45
236500 -- [-693.583] (-690.513) (-691.260) (-691.211) * (-690.410) [-696.188] (-692.067) (-692.184) -- 0:00:45
237000 -- (-689.540) (-690.128) (-691.594) [-689.892] * [-693.887] (-691.316) (-693.663) (-691.796) -- 0:00:45
237500 -- [-690.401] (-692.888) (-692.133) (-691.978) * [-691.486] (-690.804) (-690.738) (-690.472) -- 0:00:44
238000 -- (-691.610) (-690.195) [-689.869] (-693.569) * (-690.655) (-691.817) (-689.307) [-689.832] -- 0:00:44
238500 -- (-691.770) (-690.369) [-689.769] (-690.925) * (-692.360) (-689.121) [-689.809] (-689.817) -- 0:00:44
239000 -- [-691.743] (-694.697) (-693.112) (-694.825) * (-694.312) (-689.717) [-692.080] (-691.718) -- 0:00:44
239500 -- (-691.008) [-691.704] (-689.650) (-699.197) * (-691.095) [-694.417] (-692.721) (-693.712) -- 0:00:44
240000 -- (-691.615) (-690.484) [-690.042] (-696.976) * (-689.658) (-694.045) (-692.711) [-689.743] -- 0:00:44
Average standard deviation of split frequencies: 0.012213
240500 -- [-690.744] (-690.871) (-691.475) (-690.380) * (-690.214) (-690.743) [-690.389] (-693.085) -- 0:00:44
241000 -- (-691.715) (-691.621) (-692.533) [-690.045] * (-690.679) [-694.576] (-692.926) (-691.102) -- 0:00:44
241500 -- (-690.445) (-693.752) (-690.379) [-690.352] * (-692.128) [-696.012] (-695.214) (-690.212) -- 0:00:43
242000 -- [-691.264] (-690.091) (-689.120) (-693.014) * [-690.346] (-689.525) (-691.488) (-689.337) -- 0:00:43
242500 -- (-692.188) (-693.746) [-689.779] (-692.214) * (-694.064) (-690.765) (-690.681) [-690.040] -- 0:00:43
243000 -- (-694.929) (-693.186) (-690.204) [-689.627] * (-692.292) (-691.372) [-691.857] (-690.851) -- 0:00:43
243500 -- (-695.365) (-692.618) [-689.507] (-691.767) * (-693.383) (-690.033) (-689.255) [-689.623] -- 0:00:43
244000 -- [-694.018] (-692.135) (-690.237) (-694.063) * (-690.456) (-691.252) [-689.899] (-692.499) -- 0:00:43
244500 -- [-691.586] (-692.653) (-690.101) (-692.542) * (-690.658) [-690.901] (-690.627) (-689.924) -- 0:00:43
245000 -- (-691.093) [-690.688] (-689.905) (-696.611) * (-692.031) (-690.884) (-691.798) [-691.110] -- 0:00:43
Average standard deviation of split frequencies: 0.012669
245500 -- (-693.253) (-693.237) [-689.781] (-689.853) * (-689.593) [-694.150] (-696.237) (-694.097) -- 0:00:43
246000 -- (-696.326) [-694.692] (-690.853) (-693.518) * [-689.994] (-694.967) (-695.394) (-692.152) -- 0:00:42
246500 -- [-689.549] (-690.135) (-691.637) (-690.186) * (-690.949) (-695.708) [-692.657] (-692.544) -- 0:00:42
247000 -- [-689.364] (-690.984) (-690.750) (-689.277) * [-691.192] (-691.990) (-691.316) (-691.283) -- 0:00:42
247500 -- [-689.355] (-694.486) (-692.232) (-692.066) * (-691.756) (-691.151) (-692.814) [-692.672] -- 0:00:42
248000 -- (-690.969) (-690.154) (-690.412) [-690.983] * (-690.754) [-689.711] (-695.239) (-690.606) -- 0:00:42
248500 -- (-691.217) [-689.503] (-690.532) (-691.685) * [-690.769] (-690.693) (-690.697) (-689.910) -- 0:00:42
249000 -- [-689.591] (-692.670) (-689.893) (-691.424) * (-689.332) (-695.373) [-692.662] (-691.265) -- 0:00:42
249500 -- [-689.183] (-692.249) (-690.861) (-689.962) * (-692.368) [-695.654] (-689.653) (-691.223) -- 0:00:42
250000 -- (-690.342) (-692.733) [-690.080] (-691.808) * (-690.369) (-694.989) [-690.021] (-689.701) -- 0:00:42
Average standard deviation of split frequencies: 0.012851
250500 -- [-690.316] (-691.771) (-690.158) (-690.090) * (-690.343) (-691.115) [-690.031] (-692.652) -- 0:00:44
251000 -- (-693.179) [-691.646] (-692.067) (-691.866) * [-689.692] (-692.105) (-689.688) (-692.379) -- 0:00:44
251500 -- (-689.903) (-695.133) [-691.207] (-693.081) * (-689.424) [-693.656] (-693.195) (-694.097) -- 0:00:44
252000 -- [-694.197] (-692.810) (-690.486) (-691.308) * (-691.496) (-694.293) (-692.009) [-692.683] -- 0:00:44
252500 -- (-690.541) [-691.072] (-689.038) (-696.050) * (-693.259) [-691.625] (-691.244) (-691.600) -- 0:00:44
253000 -- (-693.089) (-689.439) [-689.192] (-690.468) * [-691.578] (-691.569) (-695.278) (-690.875) -- 0:00:44
253500 -- (-694.685) (-691.607) (-691.975) [-692.219] * (-692.022) (-690.856) [-694.129] (-695.869) -- 0:00:44
254000 -- (-690.355) [-690.317] (-692.446) (-691.543) * [-691.737] (-694.379) (-697.003) (-692.144) -- 0:00:44
254500 -- (-692.452) [-691.354] (-690.448) (-692.024) * (-691.923) [-690.739] (-692.212) (-691.316) -- 0:00:43
255000 -- (-694.029) (-692.026) (-693.794) [-689.621] * (-692.656) (-693.797) (-691.622) [-690.765] -- 0:00:43
Average standard deviation of split frequencies: 0.011049
255500 -- [-689.847] (-691.615) (-694.463) (-693.549) * [-693.770] (-692.700) (-690.462) (-690.474) -- 0:00:43
256000 -- (-694.169) (-694.585) (-690.349) [-693.419] * (-693.931) (-692.193) (-691.197) [-693.454] -- 0:00:43
256500 -- [-694.233] (-692.699) (-690.072) (-691.628) * (-689.500) (-691.749) (-691.767) [-692.242] -- 0:00:43
257000 -- (-692.776) (-691.004) (-689.584) [-690.976] * (-690.349) [-691.361] (-691.820) (-692.064) -- 0:00:43
257500 -- (-690.580) (-689.794) (-691.166) [-690.380] * (-691.330) (-692.055) [-689.753] (-690.126) -- 0:00:43
258000 -- (-691.734) (-690.365) [-691.042] (-689.521) * (-691.754) (-691.801) (-690.690) [-690.329] -- 0:00:43
258500 -- (-689.511) [-690.982] (-691.583) (-689.443) * (-689.757) (-690.552) (-690.883) [-692.092] -- 0:00:43
259000 -- (-691.581) (-697.382) [-690.568] (-689.730) * (-691.253) (-689.711) [-692.438] (-693.345) -- 0:00:42
259500 -- (-690.004) (-692.316) [-695.879] (-689.299) * (-689.493) (-693.996) (-691.312) [-689.422] -- 0:00:42
260000 -- [-692.467] (-696.543) (-696.591) (-694.452) * [-690.175] (-691.626) (-689.588) (-689.891) -- 0:00:42
Average standard deviation of split frequencies: 0.012234
260500 -- (-690.214) [-691.530] (-689.566) (-691.034) * [-690.184] (-691.426) (-690.387) (-692.646) -- 0:00:42
261000 -- (-690.263) [-690.528] (-691.296) (-691.375) * (-689.284) (-690.034) (-691.229) [-689.589] -- 0:00:42
261500 -- (-692.026) [-693.041] (-690.502) (-694.379) * (-690.566) (-690.243) (-691.037) [-690.988] -- 0:00:42
262000 -- (-693.657) (-690.416) [-691.682] (-692.021) * [-690.272] (-690.499) (-691.216) (-689.325) -- 0:00:42
262500 -- [-693.158] (-692.735) (-690.861) (-690.551) * [-689.875] (-692.924) (-690.371) (-689.108) -- 0:00:42
263000 -- [-689.577] (-691.357) (-692.405) (-693.519) * (-691.886) (-694.145) [-690.628] (-691.930) -- 0:00:42
263500 -- (-695.979) (-691.743) (-690.453) [-691.126] * [-695.892] (-694.010) (-690.105) (-689.980) -- 0:00:41
264000 -- (-702.180) [-691.373] (-689.799) (-691.593) * [-691.618] (-692.639) (-692.716) (-689.867) -- 0:00:41
264500 -- (-695.103) [-689.243] (-691.948) (-690.433) * [-690.243] (-692.958) (-690.126) (-690.285) -- 0:00:41
265000 -- (-693.639) (-690.076) (-693.382) [-690.684] * (-691.989) (-692.425) (-691.617) [-693.246] -- 0:00:41
Average standard deviation of split frequencies: 0.011988
265500 -- (-693.602) [-691.380] (-691.229) (-693.238) * (-701.570) (-692.911) [-691.411] (-691.924) -- 0:00:41
266000 -- (-690.561) (-690.604) [-689.519] (-692.240) * (-692.682) (-693.959) (-691.896) [-689.334] -- 0:00:41
266500 -- (-689.423) (-690.131) [-690.949] (-696.972) * (-692.088) (-695.774) [-691.654] (-691.472) -- 0:00:41
267000 -- (-690.528) (-693.382) [-690.258] (-690.674) * (-689.601) [-691.045] (-690.255) (-689.612) -- 0:00:41
267500 -- (-690.262) (-690.578) [-689.202] (-690.072) * [-691.147] (-693.075) (-691.108) (-693.296) -- 0:00:43
268000 -- (-690.319) (-689.644) [-697.043] (-696.672) * (-696.279) (-691.849) (-689.488) [-694.669] -- 0:00:43
268500 -- (-692.224) (-694.613) (-696.567) [-689.310] * (-695.219) (-692.750) [-691.453] (-689.605) -- 0:00:43
269000 -- (-692.076) (-691.422) (-693.743) [-689.437] * (-692.307) [-694.035] (-690.370) (-689.293) -- 0:00:43
269500 -- (-694.358) [-690.791] (-691.651) (-693.080) * (-694.688) (-697.107) [-689.353] (-690.534) -- 0:00:43
270000 -- (-694.190) (-691.495) (-691.053) [-693.954] * (-689.473) [-690.290] (-696.804) (-695.215) -- 0:00:43
Average standard deviation of split frequencies: 0.011884
270500 -- (-691.476) (-690.626) (-692.187) [-689.086] * [-692.911] (-692.578) (-689.707) (-690.239) -- 0:00:43
271000 -- (-690.092) (-691.911) (-690.237) [-691.805] * (-690.710) [-690.882] (-692.377) (-690.871) -- 0:00:43
271500 -- [-689.147] (-693.866) (-691.567) (-696.974) * (-692.743) [-692.702] (-689.509) (-690.209) -- 0:00:42
272000 -- (-690.948) (-692.772) [-693.376] (-691.226) * (-690.916) (-693.742) [-689.298] (-691.376) -- 0:00:42
272500 -- (-693.524) (-691.781) [-690.833] (-692.930) * (-694.964) [-690.716] (-690.162) (-691.276) -- 0:00:42
273000 -- [-691.060] (-692.811) (-690.700) (-690.446) * (-691.521) [-691.127] (-692.661) (-690.607) -- 0:00:42
273500 -- [-691.726] (-691.997) (-690.914) (-690.126) * (-690.937) (-690.426) [-691.499] (-692.689) -- 0:00:42
274000 -- (-691.166) [-693.759] (-690.059) (-689.655) * (-693.003) [-689.056] (-691.255) (-692.819) -- 0:00:42
274500 -- (-694.184) (-695.386) [-691.317] (-689.453) * (-694.427) (-691.655) [-693.675] (-692.571) -- 0:00:42
275000 -- (-694.006) (-692.409) [-693.313] (-693.991) * (-692.419) (-690.357) [-692.003] (-691.009) -- 0:00:42
Average standard deviation of split frequencies: 0.010851
275500 -- [-692.277] (-691.666) (-690.695) (-689.759) * [-693.126] (-690.251) (-691.654) (-689.307) -- 0:00:42
276000 -- [-691.063] (-689.508) (-691.583) (-690.342) * (-691.514) [-691.616] (-701.282) (-691.013) -- 0:00:41
276500 -- [-690.370] (-689.470) (-694.074) (-691.655) * [-691.935] (-692.004) (-695.939) (-690.628) -- 0:00:41
277000 -- (-689.801) (-690.438) [-689.645] (-693.663) * (-690.945) (-689.710) [-689.460] (-692.349) -- 0:00:41
277500 -- (-690.875) (-690.977) [-691.789] (-690.611) * (-691.855) [-690.064] (-694.010) (-693.464) -- 0:00:41
278000 -- (-689.737) (-695.360) (-689.396) [-690.216] * [-691.486] (-689.968) (-691.853) (-692.051) -- 0:00:41
278500 -- (-694.303) (-692.268) [-690.347] (-691.766) * [-690.789] (-689.623) (-692.016) (-692.498) -- 0:00:41
279000 -- (-692.344) (-691.488) (-692.052) [-690.659] * [-691.377] (-691.554) (-690.630) (-694.052) -- 0:00:41
279500 -- (-690.311) (-691.625) [-691.791] (-692.296) * (-690.269) (-697.001) [-691.760] (-690.414) -- 0:00:41
280000 -- (-691.356) [-689.813] (-693.252) (-694.748) * (-690.325) [-692.437] (-690.968) (-691.398) -- 0:00:41
Average standard deviation of split frequencies: 0.010707
280500 -- (-694.042) (-691.067) [-696.941] (-691.909) * [-690.868] (-691.708) (-694.904) (-690.550) -- 0:00:41
281000 -- [-691.384] (-698.465) (-691.261) (-692.277) * (-693.628) (-691.895) (-691.292) [-690.717] -- 0:00:40
281500 -- [-696.405] (-690.853) (-693.456) (-691.287) * (-698.501) (-690.040) [-689.889] (-690.552) -- 0:00:40
282000 -- (-691.089) (-689.466) (-694.149) [-689.918] * (-690.671) (-691.928) [-691.600] (-691.446) -- 0:00:40
282500 -- (-694.416) (-689.553) [-691.882] (-690.162) * (-690.774) (-690.318) (-690.476) [-692.992] -- 0:00:40
283000 -- (-689.709) [-689.184] (-695.745) (-689.879) * (-691.212) [-690.788] (-689.957) (-690.450) -- 0:00:40
283500 -- (-690.796) [-691.558] (-691.807) (-693.083) * (-692.387) (-694.000) [-691.500] (-689.846) -- 0:00:40
284000 -- (-693.098) (-690.899) [-691.862] (-691.448) * (-695.546) (-696.382) (-693.354) [-690.531] -- 0:00:40
284500 -- (-690.956) (-690.770) (-694.102) [-690.888] * [-693.783] (-689.605) (-696.050) (-690.294) -- 0:00:42
285000 -- (-697.093) [-693.023] (-694.821) (-692.386) * [-690.566] (-690.032) (-692.070) (-690.734) -- 0:00:42
Average standard deviation of split frequencies: 0.011263
285500 -- (-689.624) (-693.134) (-691.045) [-691.368] * (-689.238) [-691.085] (-689.645) (-693.135) -- 0:00:42
286000 -- (-692.501) (-692.590) (-689.640) [-689.359] * (-689.720) [-691.754] (-693.307) (-692.716) -- 0:00:42
286500 -- (-693.238) (-691.153) (-694.733) [-690.879] * [-690.873] (-690.481) (-699.666) (-690.793) -- 0:00:42
287000 -- (-691.785) [-691.738] (-693.143) (-693.538) * (-690.867) (-692.896) [-689.898] (-698.149) -- 0:00:42
287500 -- [-690.134] (-691.174) (-693.926) (-690.470) * (-694.141) [-691.860] (-690.890) (-691.592) -- 0:00:42
288000 -- [-692.587] (-690.975) (-692.985) (-692.630) * (-695.273) (-689.704) [-691.833] (-697.207) -- 0:00:42
288500 -- (-689.485) [-690.342] (-692.979) (-691.216) * (-692.587) (-691.412) [-692.661] (-691.921) -- 0:00:41
289000 -- (-689.284) (-691.463) [-690.167] (-691.151) * [-692.862] (-693.259) (-691.439) (-691.935) -- 0:00:41
289500 -- (-690.715) (-689.922) (-689.250) [-692.227] * [-693.402] (-692.750) (-690.243) (-693.699) -- 0:00:41
290000 -- (-689.606) [-689.741] (-690.232) (-690.773) * [-689.499] (-693.689) (-689.995) (-689.752) -- 0:00:41
Average standard deviation of split frequencies: 0.013165
290500 -- [-691.613] (-689.645) (-689.952) (-692.683) * [-690.665] (-691.652) (-690.082) (-690.640) -- 0:00:41
291000 -- (-693.188) [-692.199] (-688.996) (-692.651) * (-689.915) [-690.403] (-692.883) (-692.281) -- 0:00:41
291500 -- (-691.446) [-690.830] (-695.189) (-690.814) * [-689.080] (-690.247) (-694.030) (-693.146) -- 0:00:41
292000 -- (-692.847) (-695.345) (-691.143) [-695.177] * (-689.061) (-693.216) [-695.146] (-690.318) -- 0:00:41
292500 -- (-689.087) (-691.086) [-692.121] (-692.268) * (-692.057) (-692.699) (-691.497) [-689.870] -- 0:00:41
293000 -- (-689.902) [-690.242] (-696.377) (-692.308) * (-692.569) [-694.571] (-694.060) (-690.839) -- 0:00:41
293500 -- (-691.150) [-694.335] (-698.122) (-690.244) * (-690.723) (-690.080) (-698.695) [-690.304] -- 0:00:40
294000 -- (-695.687) (-692.099) [-690.365] (-691.340) * [-691.611] (-694.017) (-693.101) (-690.501) -- 0:00:40
294500 -- [-692.583] (-690.326) (-690.592) (-691.529) * (-690.236) (-693.272) [-693.093] (-689.056) -- 0:00:40
295000 -- [-689.610] (-690.416) (-691.765) (-691.281) * (-690.350) (-692.394) [-691.626] (-692.019) -- 0:00:40
Average standard deviation of split frequencies: 0.012387
295500 -- [-691.903] (-691.727) (-689.714) (-692.452) * (-690.898) (-695.511) (-692.899) [-690.885] -- 0:00:40
296000 -- [-691.033] (-689.499) (-693.042) (-690.446) * [-691.895] (-691.887) (-692.395) (-694.856) -- 0:00:40
296500 -- (-692.352) [-689.815] (-689.110) (-692.061) * [-691.879] (-691.311) (-692.231) (-690.867) -- 0:00:40
297000 -- (-691.194) (-690.084) [-690.655] (-691.228) * [-693.631] (-689.781) (-692.083) (-688.959) -- 0:00:40
297500 -- (-690.591) [-692.600] (-691.522) (-689.357) * [-693.613] (-690.149) (-691.780) (-691.664) -- 0:00:40
298000 -- (-689.634) [-692.222] (-690.541) (-694.028) * (-690.424) (-691.073) (-690.819) [-691.668] -- 0:00:40
298500 -- (-690.501) (-692.843) [-695.974] (-689.601) * (-693.025) (-689.571) [-691.486] (-691.553) -- 0:00:39
299000 -- [-692.163] (-691.198) (-697.449) (-695.719) * (-691.121) (-690.283) [-693.550] (-691.041) -- 0:00:39
299500 -- (-692.073) (-689.353) [-698.536] (-689.214) * (-694.438) [-689.925] (-689.174) (-691.438) -- 0:00:39
300000 -- (-690.584) [-691.009] (-692.821) (-692.345) * (-689.050) (-690.927) [-690.754] (-696.034) -- 0:00:39
Average standard deviation of split frequencies: 0.012451
300500 -- (-689.364) (-689.767) [-690.369] (-693.429) * [-691.804] (-691.623) (-692.117) (-695.793) -- 0:00:39
301000 -- [-690.650] (-690.873) (-689.454) (-690.826) * (-692.284) (-690.992) (-698.465) [-694.198] -- 0:00:41
301500 -- (-690.868) (-690.027) [-692.687] (-689.829) * (-691.862) [-690.063] (-688.982) (-691.414) -- 0:00:41
302000 -- (-690.283) (-691.016) (-694.423) [-690.766] * (-692.235) (-689.209) (-691.132) [-689.835] -- 0:00:41
302500 -- (-690.554) [-690.162] (-690.605) (-690.200) * (-690.527) (-689.241) (-692.487) [-694.437] -- 0:00:41
303000 -- [-690.040] (-690.884) (-691.318) (-690.876) * (-690.137) [-690.542] (-694.420) (-691.901) -- 0:00:41
303500 -- [-690.075] (-690.363) (-692.362) (-691.935) * [-690.542] (-692.160) (-691.995) (-692.500) -- 0:00:41
304000 -- [-692.015] (-690.082) (-690.507) (-694.707) * (-690.406) (-690.849) (-695.602) [-690.688] -- 0:00:41
304500 -- [-691.102] (-695.357) (-690.175) (-692.808) * (-691.299) (-689.927) (-690.867) [-689.819] -- 0:00:41
305000 -- (-690.269) (-690.928) [-691.870] (-690.027) * (-693.331) (-691.125) (-690.725) [-689.956] -- 0:00:41
Average standard deviation of split frequencies: 0.012923
305500 -- (-691.354) (-689.720) [-692.102] (-690.571) * (-692.260) (-691.633) (-692.210) [-693.850] -- 0:00:40
306000 -- (-692.048) (-692.263) (-690.575) [-690.752] * [-691.292] (-691.184) (-693.776) (-692.651) -- 0:00:40
306500 -- [-690.234] (-690.500) (-693.115) (-692.958) * (-691.006) [-693.293] (-694.502) (-691.412) -- 0:00:40
307000 -- (-691.646) [-690.028] (-690.263) (-691.593) * (-694.519) (-691.271) (-690.284) [-690.313] -- 0:00:40
307500 -- (-692.412) (-691.262) (-691.113) [-694.541] * (-691.391) (-691.628) [-692.709] (-692.521) -- 0:00:40
308000 -- [-691.990] (-690.443) (-691.823) (-693.616) * (-691.846) (-691.302) [-691.075] (-691.365) -- 0:00:40
308500 -- (-690.643) [-692.565] (-692.270) (-693.069) * (-690.997) [-691.783] (-690.409) (-690.095) -- 0:00:40
309000 -- (-696.031) (-693.394) (-690.095) [-691.773] * (-690.765) [-691.151] (-690.110) (-689.639) -- 0:00:40
309500 -- (-690.806) (-693.164) (-696.557) [-692.248] * (-692.078) (-691.348) (-693.432) [-690.806] -- 0:00:40
310000 -- (-693.307) (-695.709) (-690.573) [-690.253] * (-690.511) [-692.926] (-694.794) (-689.946) -- 0:00:40
Average standard deviation of split frequencies: 0.012223
310500 -- [-691.050] (-691.991) (-692.182) (-690.417) * [-689.895] (-694.919) (-692.292) (-694.519) -- 0:00:39
311000 -- (-693.423) (-691.236) (-690.593) [-691.932] * (-691.582) [-689.803] (-689.446) (-693.659) -- 0:00:39
311500 -- (-690.312) [-691.241] (-692.255) (-689.194) * (-689.901) (-693.942) [-689.192] (-691.756) -- 0:00:39
312000 -- (-690.631) (-692.838) (-692.769) [-689.825] * (-691.792) (-692.536) [-692.141] (-692.936) -- 0:00:39
312500 -- (-689.938) (-694.723) (-691.236) [-690.060] * (-690.017) [-693.616] (-691.949) (-695.348) -- 0:00:39
313000 -- (-693.469) [-695.668] (-691.090) (-691.405) * (-691.704) [-692.139] (-697.012) (-689.309) -- 0:00:39
313500 -- (-691.184) [-690.087] (-689.679) (-689.726) * (-689.848) (-694.644) (-690.135) [-691.978] -- 0:00:39
314000 -- (-691.808) [-691.830] (-689.855) (-689.845) * (-690.293) (-694.087) [-691.569] (-691.824) -- 0:00:39
314500 -- (-693.376) (-691.301) [-691.032] (-689.042) * (-693.454) (-693.694) [-694.914] (-691.038) -- 0:00:39
315000 -- (-691.544) (-691.853) (-689.500) [-688.953] * (-694.037) (-690.807) (-690.652) [-691.914] -- 0:00:39
Average standard deviation of split frequencies: 0.012100
315500 -- [-690.944] (-691.123) (-692.508) (-690.855) * (-691.225) (-692.593) (-691.793) [-691.104] -- 0:00:39
316000 -- [-689.826] (-693.638) (-691.668) (-690.731) * [-691.132] (-692.227) (-691.258) (-691.350) -- 0:00:38
316500 -- (-692.022) (-693.501) (-690.671) [-690.836] * (-694.047) (-692.121) (-690.393) [-690.752] -- 0:00:38
317000 -- (-689.647) (-695.170) [-690.510] (-689.495) * (-691.374) (-691.508) (-690.228) [-690.719] -- 0:00:40
317500 -- (-691.893) (-689.743) (-693.432) [-691.030] * (-689.362) [-692.332] (-689.838) (-692.302) -- 0:00:40
318000 -- (-690.463) (-689.660) [-689.841] (-691.156) * (-690.117) (-690.156) [-691.449] (-689.978) -- 0:00:40
318500 -- (-690.509) [-689.289] (-692.043) (-690.738) * (-693.183) (-690.837) (-691.121) [-689.727] -- 0:00:40
319000 -- (-691.539) [-689.821] (-691.453) (-693.122) * [-689.921] (-691.759) (-690.449) (-691.424) -- 0:00:40
319500 -- (-689.708) [-690.715] (-691.509) (-689.889) * (-689.952) (-691.713) [-691.196] (-691.543) -- 0:00:40
320000 -- (-690.258) [-690.558] (-691.205) (-691.941) * (-690.508) (-691.694) (-693.616) [-692.200] -- 0:00:40
Average standard deviation of split frequencies: 0.011847
320500 -- (-693.842) [-690.417] (-691.158) (-691.027) * (-690.777) (-689.438) (-690.231) [-690.774] -- 0:00:40
321000 -- (-691.664) (-690.786) [-690.195] (-690.226) * (-693.468) [-693.009] (-690.004) (-689.855) -- 0:00:40
321500 -- (-693.115) (-691.152) [-689.553] (-689.699) * (-693.233) [-692.167] (-693.991) (-690.878) -- 0:00:40
322000 -- [-691.012] (-690.705) (-694.314) (-690.534) * (-692.823) (-690.088) (-693.332) [-691.494] -- 0:00:40
322500 -- (-691.988) (-690.690) [-692.283] (-689.694) * (-694.280) [-694.491] (-692.111) (-691.060) -- 0:00:39
323000 -- (-691.837) (-691.409) [-692.339] (-689.694) * (-695.913) [-690.551] (-689.721) (-694.145) -- 0:00:39
323500 -- (-690.831) (-690.681) (-692.034) [-690.859] * [-690.298] (-691.278) (-690.580) (-689.798) -- 0:00:39
324000 -- (-691.902) [-692.040] (-693.649) (-690.770) * (-691.286) [-692.125] (-691.973) (-690.527) -- 0:00:39
324500 -- (-692.415) [-691.517] (-693.066) (-690.056) * (-690.285) [-690.858] (-690.369) (-690.874) -- 0:00:39
325000 -- (-692.415) (-690.741) (-689.924) [-692.283] * (-692.488) (-693.120) [-689.835] (-689.414) -- 0:00:39
Average standard deviation of split frequencies: 0.011653
325500 -- (-691.326) (-690.450) [-690.096] (-692.886) * [-691.140] (-692.496) (-689.717) (-692.123) -- 0:00:39
326000 -- (-692.684) (-691.860) (-696.051) [-690.083] * (-690.062) (-691.720) (-692.019) [-689.943] -- 0:00:39
326500 -- (-689.527) (-691.827) [-693.569] (-694.255) * (-691.908) (-690.347) (-691.755) [-694.441] -- 0:00:39
327000 -- (-690.530) [-692.271] (-690.654) (-693.089) * (-693.312) [-689.539] (-689.416) (-695.777) -- 0:00:39
327500 -- (-692.574) [-690.232] (-692.245) (-691.723) * (-692.178) [-690.723] (-691.533) (-697.322) -- 0:00:39
328000 -- (-694.908) (-691.394) (-691.652) [-692.195] * [-689.967] (-690.199) (-690.873) (-692.004) -- 0:00:38
328500 -- (-692.812) (-689.126) [-690.428] (-690.495) * (-693.355) [-693.171] (-692.503) (-695.324) -- 0:00:38
329000 -- (-691.752) (-693.071) [-690.815] (-691.697) * (-695.819) (-690.912) (-689.969) [-692.766] -- 0:00:38
329500 -- (-691.065) [-690.577] (-691.401) (-689.962) * (-693.004) (-693.386) [-691.379] (-694.577) -- 0:00:38
330000 -- (-691.762) (-691.597) [-689.440] (-691.005) * (-689.350) (-693.206) [-689.717] (-691.266) -- 0:00:38
Average standard deviation of split frequencies: 0.011405
330500 -- (-694.047) (-690.889) [-690.734] (-690.681) * (-691.713) (-691.569) (-690.679) [-689.691] -- 0:00:38
331000 -- (-691.805) (-690.608) (-692.104) [-690.315] * [-690.312] (-693.065) (-692.331) (-691.692) -- 0:00:38
331500 -- (-690.405) (-692.149) (-694.784) [-690.196] * (-692.260) [-691.566] (-692.179) (-689.176) -- 0:00:38
332000 -- [-690.024] (-694.915) (-690.752) (-690.251) * (-693.749) (-691.305) [-690.548] (-690.746) -- 0:00:38
332500 -- [-689.987] (-691.432) (-691.374) (-691.175) * (-690.484) (-691.466) (-689.658) [-689.299] -- 0:00:38
333000 -- (-693.081) [-689.854] (-689.875) (-691.610) * [-690.085] (-690.470) (-690.966) (-689.925) -- 0:00:38
333500 -- (-691.223) (-694.194) (-692.293) [-689.833] * (-690.125) (-690.626) (-690.981) [-692.070] -- 0:00:37
334000 -- (-692.355) (-691.294) [-695.209] (-692.687) * (-692.038) [-692.580] (-695.658) (-693.081) -- 0:00:39
334500 -- (-694.216) [-697.616] (-694.400) (-690.140) * [-689.957] (-696.557) (-693.126) (-697.735) -- 0:00:39
335000 -- (-691.759) (-690.315) (-691.707) [-690.864] * (-694.146) [-691.623] (-691.864) (-693.289) -- 0:00:39
Average standard deviation of split frequencies: 0.010399
335500 -- (-697.381) (-692.761) (-690.624) [-693.133] * [-689.587] (-690.612) (-691.756) (-691.652) -- 0:00:39
336000 -- [-692.715] (-690.314) (-693.574) (-689.389) * (-689.964) (-690.624) [-691.485] (-693.882) -- 0:00:39
336500 -- (-690.559) [-690.156] (-692.838) (-690.304) * [-690.160] (-690.378) (-691.919) (-692.887) -- 0:00:39
337000 -- [-691.371] (-691.624) (-691.325) (-689.176) * (-689.893) [-691.022] (-690.935) (-696.794) -- 0:00:39
337500 -- (-692.092) (-693.669) [-690.759] (-689.641) * (-692.114) [-689.509] (-690.675) (-691.285) -- 0:00:39
338000 -- (-694.976) [-691.634] (-691.441) (-689.399) * (-689.567) [-689.954] (-693.141) (-690.145) -- 0:00:39
338500 -- (-696.355) (-693.895) [-691.080] (-690.912) * [-690.288] (-689.771) (-690.451) (-691.350) -- 0:00:39
339000 -- (-690.101) [-691.299] (-690.717) (-689.244) * (-693.416) (-689.703) (-692.297) [-694.593] -- 0:00:38
339500 -- [-690.783] (-691.625) (-695.000) (-689.860) * (-690.328) [-689.648] (-691.120) (-691.413) -- 0:00:38
340000 -- (-694.962) (-691.957) [-692.533] (-690.765) * (-691.148) (-692.327) [-695.843] (-690.196) -- 0:00:38
Average standard deviation of split frequencies: 0.010763
340500 -- (-695.119) (-691.370) [-689.403] (-689.899) * (-693.510) [-691.755] (-690.515) (-693.051) -- 0:00:38
341000 -- (-690.263) (-693.383) (-692.195) [-690.428] * (-690.813) (-691.773) (-690.988) [-691.714] -- 0:00:38
341500 -- (-691.734) (-693.755) [-690.066] (-689.425) * (-691.216) (-689.672) (-691.625) [-693.030] -- 0:00:38
342000 -- (-691.521) (-690.597) (-692.569) [-690.049] * (-695.534) (-690.575) [-690.105] (-690.990) -- 0:00:38
342500 -- (-691.764) (-689.818) (-690.551) [-694.379] * (-692.722) (-689.180) (-691.211) [-691.984] -- 0:00:38
343000 -- [-690.811] (-695.316) (-690.497) (-692.192) * [-692.715] (-690.466) (-690.069) (-691.139) -- 0:00:38
343500 -- (-690.461) [-688.937] (-690.379) (-689.197) * (-692.400) (-691.117) [-690.042] (-693.380) -- 0:00:38
344000 -- (-694.194) [-690.061] (-692.199) (-689.780) * (-693.207) (-690.377) [-689.803] (-691.067) -- 0:00:38
344500 -- (-690.914) (-691.631) [-693.791] (-695.797) * [-691.784] (-689.859) (-693.090) (-691.406) -- 0:00:38
345000 -- (-691.203) [-691.063] (-695.512) (-692.567) * [-691.311] (-692.166) (-691.919) (-691.560) -- 0:00:37
Average standard deviation of split frequencies: 0.010018
345500 -- (-690.739) (-691.013) [-692.940] (-689.024) * [-689.715] (-689.447) (-691.472) (-691.251) -- 0:00:37
346000 -- (-689.957) [-691.582] (-690.949) (-690.128) * (-692.235) (-690.208) [-693.367] (-692.155) -- 0:00:37
346500 -- (-693.560) (-691.721) (-690.714) [-691.385] * (-690.562) (-693.409) (-690.545) [-690.755] -- 0:00:37
347000 -- (-694.090) (-691.503) (-692.033) [-691.257] * (-690.574) (-693.495) (-691.465) [-689.927] -- 0:00:37
347500 -- (-693.548) (-690.533) (-691.194) [-691.216] * [-690.088] (-692.070) (-698.305) (-690.772) -- 0:00:37
348000 -- (-693.468) (-691.221) (-690.298) [-691.802] * (-692.897) (-690.141) [-691.294] (-695.262) -- 0:00:37
348500 -- (-696.924) [-690.965] (-690.081) (-689.419) * (-693.104) (-691.371) [-691.635] (-691.896) -- 0:00:37
349000 -- (-691.013) [-689.650] (-690.077) (-692.379) * (-692.553) (-690.781) (-693.564) [-689.754] -- 0:00:37
349500 -- (-691.893) (-689.078) [-689.826] (-693.213) * [-691.492] (-691.044) (-691.168) (-691.478) -- 0:00:37
350000 -- (-691.212) (-692.339) (-692.214) [-691.870] * [-692.685] (-690.238) (-690.515) (-691.532) -- 0:00:37
Average standard deviation of split frequencies: 0.010754
350500 -- (-692.217) (-691.526) (-691.082) [-690.306] * (-693.840) [-691.240] (-693.469) (-691.917) -- 0:00:37
351000 -- (-691.642) (-691.305) (-693.778) [-690.502] * (-690.042) [-692.684] (-692.584) (-693.450) -- 0:00:38
351500 -- (-691.116) [-690.841] (-690.156) (-689.097) * (-692.942) [-689.825] (-690.009) (-694.721) -- 0:00:38
352000 -- (-692.907) (-691.115) [-690.899] (-692.523) * (-693.419) (-693.663) (-694.648) [-689.157] -- 0:00:38
352500 -- (-691.105) (-691.573) (-691.387) [-694.113] * [-692.644] (-693.730) (-692.785) (-689.091) -- 0:00:38
353000 -- (-690.455) (-691.210) [-690.002] (-691.927) * (-689.783) (-694.218) (-690.475) [-689.191] -- 0:00:38
353500 -- (-692.994) [-690.586] (-691.668) (-691.826) * (-690.923) (-692.520) [-690.464] (-690.033) -- 0:00:38
354000 -- [-691.734] (-691.761) (-691.277) (-692.751) * (-689.754) (-690.235) [-691.157] (-691.661) -- 0:00:38
354500 -- (-690.832) [-690.873] (-691.415) (-691.489) * (-689.751) (-689.894) (-689.212) [-691.824] -- 0:00:38
355000 -- (-693.982) (-689.876) (-692.288) [-690.010] * (-692.013) (-689.282) (-690.638) [-691.374] -- 0:00:38
Average standard deviation of split frequencies: 0.009517
355500 -- (-691.915) (-690.352) (-692.222) [-691.674] * (-691.755) (-690.633) [-694.022] (-691.743) -- 0:00:38
356000 -- (-693.044) [-690.713] (-692.266) (-693.502) * (-693.326) (-691.457) [-692.251] (-691.027) -- 0:00:37
356500 -- (-690.391) (-689.313) (-690.325) [-690.633] * (-692.478) [-689.834] (-690.828) (-690.494) -- 0:00:37
357000 -- (-692.553) (-692.339) (-690.658) [-690.295] * (-690.575) (-689.755) [-690.681] (-692.844) -- 0:00:37
357500 -- [-694.442] (-691.430) (-689.829) (-689.723) * (-689.033) (-690.429) (-692.645) [-689.479] -- 0:00:37
358000 -- (-692.544) (-691.128) [-690.910] (-688.917) * [-689.399] (-696.294) (-691.806) (-692.704) -- 0:00:37
358500 -- (-693.123) (-690.723) [-694.175] (-690.512) * [-689.149] (-691.957) (-690.122) (-691.799) -- 0:00:37
359000 -- [-691.298] (-690.071) (-694.054) (-690.587) * [-690.958] (-690.473) (-690.151) (-691.060) -- 0:00:37
359500 -- (-689.631) (-690.951) [-691.816] (-692.137) * (-692.115) (-690.683) (-693.233) [-690.424] -- 0:00:37
360000 -- [-691.243] (-689.125) (-691.127) (-691.497) * (-689.447) (-700.015) [-691.821] (-691.911) -- 0:00:37
Average standard deviation of split frequencies: 0.010282
360500 -- (-691.933) (-689.722) [-689.820] (-691.238) * [-689.631] (-700.200) (-692.730) (-689.915) -- 0:00:37
361000 -- (-693.524) (-690.107) [-690.726] (-692.694) * (-691.788) (-689.781) (-690.153) [-689.684] -- 0:00:37
361500 -- (-690.074) (-694.398) (-691.289) [-689.937] * (-690.867) (-691.468) [-691.270] (-691.615) -- 0:00:37
362000 -- (-694.329) (-691.314) [-690.134] (-690.527) * (-689.844) (-693.806) [-692.047] (-691.890) -- 0:00:37
362500 -- (-690.869) [-691.402] (-691.547) (-693.511) * (-689.509) (-695.270) [-690.559] (-692.566) -- 0:00:36
363000 -- (-691.269) (-690.332) [-689.837] (-691.899) * (-693.316) (-692.066) [-691.567] (-692.353) -- 0:00:36
363500 -- (-691.810) (-689.176) (-690.182) [-690.928] * (-693.613) (-690.549) (-691.513) [-689.907] -- 0:00:36
364000 -- [-689.969] (-689.357) (-700.549) (-689.340) * (-691.198) (-690.432) (-689.334) [-689.772] -- 0:00:36
364500 -- [-691.971] (-690.540) (-695.248) (-690.185) * (-691.353) (-691.467) [-691.344] (-690.822) -- 0:00:36
365000 -- (-696.092) [-692.428] (-690.039) (-691.804) * [-689.672] (-692.455) (-691.373) (-691.357) -- 0:00:36
Average standard deviation of split frequencies: 0.010590
365500 -- (-692.474) (-689.614) [-690.603] (-689.572) * [-689.734] (-692.066) (-691.360) (-692.041) -- 0:00:36
366000 -- (-691.850) (-690.218) [-689.457] (-690.776) * [-691.710] (-691.595) (-692.863) (-690.853) -- 0:00:36
366500 -- (-691.863) (-694.167) (-690.568) [-693.970] * (-697.928) [-691.221] (-692.261) (-689.639) -- 0:00:36
367000 -- (-693.360) (-690.914) [-689.476] (-695.007) * (-695.293) (-689.169) (-693.672) [-689.805] -- 0:00:36
367500 -- (-695.421) [-690.370] (-692.000) (-692.694) * (-689.669) [-689.814] (-690.315) (-690.754) -- 0:00:37
368000 -- [-692.269] (-691.320) (-691.008) (-692.277) * [-689.031] (-694.317) (-692.139) (-689.497) -- 0:00:37
368500 -- [-690.425] (-689.533) (-691.862) (-690.892) * [-689.568] (-695.857) (-691.602) (-691.809) -- 0:00:37
369000 -- (-691.254) (-693.545) (-694.791) [-691.584] * (-689.736) [-689.449] (-691.466) (-697.213) -- 0:00:37
369500 -- (-690.021) (-690.784) [-694.339] (-691.357) * (-690.145) (-690.915) [-691.625] (-690.156) -- 0:00:37
370000 -- [-689.957] (-690.609) (-691.908) (-692.012) * (-691.085) (-691.173) (-692.743) [-689.699] -- 0:00:37
Average standard deviation of split frequencies: 0.011970
370500 -- (-692.255) (-692.372) [-690.445] (-689.822) * (-691.378) [-690.695] (-690.136) (-690.565) -- 0:00:37
371000 -- (-691.703) (-693.880) (-689.832) [-691.284] * (-690.754) (-692.970) [-691.146] (-689.227) -- 0:00:37
371500 -- (-694.233) [-691.239] (-690.879) (-690.151) * (-691.259) (-690.714) (-690.647) [-689.246] -- 0:00:37
372000 -- (-690.026) (-692.406) [-690.361] (-690.910) * (-693.003) [-693.757] (-689.645) (-691.561) -- 0:00:37
372500 -- (-689.368) (-689.389) [-692.287] (-690.224) * [-692.535] (-698.542) (-693.094) (-691.719) -- 0:00:37
373000 -- (-689.115) (-690.019) (-692.631) [-692.663] * (-694.478) (-690.446) (-694.854) [-694.882] -- 0:00:36
373500 -- (-692.656) (-689.530) (-690.439) [-690.636] * (-692.612) (-690.713) [-692.753] (-689.783) -- 0:00:36
374000 -- (-690.671) (-689.556) [-690.745] (-691.736) * [-690.491] (-690.786) (-692.960) (-689.786) -- 0:00:36
374500 -- (-691.910) (-690.084) (-690.561) [-689.912] * (-693.452) (-690.605) [-691.404] (-692.219) -- 0:00:36
375000 -- [-691.172] (-690.224) (-690.409) (-689.983) * (-693.535) (-696.412) [-690.252] (-689.058) -- 0:00:36
Average standard deviation of split frequencies: 0.011284
375500 -- [-690.793] (-695.200) (-692.695) (-692.200) * [-690.106] (-696.992) (-689.676) (-690.228) -- 0:00:36
376000 -- (-689.431) (-691.083) (-691.697) [-692.366] * (-689.078) (-692.125) (-690.351) [-690.847] -- 0:00:36
376500 -- (-693.124) (-691.794) [-689.969] (-690.182) * (-690.454) [-689.163] (-691.913) (-690.797) -- 0:00:36
377000 -- (-695.634) (-691.723) [-695.412] (-692.389) * [-690.694] (-689.408) (-693.997) (-690.337) -- 0:00:36
377500 -- (-691.273) (-691.399) [-689.116] (-693.239) * (-691.206) (-689.846) (-690.593) [-690.125] -- 0:00:36
378000 -- (-691.577) [-689.782] (-692.325) (-692.535) * (-690.071) [-689.189] (-690.851) (-691.213) -- 0:00:36
378500 -- [-691.361] (-690.986) (-689.847) (-692.988) * (-690.705) (-690.350) [-690.143] (-690.549) -- 0:00:36
379000 -- (-690.250) (-690.179) [-690.870] (-691.788) * [-691.117] (-690.303) (-692.019) (-690.439) -- 0:00:36
379500 -- (-691.099) [-691.365] (-691.590) (-690.668) * (-690.390) (-692.212) [-692.867] (-693.627) -- 0:00:35
380000 -- [-692.679] (-694.074) (-691.195) (-692.810) * [-691.376] (-693.812) (-692.403) (-690.654) -- 0:00:35
Average standard deviation of split frequencies: 0.010320
380500 -- [-693.644] (-691.042) (-690.684) (-692.236) * (-690.334) (-691.079) [-694.552] (-692.844) -- 0:00:35
381000 -- (-690.652) [-691.899] (-690.633) (-690.714) * (-689.271) [-694.858] (-693.235) (-694.616) -- 0:00:35
381500 -- (-692.988) (-692.735) [-690.522] (-690.760) * [-689.127] (-695.467) (-694.271) (-692.804) -- 0:00:35
382000 -- [-692.067] (-693.418) (-693.342) (-694.005) * [-691.433] (-694.244) (-691.455) (-693.256) -- 0:00:35
382500 -- (-692.390) (-692.287) [-691.742] (-692.205) * (-689.781) (-695.579) [-690.550] (-694.416) -- 0:00:35
383000 -- (-694.011) [-691.284] (-690.644) (-693.921) * [-690.406] (-693.320) (-690.958) (-689.324) -- 0:00:35
383500 -- [-693.146] (-691.954) (-695.867) (-691.352) * (-692.022) (-691.173) (-695.452) [-691.559] -- 0:00:35
384000 -- (-690.477) (-689.963) [-691.775] (-691.725) * (-693.107) [-691.359] (-690.262) (-692.604) -- 0:00:35
384500 -- (-690.485) (-692.009) (-690.460) [-691.816] * [-689.890] (-689.042) (-692.573) (-693.205) -- 0:00:36
385000 -- (-695.379) [-689.625] (-692.087) (-695.298) * (-693.173) (-689.428) (-691.093) [-691.532] -- 0:00:36
Average standard deviation of split frequencies: 0.010457
385500 -- (-693.527) (-690.667) [-693.947] (-690.164) * [-693.073] (-689.419) (-695.129) (-689.770) -- 0:00:36
386000 -- [-694.448] (-693.388) (-691.640) (-692.108) * [-692.838] (-690.256) (-694.058) (-692.501) -- 0:00:36
386500 -- (-689.637) [-691.701] (-691.068) (-692.596) * (-691.948) (-690.234) [-692.754] (-691.510) -- 0:00:36
387000 -- (-690.858) [-690.222] (-691.696) (-690.647) * (-693.769) (-692.121) [-690.280] (-690.418) -- 0:00:36
387500 -- (-690.726) (-690.012) (-691.031) [-692.768] * [-691.749] (-697.772) (-692.815) (-691.236) -- 0:00:36
388000 -- (-690.536) [-694.228] (-690.480) (-696.685) * [-691.192] (-689.904) (-691.282) (-693.146) -- 0:00:36
388500 -- (-692.701) [-690.513] (-690.720) (-689.648) * [-693.652] (-691.136) (-691.984) (-689.535) -- 0:00:36
389000 -- (-691.861) (-690.779) (-693.440) [-692.662] * (-692.473) [-689.581] (-693.529) (-689.514) -- 0:00:36
389500 -- (-693.243) [-690.444] (-692.683) (-694.077) * [-692.988] (-692.495) (-690.541) (-692.355) -- 0:00:36
390000 -- (-692.545) (-690.782) (-692.367) [-692.337] * (-694.108) (-692.216) (-692.017) [-694.329] -- 0:00:35
Average standard deviation of split frequencies: 0.010699
390500 -- (-689.571) (-695.603) (-690.379) [-691.117] * (-691.661) (-692.543) (-691.671) [-690.272] -- 0:00:35
391000 -- (-689.394) (-696.720) [-692.091] (-697.498) * (-692.909) (-690.601) [-691.501] (-691.828) -- 0:00:35
391500 -- (-691.567) (-694.044) (-695.223) [-693.881] * (-692.632) (-690.893) (-690.996) [-690.850] -- 0:00:35
392000 -- (-690.064) (-693.933) (-690.934) [-689.616] * (-691.133) (-692.757) [-689.989] (-689.618) -- 0:00:35
392500 -- (-693.678) [-691.965] (-691.771) (-692.774) * [-691.500] (-693.749) (-689.432) (-689.323) -- 0:00:35
393000 -- (-692.014) (-692.816) (-690.514) [-694.600] * [-694.735] (-690.582) (-691.325) (-693.455) -- 0:00:35
393500 -- (-691.316) [-691.176] (-690.514) (-698.657) * (-693.415) [-692.373] (-691.750) (-692.438) -- 0:00:35
394000 -- [-691.247] (-690.834) (-691.570) (-693.934) * (-690.832) (-694.313) (-689.128) [-691.449] -- 0:00:35
394500 -- (-693.638) [-692.934] (-690.035) (-690.730) * (-690.152) (-689.881) [-691.758] (-690.377) -- 0:00:35
395000 -- (-690.587) (-690.172) (-690.442) [-694.743] * (-690.345) [-691.031] (-690.465) (-690.582) -- 0:00:35
Average standard deviation of split frequencies: 0.011086
395500 -- (-690.846) (-695.492) (-691.423) [-692.833] * (-692.387) (-690.282) (-691.872) [-692.661] -- 0:00:35
396000 -- (-692.119) (-690.992) [-689.770] (-692.139) * (-690.383) (-689.887) (-693.306) [-692.321] -- 0:00:35
396500 -- (-690.083) (-691.894) [-694.204] (-693.220) * (-691.768) (-695.461) (-690.412) [-690.288] -- 0:00:35
397000 -- (-689.446) [-690.983] (-692.261) (-694.367) * (-694.503) (-694.801) [-690.135] (-690.282) -- 0:00:34
397500 -- [-690.007] (-689.955) (-692.025) (-692.104) * (-693.449) (-691.834) [-689.574] (-691.923) -- 0:00:34
398000 -- (-690.420) [-693.141] (-691.504) (-691.212) * (-692.328) (-691.018) [-689.944] (-689.533) -- 0:00:34
398500 -- [-689.996] (-690.229) (-691.050) (-690.417) * (-692.068) (-691.624) (-690.023) [-691.077] -- 0:00:34
399000 -- (-693.576) (-689.291) (-694.680) [-692.157] * (-690.658) (-692.805) (-691.840) [-689.343] -- 0:00:34
399500 -- (-696.238) (-691.773) [-689.466] (-691.764) * (-691.380) [-690.980] (-693.280) (-690.838) -- 0:00:34
400000 -- (-695.871) [-691.131] (-689.822) (-694.787) * (-690.401) (-691.275) (-690.967) [-689.452] -- 0:00:34
Average standard deviation of split frequencies: 0.011545
400500 -- [-694.194] (-698.933) (-690.041) (-695.912) * [-691.099] (-696.060) (-692.849) (-690.678) -- 0:00:34
401000 -- (-690.155) [-690.364] (-690.651) (-697.105) * [-692.840] (-691.646) (-693.404) (-690.374) -- 0:00:35
401500 -- (-689.729) (-691.775) [-690.957] (-692.964) * [-698.995] (-693.002) (-695.268) (-692.466) -- 0:00:35
402000 -- (-693.699) (-690.355) [-691.566] (-689.572) * [-691.529] (-692.384) (-690.194) (-693.107) -- 0:00:35
402500 -- [-692.399] (-693.825) (-693.505) (-690.106) * (-693.344) (-689.192) [-691.290] (-689.721) -- 0:00:35
403000 -- (-690.858) [-690.039] (-695.728) (-699.646) * (-690.509) (-690.178) (-691.119) [-689.368] -- 0:00:35
403500 -- [-690.867] (-693.710) (-696.883) (-693.480) * (-689.329) (-694.001) (-691.909) [-689.476] -- 0:00:35
404000 -- [-690.069] (-692.568) (-696.619) (-692.406) * (-690.114) (-695.244) [-690.260] (-693.259) -- 0:00:35
404500 -- [-689.770] (-691.430) (-690.875) (-690.322) * (-690.830) (-690.742) [-695.206] (-693.778) -- 0:00:35
405000 -- (-692.906) [-690.373] (-691.018) (-692.144) * (-690.935) (-691.306) (-691.121) [-689.123] -- 0:00:35
Average standard deviation of split frequencies: 0.010723
405500 -- [-691.359] (-691.901) (-691.292) (-689.785) * [-689.659] (-692.207) (-691.380) (-689.369) -- 0:00:35
406000 -- (-689.881) (-692.824) (-691.836) [-690.190] * [-692.517] (-692.695) (-689.986) (-690.079) -- 0:00:35
406500 -- [-690.401] (-690.438) (-693.065) (-689.328) * [-692.951] (-692.267) (-689.850) (-693.509) -- 0:00:35
407000 -- (-690.314) [-691.480] (-690.689) (-696.056) * (-694.225) (-693.732) [-689.876] (-689.119) -- 0:00:34
407500 -- [-692.654] (-689.953) (-693.220) (-692.574) * (-692.672) (-691.251) (-690.430) [-690.071] -- 0:00:34
408000 -- (-690.057) [-690.259] (-692.524) (-692.741) * (-692.766) (-693.975) [-690.576] (-690.504) -- 0:00:34
408500 -- (-689.561) (-690.169) (-689.580) [-692.254] * (-694.149) (-693.303) [-689.088] (-692.821) -- 0:00:34
409000 -- (-691.374) [-689.955] (-696.957) (-691.928) * (-693.083) [-691.937] (-689.149) (-690.215) -- 0:00:34
409500 -- (-690.004) (-691.457) (-693.045) [-692.701] * (-691.848) (-691.395) [-690.103] (-693.790) -- 0:00:34
410000 -- [-690.220] (-696.051) (-691.876) (-691.152) * (-694.348) (-690.121) (-691.774) [-691.613] -- 0:00:34
Average standard deviation of split frequencies: 0.009693
410500 -- (-692.097) (-691.259) [-689.535] (-692.759) * (-692.383) (-693.113) (-690.669) [-690.271] -- 0:00:34
411000 -- (-689.939) [-689.510] (-691.257) (-689.756) * (-691.421) (-693.781) (-690.186) [-690.531] -- 0:00:34
411500 -- (-691.826) [-689.171] (-691.705) (-690.961) * (-689.463) (-692.747) [-690.454] (-693.274) -- 0:00:34
412000 -- (-692.783) (-689.113) [-690.791] (-692.259) * (-690.225) [-690.606] (-690.180) (-690.404) -- 0:00:34
412500 -- [-691.002] (-690.194) (-694.593) (-700.196) * (-690.289) [-692.748] (-694.180) (-693.445) -- 0:00:34
413000 -- (-691.667) (-691.872) (-693.724) [-693.585] * [-690.615] (-689.989) (-693.434) (-692.444) -- 0:00:34
413500 -- (-691.371) [-692.351] (-691.877) (-692.195) * (-690.064) (-690.125) [-691.438] (-690.747) -- 0:00:34
414000 -- [-691.943] (-691.718) (-695.807) (-690.582) * (-693.012) (-690.831) [-690.809] (-690.174) -- 0:00:33
414500 -- (-696.338) (-690.893) (-691.839) [-691.240] * (-690.850) [-693.426] (-690.295) (-695.886) -- 0:00:33
415000 -- (-692.669) (-690.970) (-695.281) [-691.300] * (-689.924) (-691.792) [-690.984] (-690.474) -- 0:00:33
Average standard deviation of split frequencies: 0.010265
415500 -- (-690.018) (-690.282) (-691.773) [-693.661] * (-690.291) [-689.353] (-693.123) (-689.630) -- 0:00:33
416000 -- (-694.492) (-691.068) (-690.551) [-690.832] * (-692.696) (-692.520) [-691.686] (-689.676) -- 0:00:33
416500 -- (-690.034) [-690.123] (-690.084) (-690.596) * [-690.724] (-690.958) (-689.692) (-690.299) -- 0:00:33
417000 -- (-692.036) [-689.576] (-690.634) (-690.634) * (-692.684) [-692.969] (-691.820) (-690.685) -- 0:00:33
417500 -- (-693.096) (-689.620) (-690.380) [-690.069] * (-693.042) (-697.824) [-693.920] (-698.814) -- 0:00:33
418000 -- (-691.786) (-689.060) [-692.054] (-693.891) * (-690.633) [-691.601] (-690.051) (-694.645) -- 0:00:34
418500 -- (-694.126) (-690.965) (-695.109) [-693.316] * (-691.322) (-693.581) [-690.832] (-691.902) -- 0:00:34
419000 -- (-690.715) [-689.868] (-695.649) (-690.027) * (-694.439) (-695.420) (-692.061) [-693.720] -- 0:00:34
419500 -- [-691.573] (-691.148) (-692.441) (-690.388) * (-690.887) (-692.670) [-690.760] (-690.571) -- 0:00:34
420000 -- (-690.665) (-692.934) (-690.510) [-689.281] * (-692.970) (-694.499) [-689.911] (-690.157) -- 0:00:34
Average standard deviation of split frequencies: 0.009525
420500 -- (-690.886) (-689.729) [-690.579] (-691.469) * (-690.758) [-690.230] (-689.580) (-691.779) -- 0:00:34
421000 -- (-690.157) (-691.329) [-690.028] (-689.994) * (-689.535) (-691.574) (-690.775) [-690.225] -- 0:00:34
421500 -- (-692.703) (-690.027) (-690.799) [-690.290] * (-691.143) (-692.120) [-690.841] (-690.250) -- 0:00:34
422000 -- (-689.378) (-689.137) (-690.423) [-694.845] * (-690.040) (-692.496) (-689.206) [-692.565] -- 0:00:34
422500 -- (-690.868) [-691.238] (-691.506) (-689.631) * (-694.070) (-689.683) [-689.206] (-691.175) -- 0:00:34
423000 -- (-690.774) (-691.292) (-690.445) [-690.305] * (-693.327) (-689.764) (-690.549) [-691.496] -- 0:00:34
423500 -- (-694.836) [-691.118] (-693.771) (-692.337) * (-697.027) (-691.221) [-690.282] (-690.929) -- 0:00:34
424000 -- (-691.568) (-690.908) [-690.944] (-691.561) * (-691.546) (-694.102) (-690.271) [-690.623] -- 0:00:33
424500 -- [-691.077] (-689.682) (-689.048) (-698.320) * (-690.380) [-693.396] (-691.323) (-694.867) -- 0:00:33
425000 -- [-690.874] (-692.132) (-690.185) (-691.499) * [-693.717] (-689.147) (-692.384) (-692.985) -- 0:00:33
Average standard deviation of split frequencies: 0.009160
425500 -- (-689.720) (-693.172) (-691.939) [-690.110] * (-690.660) (-693.151) (-693.141) [-692.662] -- 0:00:33
426000 -- (-690.141) (-692.060) [-690.296] (-696.280) * [-696.043] (-692.320) (-691.505) (-693.988) -- 0:00:33
426500 -- (-692.037) [-694.445] (-699.991) (-691.229) * (-691.844) (-691.993) [-691.435] (-692.203) -- 0:00:33
427000 -- (-690.079) (-689.682) [-690.880] (-692.386) * (-691.295) (-691.777) [-690.591] (-691.145) -- 0:00:33
427500 -- (-689.942) [-691.333] (-693.328) (-693.817) * (-690.579) [-692.334] (-693.138) (-694.412) -- 0:00:33
428000 -- [-691.847] (-691.724) (-692.280) (-691.226) * (-692.037) (-692.396) [-690.203] (-690.129) -- 0:00:33
428500 -- (-692.641) [-692.138] (-692.730) (-696.325) * (-690.496) (-691.049) (-693.483) [-691.795] -- 0:00:33
429000 -- (-692.435) (-689.675) [-691.643] (-694.293) * (-690.472) [-689.525] (-693.170) (-690.714) -- 0:00:33
429500 -- (-693.821) [-691.297] (-691.362) (-692.041) * (-693.182) [-693.941] (-691.818) (-691.566) -- 0:00:33
430000 -- (-692.793) (-694.884) [-691.314] (-690.238) * (-691.760) (-692.041) [-695.491] (-689.340) -- 0:00:33
Average standard deviation of split frequencies: 0.008149
430500 -- (-690.845) [-692.146] (-690.975) (-690.821) * [-690.734] (-693.320) (-691.562) (-692.201) -- 0:00:33
431000 -- (-692.862) (-690.872) (-691.957) [-693.034] * (-693.663) (-694.990) (-690.797) [-690.523] -- 0:00:33
431500 -- (-689.724) (-695.845) [-694.633] (-694.449) * (-692.395) (-691.484) (-692.807) [-690.982] -- 0:00:32
432000 -- (-690.376) [-695.865] (-690.692) (-692.166) * (-694.292) (-690.246) (-696.601) [-690.627] -- 0:00:32
432500 -- (-691.385) [-693.062] (-690.880) (-694.477) * (-693.175) [-689.345] (-696.043) (-689.504) -- 0:00:32
433000 -- (-692.026) (-691.439) [-690.112] (-691.099) * (-692.168) [-689.576] (-691.513) (-691.526) -- 0:00:32
433500 -- [-690.882] (-691.084) (-691.910) (-694.812) * (-693.625) (-691.412) (-691.791) [-690.326] -- 0:00:32
434000 -- [-689.539] (-692.582) (-690.333) (-691.367) * (-694.736) (-691.310) [-692.658] (-691.633) -- 0:00:32
434500 -- (-691.495) (-691.807) [-690.995] (-689.565) * (-690.381) (-690.640) (-690.089) [-690.415] -- 0:00:32
435000 -- (-689.329) (-689.306) [-695.180] (-689.889) * (-694.501) (-692.434) (-690.458) [-689.565] -- 0:00:33
Average standard deviation of split frequencies: 0.008049
435500 -- [-690.718] (-689.337) (-690.543) (-692.463) * (-690.983) [-692.103] (-699.618) (-691.134) -- 0:00:33
436000 -- [-690.691] (-695.473) (-691.575) (-695.903) * (-695.603) (-692.724) [-691.366] (-689.615) -- 0:00:33
436500 -- (-690.837) [-690.696] (-692.372) (-694.438) * (-692.790) (-692.314) (-690.596) [-690.732] -- 0:00:33
437000 -- (-691.813) [-690.703] (-692.163) (-691.178) * (-694.614) (-691.105) (-689.301) [-690.674] -- 0:00:33
437500 -- (-690.940) (-690.750) [-696.768] (-694.122) * (-697.843) (-691.424) [-689.196] (-690.967) -- 0:00:33
438000 -- (-689.905) (-691.687) (-694.750) [-690.727] * (-690.427) (-696.410) [-691.301] (-690.956) -- 0:00:33
438500 -- (-689.255) (-690.966) (-693.797) [-689.740] * (-689.553) (-695.552) (-693.375) [-692.723] -- 0:00:33
439000 -- (-694.385) [-691.333] (-692.096) (-689.709) * (-690.039) [-689.426] (-693.524) (-691.735) -- 0:00:33
439500 -- (-690.508) (-689.726) [-692.553] (-689.887) * (-690.418) [-691.623] (-694.786) (-691.525) -- 0:00:33
440000 -- [-690.201] (-693.050) (-692.720) (-689.374) * (-698.347) [-689.924] (-694.284) (-690.920) -- 0:00:33
Average standard deviation of split frequencies: 0.008747
440500 -- (-691.180) (-692.182) [-696.438] (-694.505) * (-696.115) (-692.759) (-695.465) [-690.807] -- 0:00:33
441000 -- (-690.731) (-691.326) (-689.743) [-690.208] * [-691.381] (-692.487) (-693.322) (-689.784) -- 0:00:32
441500 -- (-696.323) [-693.428] (-690.965) (-689.904) * (-692.372) [-692.400] (-692.221) (-695.535) -- 0:00:32
442000 -- (-690.990) (-691.686) (-690.383) [-689.904] * (-691.743) (-692.127) [-690.713] (-692.257) -- 0:00:32
442500 -- [-691.429] (-690.146) (-690.550) (-690.814) * [-693.440] (-695.298) (-689.963) (-694.948) -- 0:00:32
443000 -- (-694.558) (-689.905) (-691.110) [-691.033] * [-691.533] (-690.254) (-693.047) (-691.740) -- 0:00:32
443500 -- (-689.883) (-691.208) (-689.872) [-694.286] * (-692.562) (-689.723) [-691.330] (-689.033) -- 0:00:32
444000 -- (-692.039) (-691.584) (-691.199) [-690.348] * (-691.393) (-689.980) (-695.549) [-689.390] -- 0:00:32
444500 -- (-694.706) (-692.885) [-689.885] (-689.676) * (-693.185) [-690.828] (-692.877) (-690.581) -- 0:00:32
445000 -- [-691.564] (-690.864) (-689.605) (-691.645) * (-689.632) [-694.644] (-690.892) (-690.895) -- 0:00:32
Average standard deviation of split frequencies: 0.009264
445500 -- [-691.861] (-691.537) (-690.881) (-690.859) * (-690.210) (-690.440) [-691.263] (-690.301) -- 0:00:32
446000 -- (-694.754) [-691.233] (-690.707) (-689.368) * [-690.445] (-691.527) (-690.484) (-693.901) -- 0:00:32
446500 -- (-693.346) (-693.647) (-690.980) [-689.178] * [-692.619] (-690.535) (-691.371) (-693.807) -- 0:00:32
447000 -- (-691.358) (-694.566) (-696.995) [-693.998] * (-692.037) [-691.018] (-692.354) (-695.465) -- 0:00:32
447500 -- [-692.437] (-690.248) (-691.250) (-691.013) * (-694.591) (-696.935) (-694.347) [-695.751] -- 0:00:32
448000 -- (-691.821) [-692.561] (-690.101) (-690.839) * (-692.568) [-689.710] (-691.239) (-692.034) -- 0:00:32
448500 -- [-691.774] (-692.504) (-691.678) (-694.186) * [-692.674] (-691.553) (-690.765) (-689.177) -- 0:00:31
449000 -- (-692.020) (-693.275) [-689.966] (-689.884) * [-691.613] (-694.345) (-690.207) (-689.585) -- 0:00:31
449500 -- (-691.139) (-689.664) (-695.040) [-689.894] * (-690.478) [-692.170] (-690.200) (-691.598) -- 0:00:31
450000 -- (-690.332) (-691.040) [-691.029] (-692.230) * (-689.019) (-692.965) (-691.397) [-690.410] -- 0:00:31
Average standard deviation of split frequencies: 0.009106
450500 -- (-690.720) (-692.275) [-690.083] (-689.920) * [-689.028] (-691.630) (-690.547) (-690.821) -- 0:00:31
451000 -- (-690.281) [-694.712] (-692.597) (-691.481) * (-689.066) (-692.947) [-691.018] (-689.972) -- 0:00:31
451500 -- (-694.625) [-692.291] (-690.363) (-689.267) * [-690.387] (-689.676) (-689.493) (-691.454) -- 0:00:31
452000 -- [-692.688] (-691.257) (-694.676) (-692.431) * [-690.010] (-692.877) (-691.629) (-691.848) -- 0:00:32
452500 -- [-690.447] (-689.570) (-691.783) (-693.753) * (-691.097) (-690.137) (-689.937) [-690.780] -- 0:00:32
453000 -- (-691.153) (-696.555) [-691.519] (-694.430) * (-692.173) (-692.105) [-690.369] (-690.565) -- 0:00:32
453500 -- (-689.866) (-691.684) (-690.104) [-692.189] * [-691.859] (-689.790) (-690.648) (-692.411) -- 0:00:32
454000 -- [-690.598] (-697.522) (-691.104) (-691.679) * (-694.280) (-691.134) [-690.704] (-689.540) -- 0:00:32
454500 -- (-689.470) [-691.495] (-689.736) (-697.875) * (-696.730) (-690.240) [-690.509] (-693.973) -- 0:00:32
455000 -- [-689.248] (-689.719) (-695.079) (-701.778) * (-690.281) [-689.650] (-689.699) (-691.860) -- 0:00:32
Average standard deviation of split frequencies: 0.009304
455500 -- (-690.064) (-691.164) (-692.029) [-691.728] * (-693.520) (-692.015) [-689.645] (-693.315) -- 0:00:32
456000 -- (-690.225) (-692.585) (-691.258) [-690.181] * (-690.950) [-690.386] (-691.115) (-693.575) -- 0:00:32
456500 -- (-692.601) (-692.342) [-690.895] (-691.048) * [-689.694] (-691.366) (-693.860) (-691.718) -- 0:00:32
457000 -- [-689.843] (-691.344) (-697.420) (-692.332) * (-690.829) [-689.745] (-693.828) (-693.638) -- 0:00:32
457500 -- [-690.348] (-690.485) (-692.629) (-697.674) * (-693.241) (-690.259) [-697.132] (-691.749) -- 0:00:32
458000 -- [-692.237] (-693.742) (-689.478) (-692.544) * [-690.374] (-690.354) (-690.113) (-692.426) -- 0:00:31
458500 -- [-693.041] (-692.350) (-689.329) (-692.556) * (-690.871) (-693.863) [-690.701] (-692.542) -- 0:00:31
459000 -- (-691.854) (-691.593) (-693.512) [-689.957] * [-695.262] (-694.765) (-691.982) (-691.842) -- 0:00:31
459500 -- [-690.082] (-692.292) (-691.707) (-693.326) * (-691.682) [-689.939] (-690.118) (-693.560) -- 0:00:31
460000 -- (-690.158) (-693.132) [-691.276] (-691.233) * (-691.231) [-695.247] (-689.829) (-693.287) -- 0:00:31
Average standard deviation of split frequencies: 0.010297
460500 -- (-691.306) [-691.707] (-693.277) (-689.207) * (-695.516) (-691.422) [-691.262] (-691.658) -- 0:00:31
461000 -- (-689.034) (-689.999) (-693.035) [-689.464] * (-691.943) (-693.637) (-692.051) [-691.306] -- 0:00:31
461500 -- (-689.929) [-689.516] (-693.510) (-693.459) * (-691.109) (-694.138) [-690.962] (-689.675) -- 0:00:31
462000 -- (-692.877) (-690.021) (-690.842) [-690.239] * (-691.433) (-689.665) [-689.637] (-689.426) -- 0:00:31
462500 -- (-693.283) (-692.144) (-696.124) [-691.829] * (-691.082) (-689.769) [-689.625] (-690.964) -- 0:00:31
463000 -- (-692.746) (-692.522) [-695.456] (-689.666) * (-689.745) (-688.987) [-690.849] (-697.779) -- 0:00:31
463500 -- [-689.862] (-692.209) (-691.899) (-689.612) * (-693.702) (-691.922) (-690.407) [-692.389] -- 0:00:31
464000 -- (-693.522) (-690.968) (-690.014) [-690.726] * (-691.272) [-690.952] (-692.606) (-693.698) -- 0:00:31
464500 -- [-691.204] (-692.291) (-689.094) (-696.892) * (-692.617) (-694.348) (-694.764) [-690.820] -- 0:00:31
465000 -- (-690.718) [-690.089] (-693.357) (-692.765) * (-694.393) [-693.911] (-689.286) (-692.236) -- 0:00:31
Average standard deviation of split frequencies: 0.010685
465500 -- (-691.928) [-692.504] (-690.499) (-690.226) * (-691.236) (-690.622) (-690.261) [-690.046] -- 0:00:31
466000 -- (-691.355) [-694.845] (-699.558) (-690.187) * (-691.444) (-690.399) (-689.676) [-689.037] -- 0:00:30
466500 -- (-693.443) (-689.531) [-691.889] (-692.030) * (-692.617) [-690.537] (-693.798) (-693.761) -- 0:00:30
467000 -- [-691.840] (-691.245) (-692.372) (-690.811) * [-691.145] (-692.181) (-691.359) (-690.632) -- 0:00:30
467500 -- (-693.972) (-691.729) [-692.299] (-691.547) * (-691.711) [-691.349] (-692.762) (-691.505) -- 0:00:30
468000 -- (-692.093) (-692.766) (-691.835) [-692.833] * (-691.859) (-691.120) (-696.181) [-689.552] -- 0:00:30
468500 -- (-691.605) (-692.859) [-690.349] (-690.770) * (-690.803) (-693.590) [-692.110] (-691.288) -- 0:00:30
469000 -- (-696.204) [-691.616] (-690.569) (-692.898) * [-691.380] (-690.948) (-689.707) (-690.181) -- 0:00:31
469500 -- (-698.683) (-692.058) (-692.403) [-690.583] * (-693.007) [-691.265] (-690.230) (-690.114) -- 0:00:31
470000 -- (-695.870) (-690.235) [-690.929] (-690.436) * [-693.476] (-689.653) (-690.125) (-693.193) -- 0:00:31
Average standard deviation of split frequencies: 0.010704
470500 -- (-690.127) (-690.506) [-692.464] (-693.745) * (-693.585) (-690.068) (-690.588) [-690.450] -- 0:00:31
471000 -- [-690.373] (-690.473) (-692.611) (-691.741) * (-694.317) (-689.848) (-690.910) [-690.088] -- 0:00:31
471500 -- [-690.926] (-692.304) (-691.238) (-690.232) * (-690.697) (-689.818) [-689.851] (-691.436) -- 0:00:31
472000 -- (-694.175) (-690.418) (-689.535) [-691.966] * (-690.304) [-689.947] (-690.697) (-688.994) -- 0:00:31
472500 -- (-690.634) (-692.997) (-690.458) [-690.557] * (-691.764) [-691.326] (-690.734) (-692.228) -- 0:00:31
473000 -- [-691.516] (-690.525) (-691.620) (-690.706) * [-693.122] (-690.409) (-689.857) (-693.840) -- 0:00:31
473500 -- (-690.356) [-690.236] (-690.003) (-689.885) * (-692.629) (-694.063) [-690.162] (-689.599) -- 0:00:31
474000 -- (-690.860) (-690.459) [-690.581] (-690.217) * [-694.937] (-691.020) (-690.728) (-690.854) -- 0:00:31
474500 -- [-693.504] (-690.050) (-691.321) (-691.558) * (-692.796) (-691.296) [-689.581] (-690.693) -- 0:00:31
475000 -- (-692.039) (-691.703) (-691.795) [-691.376] * (-694.313) (-691.411) (-690.803) [-689.759] -- 0:00:30
Average standard deviation of split frequencies: 0.010770
475500 -- (-695.942) [-692.326] (-693.766) (-690.683) * (-691.770) (-694.765) [-690.636] (-690.121) -- 0:00:30
476000 -- (-691.308) (-690.841) [-690.129] (-690.046) * [-690.866] (-693.604) (-691.449) (-689.604) -- 0:00:30
476500 -- (-691.798) [-690.363] (-689.318) (-692.285) * [-691.424] (-693.792) (-691.129) (-694.094) -- 0:00:30
477000 -- (-693.549) (-693.832) [-691.634] (-694.468) * (-691.252) (-690.258) [-691.079] (-693.881) -- 0:00:30
477500 -- (-693.389) (-691.656) [-691.669] (-691.456) * (-690.930) (-692.397) [-689.362] (-690.510) -- 0:00:30
478000 -- (-691.537) [-691.618] (-691.758) (-692.317) * [-690.591] (-691.841) (-690.673) (-690.180) -- 0:00:30
478500 -- (-689.775) [-690.765] (-691.878) (-690.206) * (-690.640) (-689.285) [-690.970] (-691.595) -- 0:00:30
479000 -- [-689.300] (-689.950) (-695.098) (-692.015) * (-691.728) (-690.085) (-690.296) [-689.915] -- 0:00:30
479500 -- (-690.555) [-689.070] (-690.743) (-691.423) * (-690.994) (-690.587) (-693.855) [-688.875] -- 0:00:30
480000 -- (-690.836) (-690.011) [-692.441] (-692.079) * (-690.496) [-689.972] (-692.794) (-690.570) -- 0:00:30
Average standard deviation of split frequencies: 0.010665
480500 -- (-690.149) [-693.374] (-691.853) (-692.501) * [-692.426] (-692.808) (-695.647) (-690.304) -- 0:00:30
481000 -- (-696.173) (-691.201) [-690.137] (-689.976) * (-693.550) [-689.484] (-695.549) (-690.282) -- 0:00:30
481500 -- (-689.565) (-694.080) [-690.404] (-690.571) * (-696.028) [-694.341] (-691.333) (-690.904) -- 0:00:30
482000 -- [-692.090] (-692.099) (-691.278) (-696.384) * (-693.209) (-694.445) [-689.700] (-695.641) -- 0:00:30
482500 -- (-691.724) (-692.523) [-691.557] (-695.583) * (-698.439) (-693.811) (-690.896) [-690.629] -- 0:00:30
483000 -- [-691.957] (-697.300) (-690.140) (-692.051) * (-689.744) [-692.132] (-690.124) (-689.484) -- 0:00:29
483500 -- (-690.906) (-695.304) [-689.966] (-690.793) * (-691.786) (-690.195) [-692.917] (-691.394) -- 0:00:29
484000 -- [-690.778] (-690.216) (-692.934) (-693.883) * [-690.989] (-689.378) (-689.536) (-690.429) -- 0:00:29
484500 -- (-690.378) (-689.017) [-693.178] (-689.870) * [-691.573] (-692.600) (-693.147) (-692.515) -- 0:00:29
485000 -- [-690.096] (-695.600) (-693.786) (-692.293) * (-690.063) [-693.360] (-690.786) (-693.518) -- 0:00:29
Average standard deviation of split frequencies: 0.011094
485500 -- [-690.239] (-690.788) (-694.429) (-692.374) * (-689.458) [-690.892] (-696.377) (-693.473) -- 0:00:30
486000 -- (-689.692) [-691.996] (-691.812) (-692.921) * [-689.639] (-691.011) (-692.794) (-693.070) -- 0:00:30
486500 -- (-691.274) (-691.897) (-691.994) [-689.944] * [-690.042] (-692.302) (-691.114) (-690.857) -- 0:00:30
487000 -- (-693.140) (-691.694) [-691.563] (-691.178) * (-689.372) (-690.516) [-689.948] (-691.309) -- 0:00:30
487500 -- (-692.390) (-691.882) [-689.046] (-690.728) * (-692.771) (-689.845) (-691.361) [-690.601] -- 0:00:30
488000 -- (-693.089) [-690.835] (-696.629) (-689.680) * (-692.662) (-691.639) (-696.081) [-692.019] -- 0:00:30
488500 -- [-690.138] (-691.493) (-694.809) (-692.995) * (-689.892) [-691.420] (-691.413) (-691.373) -- 0:00:30
489000 -- (-690.568) [-689.827] (-692.052) (-690.728) * (-690.836) [-691.348] (-690.378) (-691.606) -- 0:00:30
489500 -- (-691.948) [-691.755] (-696.612) (-689.842) * (-690.565) [-689.838] (-692.387) (-693.220) -- 0:00:30
490000 -- (-696.331) (-689.314) [-693.868] (-690.948) * (-690.774) [-693.211] (-689.775) (-691.267) -- 0:00:30
Average standard deviation of split frequencies: 0.010508
490500 -- (-690.234) (-691.013) (-690.890) [-690.314] * (-690.567) (-690.404) [-694.356] (-694.406) -- 0:00:30
491000 -- (-695.298) [-690.542] (-689.637) (-690.064) * (-697.191) (-691.006) [-693.698] (-690.369) -- 0:00:30
491500 -- (-690.961) (-691.913) [-691.176] (-692.476) * (-689.405) (-689.642) (-695.166) [-689.221] -- 0:00:30
492000 -- [-690.401] (-696.600) (-690.106) (-692.264) * (-689.869) [-693.151] (-696.385) (-689.475) -- 0:00:29
492500 -- (-689.802) (-692.715) [-691.281] (-690.276) * (-693.838) (-690.524) (-694.393) [-689.903] -- 0:00:29
493000 -- (-694.186) [-692.560] (-691.179) (-691.353) * (-693.295) [-690.496] (-691.564) (-690.096) -- 0:00:29
493500 -- (-692.536) [-693.139] (-691.246) (-690.665) * (-691.921) (-693.596) [-689.394] (-690.934) -- 0:00:29
494000 -- (-692.789) (-692.186) [-692.871] (-692.021) * [-691.063] (-690.213) (-690.756) (-688.963) -- 0:00:29
494500 -- (-691.530) [-693.465] (-690.851) (-690.394) * (-689.910) (-691.256) (-692.818) [-690.763] -- 0:00:29
495000 -- [-692.103] (-691.166) (-689.850) (-691.751) * (-689.754) (-691.060) [-690.783] (-690.663) -- 0:00:29
Average standard deviation of split frequencies: 0.009445
495500 -- (-695.334) [-690.192] (-690.061) (-689.878) * (-693.625) (-689.254) [-691.343] (-690.443) -- 0:00:29
496000 -- (-695.902) (-689.352) (-691.501) [-690.986] * (-691.621) [-690.166] (-691.040) (-690.439) -- 0:00:29
496500 -- (-692.304) (-689.509) (-695.966) [-691.456] * (-690.327) [-689.777] (-695.222) (-690.278) -- 0:00:29
497000 -- (-694.643) (-689.458) (-692.135) [-689.663] * (-691.817) [-690.268] (-691.446) (-690.209) -- 0:00:29
497500 -- (-695.204) [-690.399] (-692.020) (-690.649) * (-692.086) [-690.360] (-690.860) (-690.956) -- 0:00:29
498000 -- (-692.665) (-691.628) [-693.391] (-694.632) * (-693.883) (-690.479) (-693.550) [-689.239] -- 0:00:29
498500 -- [-691.423] (-692.636) (-689.625) (-693.035) * [-693.440] (-690.404) (-690.229) (-689.790) -- 0:00:29
499000 -- (-694.862) [-693.025] (-692.388) (-693.300) * (-690.058) (-694.057) [-689.424] (-689.311) -- 0:00:29
499500 -- (-691.390) (-693.648) [-690.665] (-691.193) * (-693.969) (-689.830) (-690.171) [-689.191] -- 0:00:29
500000 -- [-698.193] (-695.336) (-692.019) (-692.411) * [-691.966] (-691.637) (-691.762) (-691.932) -- 0:00:29
Average standard deviation of split frequencies: 0.009227
500500 -- (-690.352) [-694.494] (-695.574) (-690.867) * (-690.717) (-689.204) [-691.139] (-691.209) -- 0:00:28
501000 -- (-693.241) (-690.571) (-690.839) [-691.382] * (-693.174) (-693.836) (-693.004) [-690.720] -- 0:00:28
501500 -- (-692.562) (-690.802) (-697.188) [-692.466] * (-692.104) [-689.248] (-694.012) (-696.072) -- 0:00:28
502000 -- [-689.361] (-689.744) (-696.505) (-691.226) * (-691.227) (-690.641) [-689.973] (-696.339) -- 0:00:28
502500 -- (-691.020) (-690.188) (-690.637) [-689.446] * (-692.061) [-695.495] (-690.952) (-691.304) -- 0:00:29
503000 -- (-691.659) [-691.530] (-691.871) (-692.566) * (-693.813) [-693.495] (-692.928) (-691.031) -- 0:00:29
503500 -- (-690.136) (-693.637) [-693.001] (-693.336) * (-690.095) (-689.689) (-691.087) [-691.960] -- 0:00:29
504000 -- (-689.689) (-689.805) (-691.894) [-691.344] * (-692.519) (-690.410) (-693.729) [-693.041] -- 0:00:29
504500 -- (-690.579) [-690.492] (-696.823) (-689.406) * (-690.663) (-691.180) (-689.609) [-691.943] -- 0:00:29
505000 -- (-690.918) (-691.606) (-692.541) [-692.431] * [-693.987] (-690.499) (-689.817) (-690.414) -- 0:00:29
Average standard deviation of split frequencies: 0.008676
505500 -- [-695.816] (-694.075) (-690.714) (-690.246) * (-692.840) (-692.598) [-690.002] (-690.493) -- 0:00:29
506000 -- (-694.506) (-691.152) [-690.500] (-692.214) * (-693.705) [-690.395] (-692.221) (-689.973) -- 0:00:29
506500 -- (-690.195) (-690.334) [-693.171] (-691.692) * (-694.213) (-692.338) (-693.233) [-689.620] -- 0:00:29
507000 -- [-691.160] (-691.261) (-693.393) (-693.833) * (-692.461) [-689.586] (-691.888) (-693.030) -- 0:00:29
507500 -- (-691.041) [-690.801] (-692.708) (-695.198) * (-690.330) (-689.575) (-691.804) [-690.993] -- 0:00:29
508000 -- (-689.540) [-693.978] (-693.957) (-690.378) * (-690.614) (-690.901) (-691.440) [-694.426] -- 0:00:29
508500 -- (-691.372) (-690.131) [-690.250] (-690.067) * [-690.827] (-694.133) (-691.578) (-693.175) -- 0:00:28
509000 -- (-691.473) (-689.409) [-690.264] (-692.881) * [-690.241] (-693.177) (-692.094) (-694.039) -- 0:00:28
509500 -- [-694.093] (-690.423) (-691.966) (-688.929) * (-691.786) (-691.271) [-694.857] (-691.188) -- 0:00:28
510000 -- [-690.218] (-695.948) (-694.552) (-688.942) * (-690.432) (-690.873) [-696.046] (-691.967) -- 0:00:28
Average standard deviation of split frequencies: 0.008077
510500 -- (-690.044) (-692.769) [-693.385] (-689.467) * (-693.595) (-690.197) [-689.848] (-696.676) -- 0:00:28
511000 -- [-689.959] (-691.537) (-696.640) (-689.491) * [-691.019] (-689.189) (-694.461) (-691.933) -- 0:00:28
511500 -- (-691.572) [-689.185] (-691.844) (-693.887) * (-698.084) [-692.530] (-691.776) (-693.075) -- 0:00:28
512000 -- [-690.773] (-691.320) (-692.793) (-692.378) * [-691.888] (-691.005) (-693.473) (-691.913) -- 0:00:28
512500 -- [-689.651] (-691.314) (-690.718) (-691.134) * (-690.053) (-690.284) (-699.829) [-692.792] -- 0:00:28
513000 -- (-689.967) [-690.554] (-692.756) (-693.925) * (-697.492) (-690.640) (-691.432) [-692.000] -- 0:00:28
513500 -- (-689.707) [-690.984] (-690.234) (-693.507) * (-693.196) (-692.594) (-690.807) [-693.209] -- 0:00:28
514000 -- (-689.546) (-690.259) (-689.771) [-691.398] * (-696.301) (-690.413) (-691.194) [-690.972] -- 0:00:28
514500 -- (-691.730) (-690.503) (-693.021) [-689.401] * (-695.802) [-689.973] (-693.097) (-691.209) -- 0:00:28
515000 -- (-691.490) (-695.978) [-690.408] (-696.403) * (-693.775) (-691.779) (-691.249) [-692.685] -- 0:00:28
Average standard deviation of split frequencies: 0.008451
515500 -- (-691.481) (-691.944) [-690.648] (-696.863) * (-695.596) (-690.231) (-690.872) [-689.211] -- 0:00:28
516000 -- [-690.704] (-690.846) (-691.265) (-694.140) * [-694.980] (-691.501) (-693.098) (-689.255) -- 0:00:28
516500 -- (-690.721) (-692.700) (-691.388) [-691.417] * (-691.346) (-690.593) (-691.603) [-689.428] -- 0:00:28
517000 -- (-691.488) [-693.190] (-692.114) (-692.218) * (-693.189) [-689.695] (-691.852) (-689.182) -- 0:00:28
517500 -- (-690.948) [-692.185] (-692.341) (-694.043) * [-693.105] (-691.422) (-690.517) (-690.721) -- 0:00:27
518000 -- [-691.607] (-691.604) (-694.635) (-690.487) * (-691.078) [-690.261] (-690.903) (-689.418) -- 0:00:27
518500 -- [-691.456] (-690.453) (-692.526) (-689.032) * (-694.539) [-690.159] (-689.460) (-691.899) -- 0:00:27
519000 -- (-691.013) (-695.323) [-689.987] (-689.511) * (-693.795) (-693.907) (-690.255) [-692.249] -- 0:00:28
519500 -- (-692.863) [-692.445] (-692.358) (-693.534) * (-694.295) (-693.938) (-696.932) [-691.595] -- 0:00:28
520000 -- [-690.005] (-693.335) (-691.588) (-691.765) * (-693.832) [-691.297] (-690.688) (-689.866) -- 0:00:28
Average standard deviation of split frequencies: 0.007583
520500 -- (-690.261) (-691.796) [-689.795] (-689.303) * (-696.200) (-689.430) (-694.392) [-691.775] -- 0:00:28
521000 -- [-690.012] (-690.336) (-690.043) (-689.159) * (-692.350) (-689.908) (-693.728) [-691.501] -- 0:00:28
521500 -- (-690.834) (-696.952) (-693.269) [-690.081] * (-692.813) (-689.770) (-695.390) [-690.928] -- 0:00:28
522000 -- (-691.013) (-692.901) (-694.353) [-691.063] * (-691.453) [-691.555] (-691.896) (-690.705) -- 0:00:28
522500 -- (-690.944) (-691.896) [-690.267] (-690.954) * (-691.468) [-693.344] (-689.276) (-695.281) -- 0:00:28
523000 -- (-691.617) (-692.514) (-689.255) [-689.522] * (-695.321) (-692.582) [-695.019] (-695.337) -- 0:00:28
523500 -- (-693.772) (-692.908) (-690.156) [-689.464] * [-690.786] (-690.153) (-691.022) (-691.205) -- 0:00:28
524000 -- (-693.955) (-690.161) [-690.675] (-689.878) * (-689.854) [-690.245] (-692.484) (-691.051) -- 0:00:28
524500 -- (-691.282) [-690.121] (-690.277) (-691.618) * [-690.753] (-691.771) (-691.257) (-689.564) -- 0:00:28
525000 -- [-690.614] (-690.806) (-689.905) (-690.250) * (-691.066) (-691.886) [-691.374] (-690.446) -- 0:00:28
Average standard deviation of split frequencies: 0.007855
525500 -- (-690.052) (-691.532) (-689.717) [-691.396] * (-690.306) (-691.668) (-691.100) [-692.363] -- 0:00:27
526000 -- (-693.013) (-691.122) (-690.596) [-689.611] * (-691.746) (-693.392) [-691.754] (-690.884) -- 0:00:27
526500 -- (-696.775) [-691.994] (-693.860) (-689.828) * (-689.324) (-690.966) (-690.817) [-689.623] -- 0:00:27
527000 -- (-693.266) (-690.909) (-693.438) [-690.292] * (-689.853) (-689.998) [-690.258] (-690.986) -- 0:00:27
527500 -- (-693.248) [-690.538] (-690.328) (-690.065) * [-691.553] (-690.823) (-691.920) (-692.371) -- 0:00:27
528000 -- [-691.358] (-695.995) (-690.129) (-691.367) * [-694.559] (-689.893) (-690.244) (-694.859) -- 0:00:27
528500 -- (-690.842) [-690.977] (-693.633) (-692.608) * (-699.480) (-692.595) [-696.113] (-690.425) -- 0:00:27
529000 -- [-690.010] (-692.995) (-692.086) (-691.717) * (-691.031) (-691.057) (-691.695) [-689.572] -- 0:00:27
529500 -- [-693.092] (-691.357) (-689.227) (-691.457) * (-689.935) (-692.736) [-690.408] (-689.601) -- 0:00:27
530000 -- [-691.074] (-693.582) (-694.140) (-693.727) * (-692.450) (-693.913) [-691.365] (-691.040) -- 0:00:27
Average standard deviation of split frequencies: 0.007734
530500 -- [-692.115] (-691.736) (-691.538) (-693.025) * [-690.761] (-692.517) (-690.653) (-689.385) -- 0:00:27
531000 -- [-692.119] (-690.153) (-692.920) (-689.771) * [-690.454] (-690.193) (-691.238) (-691.515) -- 0:00:27
531500 -- [-692.346] (-691.890) (-690.837) (-689.973) * [-689.827] (-690.193) (-691.256) (-691.371) -- 0:00:27
532000 -- [-691.598] (-691.896) (-690.468) (-692.196) * [-690.143] (-691.477) (-693.688) (-691.153) -- 0:00:27
532500 -- [-693.771] (-692.037) (-690.103) (-691.859) * (-694.173) (-690.454) [-690.708] (-695.146) -- 0:00:27
533000 -- [-692.045] (-692.805) (-689.434) (-694.031) * (-691.652) (-690.960) (-692.941) [-690.643] -- 0:00:27
533500 -- (-693.598) (-691.258) (-691.314) [-695.615] * (-690.157) (-693.538) [-691.772] (-692.362) -- 0:00:27
534000 -- (-690.442) [-691.783] (-689.375) (-693.119) * (-691.752) (-694.875) (-694.504) [-690.652] -- 0:00:27
534500 -- (-689.618) [-693.345] (-690.195) (-691.173) * (-690.445) (-692.326) (-690.150) [-693.106] -- 0:00:26
535000 -- (-692.748) [-693.187] (-689.812) (-694.111) * (-692.041) (-689.446) (-691.135) [-689.221] -- 0:00:26
Average standard deviation of split frequencies: 0.007553
535500 -- (-691.563) [-689.573] (-690.232) (-690.625) * (-692.438) (-692.088) (-692.583) [-689.811] -- 0:00:26
536000 -- (-696.450) (-692.940) (-689.903) [-690.729] * (-691.865) (-695.397) (-692.563) [-689.175] -- 0:00:27
536500 -- (-690.884) (-692.302) [-689.865] (-691.616) * [-689.929] (-692.402) (-690.435) (-689.829) -- 0:00:27
537000 -- (-691.416) [-688.953] (-689.684) (-689.900) * (-691.398) (-692.476) [-690.029] (-694.107) -- 0:00:27
537500 -- (-690.373) [-689.625] (-689.085) (-689.944) * (-690.033) (-691.368) (-692.184) [-695.972] -- 0:00:27
538000 -- [-690.594] (-689.975) (-690.453) (-690.121) * (-691.096) [-691.919] (-691.219) (-691.651) -- 0:00:27
538500 -- [-691.973] (-689.402) (-690.854) (-689.850) * [-693.598] (-690.251) (-691.076) (-691.527) -- 0:00:27
539000 -- (-692.185) (-694.579) (-691.006) [-692.676] * [-693.856] (-693.310) (-689.882) (-698.770) -- 0:00:27
539500 -- [-692.224] (-690.591) (-689.118) (-692.292) * (-690.493) (-694.140) (-696.001) [-690.160] -- 0:00:27
540000 -- (-690.819) [-690.615] (-693.921) (-690.213) * [-690.481] (-694.520) (-693.358) (-691.247) -- 0:00:27
Average standard deviation of split frequencies: 0.007744
540500 -- [-691.527] (-690.601) (-691.870) (-689.121) * (-690.296) (-695.318) [-693.192] (-690.950) -- 0:00:27
541000 -- (-694.727) (-692.558) [-690.088] (-690.044) * (-689.265) (-693.379) (-691.783) [-691.611] -- 0:00:27
541500 -- (-689.739) (-693.084) [-693.182] (-689.760) * (-690.549) [-692.436] (-695.348) (-694.461) -- 0:00:27
542000 -- [-691.954] (-689.843) (-690.432) (-690.681) * (-693.225) (-691.677) (-691.579) [-690.643] -- 0:00:27
542500 -- (-691.076) (-697.132) [-691.193] (-690.246) * (-690.652) (-691.994) [-692.171] (-689.607) -- 0:00:26
543000 -- (-690.180) (-695.740) [-692.395] (-693.522) * (-693.065) [-691.665] (-691.063) (-689.433) -- 0:00:26
543500 -- (-690.177) (-691.685) [-690.558] (-695.724) * (-690.659) [-690.498] (-689.700) (-690.755) -- 0:00:26
544000 -- [-691.287] (-689.923) (-691.484) (-694.054) * (-694.230) (-694.703) [-692.789] (-692.091) -- 0:00:26
544500 -- [-689.654] (-690.009) (-689.689) (-692.352) * (-691.357) [-689.547] (-690.325) (-692.673) -- 0:00:26
545000 -- (-690.837) [-689.217] (-693.968) (-690.512) * (-693.246) (-692.463) [-691.862] (-694.079) -- 0:00:26
Average standard deviation of split frequencies: 0.007974
545500 -- [-691.689] (-690.158) (-691.344) (-692.869) * (-693.885) (-691.615) (-691.715) [-693.436] -- 0:00:26
546000 -- (-694.533) (-691.153) [-691.339] (-690.059) * [-692.948] (-689.459) (-690.016) (-691.271) -- 0:00:26
546500 -- [-690.921] (-689.354) (-690.759) (-689.361) * (-692.724) (-689.186) [-689.908] (-693.827) -- 0:00:26
547000 -- (-690.860) (-689.707) [-693.451] (-691.847) * (-692.343) (-692.722) [-690.338] (-689.724) -- 0:00:26
547500 -- (-691.519) (-691.793) (-692.012) [-690.479] * (-691.037) (-690.971) (-691.482) [-689.057] -- 0:00:26
548000 -- (-690.985) (-693.570) (-692.403) [-691.596] * (-689.911) (-691.979) (-692.152) [-693.875] -- 0:00:26
548500 -- (-689.807) (-692.288) (-690.763) [-690.587] * (-692.604) (-691.429) [-690.966] (-694.516) -- 0:00:26
549000 -- (-689.858) (-692.404) [-689.414] (-692.200) * (-695.233) (-692.024) (-690.515) [-692.171] -- 0:00:26
549500 -- (-689.310) [-691.641] (-689.478) (-691.111) * (-694.251) (-690.467) [-691.945] (-691.176) -- 0:00:26
550000 -- [-689.318] (-690.637) (-691.329) (-692.987) * [-691.752] (-689.843) (-691.161) (-690.835) -- 0:00:26
Average standard deviation of split frequencies: 0.008359
550500 -- (-690.188) [-690.239] (-690.333) (-690.538) * (-690.181) (-690.399) [-689.960] (-693.841) -- 0:00:26
551000 -- (-690.241) [-691.223] (-694.069) (-693.419) * [-691.435] (-691.161) (-691.395) (-690.808) -- 0:00:26
551500 -- (-690.320) [-693.484] (-690.006) (-692.366) * (-693.215) [-690.035] (-691.640) (-691.293) -- 0:00:26
552000 -- (-690.104) (-692.740) [-691.312] (-690.912) * (-690.773) (-690.725) [-691.916] (-691.268) -- 0:00:25
552500 -- (-690.303) (-694.375) (-692.504) [-694.025] * [-690.161] (-693.355) (-691.398) (-695.838) -- 0:00:25
553000 -- [-690.543] (-691.718) (-691.162) (-693.337) * (-691.938) (-690.994) (-691.585) [-690.104] -- 0:00:26
553500 -- (-691.099) (-690.022) (-693.671) [-690.995] * [-691.553] (-691.084) (-689.434) (-690.639) -- 0:00:26
554000 -- (-692.497) [-690.187] (-690.083) (-691.265) * (-691.712) (-693.410) [-691.280] (-692.423) -- 0:00:26
554500 -- [-692.000] (-691.848) (-691.234) (-691.263) * (-690.711) (-692.705) [-689.527] (-690.961) -- 0:00:26
555000 -- (-691.674) [-689.424] (-692.339) (-693.029) * [-689.627] (-699.547) (-697.813) (-691.474) -- 0:00:26
Average standard deviation of split frequencies: 0.008478
555500 -- (-690.794) (-690.098) [-691.112] (-698.010) * [-690.057] (-690.658) (-691.406) (-691.661) -- 0:00:26
556000 -- (-689.137) [-690.879] (-691.753) (-690.048) * (-690.006) (-690.658) (-691.995) [-689.973] -- 0:00:26
556500 -- (-689.961) (-690.699) (-694.433) [-691.611] * [-690.222] (-690.310) (-691.066) (-693.317) -- 0:00:26
557000 -- (-689.405) (-689.332) (-695.277) [-689.081] * (-693.839) (-691.756) [-692.129] (-691.587) -- 0:00:26
557500 -- (-689.674) [-693.230] (-691.681) (-691.452) * (-692.600) (-691.051) (-693.392) [-695.859] -- 0:00:26
558000 -- [-690.523] (-692.387) (-690.113) (-691.335) * [-689.831] (-692.277) (-692.905) (-694.598) -- 0:00:26
558500 -- [-691.373] (-694.187) (-693.704) (-693.749) * (-692.683) (-690.465) (-692.163) [-691.421] -- 0:00:26
559000 -- (-690.096) [-690.233] (-690.707) (-692.686) * [-691.078] (-691.174) (-690.634) (-690.450) -- 0:00:26
559500 -- (-691.505) (-691.905) (-692.621) [-692.983] * (-692.524) (-689.404) [-690.386] (-690.055) -- 0:00:25
560000 -- (-690.210) [-690.799] (-692.984) (-693.407) * (-689.726) (-689.130) (-691.303) [-690.082] -- 0:00:25
Average standard deviation of split frequencies: 0.008556
560500 -- (-690.542) [-689.719] (-691.720) (-693.302) * (-690.024) [-691.118] (-690.354) (-690.564) -- 0:00:25
561000 -- (-692.231) [-689.941] (-690.836) (-692.512) * (-690.762) [-691.022] (-691.167) (-690.637) -- 0:00:25
561500 -- [-689.685] (-692.821) (-691.782) (-692.380) * [-695.902] (-691.907) (-692.986) (-689.962) -- 0:00:25
562000 -- (-691.599) (-694.050) [-689.870] (-691.028) * (-689.861) (-690.902) [-691.850] (-690.769) -- 0:00:25
562500 -- [-693.872] (-691.361) (-691.335) (-693.310) * [-690.044] (-690.578) (-692.052) (-691.782) -- 0:00:25
563000 -- (-690.214) (-689.535) (-690.248) [-692.234] * (-689.108) (-690.622) (-693.174) [-691.849] -- 0:00:25
563500 -- (-689.719) [-690.847] (-692.124) (-691.683) * [-689.180] (-692.849) (-691.339) (-690.805) -- 0:00:25
564000 -- [-689.788] (-691.344) (-690.510) (-693.941) * (-693.900) [-695.386] (-689.785) (-690.889) -- 0:00:25
564500 -- (-690.649) (-690.759) [-691.443] (-694.775) * [-691.347] (-691.222) (-689.570) (-691.221) -- 0:00:25
565000 -- [-690.421] (-690.319) (-689.774) (-693.954) * (-691.875) (-691.491) [-691.408] (-691.566) -- 0:00:25
Average standard deviation of split frequencies: 0.008574
565500 -- (-693.110) (-692.274) (-690.566) [-694.041] * (-690.138) (-692.721) (-690.186) [-689.276] -- 0:00:25
566000 -- (-692.895) (-691.312) (-692.537) [-691.830] * (-692.608) (-695.520) [-690.603] (-691.241) -- 0:00:25
566500 -- (-693.562) (-692.465) [-691.731] (-690.766) * (-693.153) [-692.168] (-690.817) (-693.444) -- 0:00:25
567000 -- (-692.814) (-690.988) [-692.019] (-689.499) * [-690.478] (-692.746) (-692.053) (-691.931) -- 0:00:25
567500 -- (-692.365) (-694.120) (-692.571) [-690.312] * (-691.235) [-692.378] (-691.296) (-690.692) -- 0:00:25
568000 -- (-689.516) (-696.878) (-691.944) [-691.162] * [-689.758] (-691.659) (-692.972) (-689.574) -- 0:00:25
568500 -- (-691.191) (-692.347) [-690.618] (-691.775) * (-689.913) (-690.891) (-694.254) [-691.560] -- 0:00:25
569000 -- [-696.779] (-691.140) (-690.652) (-693.304) * (-690.258) (-696.415) [-689.471] (-691.777) -- 0:00:24
569500 -- (-691.274) [-689.673] (-691.645) (-696.709) * [-692.914] (-697.252) (-689.929) (-691.400) -- 0:00:25
570000 -- (-692.499) (-689.896) (-692.273) [-692.304] * (-689.874) (-691.366) (-691.205) [-691.800] -- 0:00:25
Average standard deviation of split frequencies: 0.008649
570500 -- (-693.270) (-691.876) (-690.321) [-692.110] * (-690.106) (-692.986) (-689.203) [-691.506] -- 0:00:25
571000 -- (-695.631) [-690.557] (-690.381) (-691.068) * (-690.361) (-690.301) [-690.402] (-692.066) -- 0:00:25
571500 -- [-690.592] (-691.187) (-694.317) (-704.378) * (-692.478) (-692.380) [-691.819] (-693.290) -- 0:00:25
572000 -- [-690.283] (-693.757) (-690.578) (-703.673) * (-690.060) (-693.587) (-699.068) [-692.110] -- 0:00:25
572500 -- (-690.871) [-690.683] (-689.608) (-694.697) * (-690.490) (-691.634) (-691.870) [-692.732] -- 0:00:25
573000 -- (-691.701) [-690.407] (-689.424) (-692.716) * (-692.557) [-693.632] (-692.487) (-691.522) -- 0:00:25
573500 -- (-692.418) [-693.093] (-689.677) (-690.881) * [-690.693] (-689.272) (-694.874) (-693.710) -- 0:00:25
574000 -- [-692.137] (-689.519) (-691.806) (-692.705) * (-692.972) (-695.566) (-693.620) [-692.584] -- 0:00:25
574500 -- (-694.097) (-689.754) (-691.869) [-692.786] * (-694.052) (-691.440) [-689.733] (-690.679) -- 0:00:25
575000 -- (-691.623) [-690.824] (-690.209) (-693.447) * [-691.038] (-690.599) (-689.712) (-691.322) -- 0:00:25
Average standard deviation of split frequencies: 0.008762
575500 -- [-690.639] (-691.511) (-691.736) (-694.041) * [-692.472] (-692.030) (-689.804) (-690.271) -- 0:00:25
576000 -- [-693.021] (-694.215) (-696.722) (-695.264) * (-690.266) [-691.598] (-690.256) (-692.280) -- 0:00:25
576500 -- (-694.109) (-690.413) (-693.328) [-690.644] * (-691.469) [-694.442] (-690.569) (-694.497) -- 0:00:24
577000 -- [-690.463] (-692.243) (-692.435) (-689.227) * (-691.276) (-693.783) (-696.427) [-691.205] -- 0:00:24
577500 -- (-691.137) [-689.961] (-691.632) (-691.158) * (-689.708) [-692.303] (-691.361) (-689.197) -- 0:00:24
578000 -- [-689.192] (-693.070) (-690.138) (-694.051) * (-689.247) (-690.792) [-690.663] (-691.475) -- 0:00:24
578500 -- (-691.144) [-692.728] (-691.969) (-689.885) * [-689.176] (-691.168) (-690.195) (-692.730) -- 0:00:24
579000 -- (-689.272) (-689.800) [-692.232] (-689.728) * [-689.643] (-694.445) (-690.793) (-691.447) -- 0:00:24
579500 -- (-695.777) (-693.710) [-690.740] (-689.604) * (-690.200) [-693.016] (-689.996) (-690.242) -- 0:00:24
580000 -- (-690.121) (-691.658) (-698.637) [-690.219] * [-690.874] (-691.784) (-689.378) (-693.405) -- 0:00:24
Average standard deviation of split frequencies: 0.007736
580500 -- (-693.834) (-691.609) (-693.727) [-695.320] * (-693.103) (-693.969) (-693.235) [-691.238] -- 0:00:24
581000 -- (-690.438) (-690.780) [-690.215] (-695.857) * [-689.560] (-689.710) (-691.478) (-690.397) -- 0:00:24
581500 -- [-691.472] (-693.952) (-691.429) (-693.828) * (-691.219) (-691.826) (-691.449) [-690.906] -- 0:00:24
582000 -- (-690.021) (-690.390) [-690.328] (-690.223) * [-690.382] (-692.402) (-690.684) (-689.342) -- 0:00:24
582500 -- (-690.186) (-690.814) [-689.560] (-691.310) * (-691.192) (-693.906) [-690.598] (-689.887) -- 0:00:24
583000 -- (-689.811) (-689.963) [-690.155] (-695.334) * (-690.832) (-693.564) [-690.170] (-689.995) -- 0:00:24
583500 -- [-689.468] (-689.614) (-689.974) (-693.104) * (-694.553) (-696.311) (-692.450) [-690.955] -- 0:00:24
584000 -- (-691.048) (-690.266) (-690.639) [-690.982] * (-690.823) (-692.931) (-695.930) [-690.796] -- 0:00:24
584500 -- (-691.451) (-697.865) [-690.308] (-689.609) * (-690.182) (-693.637) (-690.900) [-690.518] -- 0:00:24
585000 -- (-694.959) (-690.823) (-699.274) [-690.745] * (-693.210) (-694.432) (-697.533) [-691.187] -- 0:00:24
Average standard deviation of split frequencies: 0.007619
585500 -- (-693.952) (-691.440) (-693.049) [-692.025] * (-693.764) [-691.206] (-691.442) (-691.539) -- 0:00:24
586000 -- (-691.402) (-690.737) (-691.339) [-690.836] * [-689.842] (-692.038) (-698.899) (-693.153) -- 0:00:24
586500 -- [-692.665] (-691.883) (-696.364) (-689.658) * [-690.698] (-696.434) (-691.013) (-691.674) -- 0:00:24
587000 -- (-690.885) [-692.264] (-692.647) (-690.532) * (-690.597) (-693.189) (-692.057) [-691.831] -- 0:00:24
587500 -- (-689.473) [-692.104] (-691.833) (-690.700) * (-690.724) (-696.772) (-691.908) [-691.817] -- 0:00:24
588000 -- (-691.250) (-691.492) [-692.808] (-690.229) * [-692.902] (-692.093) (-689.731) (-694.791) -- 0:00:24
588500 -- [-695.933] (-691.567) (-695.062) (-689.243) * (-690.747) (-691.296) (-691.241) [-695.513] -- 0:00:24
589000 -- (-694.550) [-692.095] (-692.149) (-690.359) * (-691.716) (-691.284) [-692.678] (-689.426) -- 0:00:24
589500 -- (-693.495) [-692.799] (-689.433) (-689.551) * (-689.263) [-696.677] (-690.068) (-692.207) -- 0:00:24
590000 -- (-691.911) (-689.940) (-691.676) [-689.362] * (-689.780) (-692.577) (-689.678) [-691.760] -- 0:00:24
Average standard deviation of split frequencies: 0.008075
590500 -- (-691.157) (-691.561) [-690.551] (-690.239) * (-693.635) (-695.894) (-692.233) [-689.903] -- 0:00:24
591000 -- (-689.190) [-690.535] (-692.635) (-694.405) * (-690.129) (-691.176) [-691.401] (-691.416) -- 0:00:24
591500 -- (-690.100) (-692.323) (-697.681) [-691.261] * (-689.568) (-690.569) (-690.187) [-689.859] -- 0:00:24
592000 -- (-690.340) (-694.616) (-695.586) [-690.524] * (-693.090) [-689.619] (-690.392) (-690.349) -- 0:00:24
592500 -- [-691.487] (-693.813) (-693.894) (-689.789) * (-699.112) (-689.154) (-689.225) [-689.182] -- 0:00:24
593000 -- (-691.510) (-692.392) [-691.541] (-690.384) * (-690.364) [-691.398] (-689.601) (-689.329) -- 0:00:24
593500 -- (-693.684) (-691.251) [-690.288] (-690.896) * [-689.864] (-690.855) (-691.329) (-691.763) -- 0:00:23
594000 -- (-690.343) (-690.319) [-691.564] (-692.438) * (-694.589) (-694.304) (-691.999) [-691.114] -- 0:00:23
594500 -- (-690.379) (-689.888) [-691.079] (-690.028) * (-690.756) (-693.655) (-694.317) [-691.004] -- 0:00:23
595000 -- [-690.376] (-690.591) (-689.426) (-689.932) * (-689.231) (-691.933) [-688.982] (-689.685) -- 0:00:23
Average standard deviation of split frequencies: 0.007584
595500 -- (-692.668) (-690.240) [-689.780] (-689.912) * (-692.420) (-693.383) (-691.679) [-691.087] -- 0:00:23
596000 -- [-691.870] (-689.864) (-690.311) (-689.933) * [-691.980] (-689.828) (-692.783) (-691.933) -- 0:00:23
596500 -- (-691.762) (-690.360) [-689.546] (-694.526) * (-694.454) [-690.005] (-693.350) (-691.800) -- 0:00:23
597000 -- [-692.016] (-690.095) (-694.640) (-694.319) * (-694.603) [-691.894] (-690.611) (-692.591) -- 0:00:23
597500 -- (-691.969) [-690.063] (-692.601) (-692.572) * (-692.210) (-692.645) [-691.390] (-691.960) -- 0:00:23
598000 -- [-689.460] (-691.493) (-693.203) (-692.797) * (-690.709) [-690.809] (-692.496) (-690.959) -- 0:00:23
598500 -- (-693.109) (-690.784) [-695.177] (-695.145) * (-693.470) (-691.218) (-690.871) [-689.787] -- 0:00:23
599000 -- (-699.235) (-691.204) [-692.655] (-691.924) * (-691.670) (-693.353) [-691.074] (-690.647) -- 0:00:23
599500 -- (-695.620) (-689.678) (-696.374) [-690.141] * (-694.223) (-691.478) (-692.286) [-690.220] -- 0:00:23
600000 -- [-693.074] (-692.964) (-690.668) (-693.194) * (-691.494) (-695.678) (-691.553) [-691.514] -- 0:00:23
Average standard deviation of split frequencies: 0.007479
600500 -- (-689.775) [-690.487] (-691.290) (-690.713) * (-691.339) (-692.635) [-690.913] (-693.793) -- 0:00:23
601000 -- (-693.728) [-692.193] (-690.431) (-692.991) * (-691.586) (-693.515) [-690.068] (-695.932) -- 0:00:23
601500 -- (-691.335) [-689.580] (-691.188) (-694.543) * [-696.217] (-691.609) (-690.237) (-692.294) -- 0:00:23
602000 -- (-696.916) (-690.623) (-693.685) [-691.600] * (-691.868) (-689.748) [-690.317] (-691.720) -- 0:00:23
602500 -- (-694.697) (-692.251) [-689.465] (-690.036) * (-689.946) [-690.546] (-690.785) (-689.625) -- 0:00:23
603000 -- (-691.304) [-693.157] (-692.283) (-694.268) * (-692.253) [-691.445] (-691.912) (-692.417) -- 0:00:23
603500 -- (-690.946) [-691.753] (-691.590) (-694.069) * (-690.224) (-691.400) (-691.930) [-690.176] -- 0:00:23
604000 -- [-690.704] (-691.734) (-689.520) (-694.358) * [-690.577] (-691.209) (-691.349) (-690.171) -- 0:00:23
604500 -- [-690.590] (-689.986) (-692.001) (-696.565) * (-691.922) (-690.131) [-694.479] (-689.468) -- 0:00:23
605000 -- (-692.282) [-690.242] (-691.232) (-696.450) * (-692.151) (-692.730) [-693.437] (-691.607) -- 0:00:23
Average standard deviation of split frequencies: 0.008145
605500 -- (-691.207) (-690.511) (-694.846) [-693.596] * (-696.707) (-695.866) (-690.315) [-691.914] -- 0:00:23
606000 -- (-694.520) (-689.655) [-692.276] (-690.530) * (-697.356) (-690.683) (-694.625) [-691.103] -- 0:00:23
606500 -- (-693.761) (-689.632) (-690.343) [-692.892] * (-692.147) (-692.160) [-692.129] (-693.190) -- 0:00:23
607000 -- [-690.364] (-693.084) (-696.858) (-692.156) * (-690.169) (-692.629) [-690.072] (-692.936) -- 0:00:23
607500 -- (-691.435) [-689.025] (-691.653) (-690.732) * [-690.286] (-690.673) (-689.750) (-690.359) -- 0:00:23
608000 -- [-690.309] (-691.407) (-693.037) (-691.069) * (-691.090) (-690.315) [-689.874] (-691.047) -- 0:00:23
608500 -- (-692.751) [-690.972] (-691.021) (-693.059) * [-691.915] (-695.862) (-690.204) (-691.548) -- 0:00:23
609000 -- (-690.711) (-693.558) [-690.869] (-691.565) * (-691.555) (-693.623) [-690.019] (-693.511) -- 0:00:23
609500 -- (-691.183) (-690.362) (-691.588) [-690.398] * [-689.572] (-691.296) (-692.667) (-692.074) -- 0:00:23
610000 -- (-692.430) (-693.730) (-691.591) [-691.312] * [-689.257] (-695.762) (-691.166) (-693.353) -- 0:00:23
Average standard deviation of split frequencies: 0.007992
610500 -- (-693.101) [-691.872] (-691.196) (-690.860) * (-693.210) (-692.714) [-690.229] (-692.170) -- 0:00:22
611000 -- (-690.226) (-692.333) [-691.294] (-691.176) * (-693.808) (-692.614) [-691.053] (-694.850) -- 0:00:22
611500 -- (-693.468) (-691.190) [-689.144] (-689.465) * (-691.397) (-693.352) (-689.852) [-690.474] -- 0:00:22
612000 -- (-690.099) (-690.126) (-690.817) [-692.058] * (-695.832) [-692.974] (-691.716) (-692.105) -- 0:00:22
612500 -- (-689.392) (-690.441) [-690.972] (-690.074) * [-692.366] (-693.504) (-693.512) (-690.737) -- 0:00:22
613000 -- (-692.851) [-689.981] (-690.438) (-694.927) * (-690.995) (-689.713) (-690.803) [-689.610] -- 0:00:22
613500 -- (-691.238) (-689.026) (-690.789) [-690.205] * (-691.090) (-690.176) (-692.544) [-691.285] -- 0:00:22
614000 -- (-693.184) (-691.653) [-690.521] (-692.117) * (-691.896) (-692.304) [-691.174] (-691.991) -- 0:00:22
614500 -- (-690.198) [-689.245] (-690.220) (-690.766) * (-691.202) (-691.576) (-691.238) [-692.738] -- 0:00:22
615000 -- (-692.599) (-691.266) (-689.938) [-691.539] * (-689.917) [-694.785] (-691.208) (-691.718) -- 0:00:22
Average standard deviation of split frequencies: 0.007473
615500 -- (-695.619) (-691.288) (-692.117) [-690.445] * (-692.703) [-690.931] (-692.478) (-689.477) -- 0:00:22
616000 -- (-693.927) [-691.398] (-694.408) (-690.475) * [-693.385] (-689.515) (-693.574) (-691.239) -- 0:00:22
616500 -- (-690.503) [-690.444] (-693.564) (-690.941) * (-691.516) (-690.755) (-691.589) [-689.876] -- 0:00:22
617000 -- (-692.151) (-690.948) (-689.826) [-695.150] * (-691.520) [-692.717] (-692.754) (-690.553) -- 0:00:22
617500 -- (-694.869) (-692.825) [-689.497] (-691.621) * (-691.694) [-690.604] (-691.676) (-690.634) -- 0:00:22
618000 -- (-690.779) [-690.427] (-691.015) (-690.960) * (-691.892) [-691.411] (-689.263) (-693.731) -- 0:00:22
618500 -- (-691.925) (-689.770) [-693.152] (-690.737) * (-689.488) (-690.543) (-691.188) [-690.528] -- 0:00:22
619000 -- (-692.416) (-689.798) (-698.291) [-692.577] * (-690.323) (-691.144) (-691.510) [-689.387] -- 0:00:22
619500 -- (-693.089) (-690.576) (-693.874) [-689.857] * (-693.521) (-690.872) (-690.587) [-691.126] -- 0:00:22
620000 -- (-691.650) (-692.829) (-689.965) [-691.925] * (-691.843) (-690.032) (-690.989) [-691.584] -- 0:00:22
Average standard deviation of split frequencies: 0.007193
620500 -- (-694.204) (-697.821) [-693.039] (-696.794) * (-693.591) [-689.154] (-690.192) (-689.371) -- 0:00:22
621000 -- (-691.671) [-691.154] (-692.146) (-692.245) * (-691.513) [-689.868] (-694.528) (-689.474) -- 0:00:22
621500 -- (-693.083) (-691.474) [-694.285] (-689.513) * [-690.832] (-689.466) (-692.291) (-690.392) -- 0:00:22
622000 -- [-691.322] (-692.682) (-690.271) (-689.759) * (-690.235) (-692.455) [-691.510] (-691.766) -- 0:00:22
622500 -- (-695.633) [-691.407] (-694.335) (-690.089) * (-690.120) (-690.320) (-693.063) [-694.903] -- 0:00:22
623000 -- (-691.709) [-690.504] (-690.778) (-694.495) * [-695.305] (-694.232) (-693.759) (-693.877) -- 0:00:22
623500 -- [-692.224] (-689.987) (-692.228) (-692.962) * [-689.700] (-692.376) (-689.339) (-692.615) -- 0:00:22
624000 -- [-692.224] (-690.944) (-692.769) (-691.841) * (-691.422) (-690.368) [-689.360] (-690.846) -- 0:00:22
624500 -- (-691.858) (-689.845) (-693.611) [-691.297] * [-690.635] (-691.097) (-692.603) (-689.622) -- 0:00:22
625000 -- (-692.892) (-690.538) [-692.304] (-690.713) * (-689.870) (-694.000) [-690.734] (-692.216) -- 0:00:22
Average standard deviation of split frequencies: 0.007220
625500 -- (-690.619) (-690.757) [-692.023] (-691.834) * (-690.392) (-691.681) [-689.909] (-692.988) -- 0:00:22
626000 -- (-689.468) (-691.011) (-694.491) [-694.734] * [-691.328] (-700.257) (-690.125) (-690.351) -- 0:00:22
626500 -- (-690.095) (-691.620) [-696.159] (-691.474) * (-690.850) (-691.472) (-690.321) [-690.197] -- 0:00:22
627000 -- (-690.596) [-690.214] (-690.238) (-693.496) * (-689.226) (-693.329) [-689.491] (-689.563) -- 0:00:22
627500 -- (-690.455) (-690.832) (-692.021) [-695.841] * (-691.722) [-690.644] (-690.437) (-689.637) -- 0:00:21
628000 -- (-693.030) (-692.779) (-692.086) [-689.960] * (-692.029) (-692.140) [-690.748] (-690.183) -- 0:00:21
628500 -- [-694.207] (-694.094) (-690.807) (-689.333) * (-690.738) [-690.772] (-691.167) (-691.859) -- 0:00:21
629000 -- [-693.812] (-691.439) (-692.320) (-689.736) * [-692.534] (-694.317) (-691.638) (-694.616) -- 0:00:21
629500 -- (-691.686) [-690.443] (-692.894) (-690.767) * (-693.206) (-693.189) [-691.262] (-690.333) -- 0:00:21
630000 -- [-690.211] (-696.413) (-690.764) (-691.782) * (-694.907) [-692.847] (-690.094) (-694.239) -- 0:00:21
Average standard deviation of split frequencies: 0.006288
630500 -- (-692.772) (-693.086) (-691.488) [-690.607] * (-696.472) (-692.957) [-690.555] (-696.052) -- 0:00:21
631000 -- (-690.662) [-691.511] (-692.866) (-690.918) * (-697.184) [-692.720] (-694.158) (-693.027) -- 0:00:21
631500 -- (-692.433) [-690.015] (-690.009) (-691.188) * (-692.012) [-691.437] (-691.995) (-690.501) -- 0:00:21
632000 -- [-693.474] (-691.607) (-690.225) (-692.054) * [-689.607] (-690.924) (-692.805) (-696.216) -- 0:00:21
632500 -- (-693.149) (-690.180) [-689.215] (-691.408) * [-692.127] (-692.272) (-692.357) (-691.337) -- 0:00:21
633000 -- (-694.642) [-692.363] (-689.958) (-692.885) * [-692.330] (-690.968) (-690.892) (-695.233) -- 0:00:21
633500 -- (-692.061) (-696.163) [-689.549] (-691.648) * [-690.573] (-692.258) (-694.229) (-694.662) -- 0:00:21
634000 -- (-693.094) (-692.671) [-689.716] (-693.521) * (-690.435) (-693.121) [-691.299] (-693.439) -- 0:00:21
634500 -- [-690.714] (-693.383) (-690.378) (-689.978) * (-692.556) (-693.847) [-692.361] (-690.361) -- 0:00:21
635000 -- (-691.681) [-690.721] (-690.176) (-690.011) * [-690.915] (-691.471) (-692.401) (-693.842) -- 0:00:21
Average standard deviation of split frequencies: 0.006191
635500 -- (-692.411) (-690.722) (-689.555) [-691.706] * (-691.545) [-689.680] (-691.172) (-690.930) -- 0:00:21
636000 -- (-691.159) [-691.169] (-690.193) (-692.549) * (-693.342) [-690.959] (-690.581) (-690.610) -- 0:00:21
636500 -- [-691.006] (-691.401) (-696.910) (-689.922) * (-689.232) (-691.071) [-690.529] (-689.841) -- 0:00:21
637000 -- [-693.355] (-692.476) (-689.699) (-692.475) * (-691.796) (-691.854) (-690.254) [-690.511] -- 0:00:21
637500 -- (-692.648) (-689.936) [-689.563] (-690.586) * (-690.268) (-693.626) (-691.463) [-691.397] -- 0:00:21
638000 -- (-689.058) (-693.108) [-689.859] (-689.556) * (-691.134) [-691.484] (-689.132) (-695.010) -- 0:00:21
638500 -- (-689.900) (-693.405) [-689.247] (-690.858) * [-690.283] (-691.560) (-694.448) (-698.292) -- 0:00:21
639000 -- (-692.794) (-692.887) (-690.659) [-692.515] * [-691.616] (-689.798) (-690.878) (-690.941) -- 0:00:21
639500 -- [-692.848] (-690.417) (-691.421) (-690.774) * (-695.168) (-690.241) (-692.306) [-690.775] -- 0:00:21
640000 -- (-691.013) (-689.511) (-695.051) [-694.309] * (-692.336) (-691.657) (-690.767) [-690.603] -- 0:00:21
Average standard deviation of split frequencies: 0.005670
640500 -- (-690.953) (-690.210) (-698.359) [-691.662] * (-691.100) (-693.205) [-690.422] (-689.783) -- 0:00:21
641000 -- [-690.106] (-689.961) (-692.640) (-690.314) * (-691.268) (-692.344) (-692.326) [-691.683] -- 0:00:21
641500 -- (-690.792) (-691.895) [-692.401] (-689.659) * (-691.439) (-691.863) (-695.891) [-690.490] -- 0:00:21
642000 -- (-692.313) (-691.200) (-690.829) [-689.497] * (-689.822) (-691.520) (-695.170) [-693.293] -- 0:00:21
642500 -- [-689.840] (-690.632) (-689.447) (-696.427) * (-689.593) (-690.751) [-689.360] (-692.763) -- 0:00:21
643000 -- (-694.478) [-689.662] (-689.435) (-692.504) * [-690.150] (-689.846) (-690.004) (-691.797) -- 0:00:21
643500 -- (-693.935) (-691.606) (-689.304) [-690.572] * (-691.503) (-690.003) [-689.247] (-692.953) -- 0:00:21
644000 -- (-690.150) [-691.006] (-693.067) (-694.776) * (-692.176) [-689.541] (-690.561) (-690.780) -- 0:00:21
644500 -- (-690.745) (-689.562) [-694.154] (-694.221) * (-693.262) [-689.763] (-691.273) (-693.302) -- 0:00:20
645000 -- (-693.629) [-690.908] (-692.872) (-694.655) * (-691.443) [-694.005] (-691.691) (-689.865) -- 0:00:20
Average standard deviation of split frequencies: 0.006353
645500 -- (-694.219) (-694.072) [-693.674] (-695.182) * (-692.170) (-693.577) (-693.023) [-690.970] -- 0:00:20
646000 -- [-689.696] (-694.121) (-694.270) (-690.083) * (-693.862) (-693.573) [-691.609] (-692.697) -- 0:00:20
646500 -- (-692.999) [-690.573] (-691.885) (-691.559) * (-691.286) (-694.208) (-690.734) [-692.225] -- 0:00:20
647000 -- (-689.830) (-690.171) (-689.407) [-691.010] * (-695.073) (-696.042) (-694.036) [-693.101] -- 0:00:20
647500 -- [-690.191] (-694.043) (-690.597) (-691.250) * (-692.454) (-691.953) (-693.187) [-692.324] -- 0:00:20
648000 -- (-692.102) (-691.740) [-692.477] (-691.458) * (-691.295) [-689.990] (-690.992) (-691.194) -- 0:00:20
648500 -- (-693.385) (-690.471) [-693.952] (-690.004) * (-691.055) (-693.694) [-689.636] (-692.765) -- 0:00:20
649000 -- (-693.041) (-699.425) [-689.444] (-690.088) * (-691.566) (-694.330) (-691.087) [-689.688] -- 0:00:20
649500 -- [-691.992] (-698.821) (-689.360) (-689.831) * (-693.318) [-691.952] (-689.975) (-696.090) -- 0:00:20
650000 -- (-689.523) (-697.653) (-692.593) [-689.998] * (-693.032) (-690.878) (-693.280) [-694.193] -- 0:00:20
Average standard deviation of split frequencies: 0.006265
650500 -- (-690.881) (-697.475) [-694.244] (-699.783) * (-693.977) (-690.431) (-690.151) [-696.752] -- 0:00:20
651000 -- (-692.104) (-695.460) [-694.061] (-690.048) * (-690.662) [-693.418] (-691.897) (-689.251) -- 0:00:20
651500 -- (-693.976) [-690.589] (-692.892) (-691.890) * [-690.205] (-692.038) (-695.156) (-693.373) -- 0:00:20
652000 -- (-693.976) [-692.427] (-690.265) (-694.675) * (-692.364) [-692.305] (-691.953) (-694.275) -- 0:00:20
652500 -- (-696.708) (-690.154) (-690.742) [-690.218] * [-692.993] (-692.434) (-690.769) (-690.858) -- 0:00:20
653000 -- (-691.355) [-690.472] (-691.470) (-690.563) * (-691.481) (-692.943) [-691.391] (-691.502) -- 0:00:20
653500 -- [-691.596] (-690.404) (-690.680) (-692.358) * (-690.317) [-692.323] (-695.128) (-692.630) -- 0:00:20
654000 -- [-692.100] (-689.330) (-691.220) (-703.777) * (-690.079) (-690.572) [-697.987] (-693.661) -- 0:00:20
654500 -- (-692.755) (-689.771) (-693.073) [-689.830] * (-692.377) (-691.424) [-691.360] (-689.926) -- 0:00:20
655000 -- [-691.603] (-690.742) (-693.310) (-694.624) * (-692.091) (-690.473) [-689.839] (-695.862) -- 0:00:20
Average standard deviation of split frequencies: 0.006848
655500 -- [-690.211] (-690.832) (-691.496) (-692.403) * [-691.351] (-690.192) (-689.757) (-690.280) -- 0:00:20
656000 -- (-690.929) (-690.611) [-693.544] (-691.035) * (-693.451) (-690.845) (-694.171) [-689.983] -- 0:00:20
656500 -- [-689.277] (-689.892) (-690.606) (-689.514) * (-689.544) (-690.771) [-695.668] (-690.094) -- 0:00:20
657000 -- (-691.907) (-691.039) [-689.585] (-691.183) * (-691.206) (-690.376) (-693.130) [-691.170] -- 0:00:20
657500 -- (-690.195) [-691.631] (-691.994) (-692.920) * (-690.604) [-691.011] (-692.514) (-693.674) -- 0:00:20
658000 -- [-695.508] (-692.266) (-689.522) (-695.714) * [-694.862] (-690.013) (-690.560) (-691.595) -- 0:00:20
658500 -- [-693.714] (-691.995) (-691.298) (-691.864) * (-690.625) [-691.106] (-689.946) (-689.715) -- 0:00:20
659000 -- [-692.472] (-692.562) (-690.859) (-691.570) * [-690.021] (-693.030) (-689.978) (-690.249) -- 0:00:20
659500 -- [-690.947] (-690.900) (-691.903) (-692.045) * (-693.173) [-691.015] (-691.797) (-690.312) -- 0:00:20
660000 -- [-692.295] (-693.649) (-693.595) (-691.952) * (-692.945) (-692.409) (-689.093) [-690.925] -- 0:00:20
Average standard deviation of split frequencies: 0.007261
660500 -- [-691.848] (-693.797) (-691.457) (-691.140) * (-691.055) [-691.027] (-694.741) (-689.522) -- 0:00:20
661000 -- (-690.032) (-691.747) [-689.732] (-689.481) * (-692.742) (-690.735) (-693.830) [-689.519] -- 0:00:20
661500 -- (-690.302) (-692.829) (-691.703) [-689.978] * (-690.613) (-693.147) (-692.603) [-691.354] -- 0:00:19
662000 -- (-690.343) (-689.685) [-690.963] (-692.672) * (-691.252) (-691.824) [-692.568] (-696.171) -- 0:00:19
662500 -- (-692.947) (-690.927) (-690.717) [-692.680] * (-698.679) (-690.445) [-690.895] (-689.113) -- 0:00:19
663000 -- (-692.051) [-692.276] (-695.081) (-690.043) * [-693.448] (-689.340) (-691.704) (-691.389) -- 0:00:19
663500 -- (-690.458) (-691.279) [-691.171] (-692.541) * (-693.911) (-694.571) (-692.022) [-691.979] -- 0:00:19
664000 -- (-690.169) (-690.413) [-691.709] (-691.547) * [-693.276] (-694.327) (-695.182) (-691.056) -- 0:00:19
664500 -- (-692.055) (-691.011) [-694.883] (-693.145) * (-690.533) (-689.947) [-690.877] (-690.354) -- 0:00:19
665000 -- (-690.163) (-690.297) [-689.668] (-691.467) * (-690.956) [-689.847] (-690.510) (-690.679) -- 0:00:19
Average standard deviation of split frequencies: 0.007828
665500 -- [-690.669] (-690.318) (-691.823) (-692.750) * (-691.808) [-691.838] (-692.711) (-690.658) -- 0:00:19
666000 -- [-691.148] (-689.041) (-692.188) (-694.590) * (-690.551) (-689.614) [-692.045] (-689.696) -- 0:00:19
666500 -- (-690.208) [-689.717] (-690.718) (-694.673) * (-690.754) [-689.896] (-691.608) (-689.571) -- 0:00:19
667000 -- (-691.663) (-692.151) [-690.892] (-691.006) * (-689.113) (-694.449) [-695.152] (-690.819) -- 0:00:19
667500 -- (-690.251) (-692.772) [-692.414] (-691.502) * (-691.712) (-692.989) (-695.847) [-689.918] -- 0:00:19
668000 -- (-690.570) (-690.102) (-699.619) [-691.429] * (-689.967) (-690.120) [-690.663] (-690.285) -- 0:00:19
668500 -- [-691.442] (-689.995) (-696.079) (-691.216) * (-689.813) (-689.910) [-691.256] (-691.947) -- 0:00:19
669000 -- (-691.689) (-692.463) (-697.553) [-691.218] * [-689.570] (-690.892) (-696.538) (-689.250) -- 0:00:19
669500 -- [-691.745] (-693.296) (-690.009) (-690.512) * (-689.635) (-690.042) (-690.271) [-689.166] -- 0:00:19
670000 -- (-691.211) (-693.569) [-691.700] (-691.805) * (-689.296) [-689.983] (-690.105) (-689.067) -- 0:00:19
Average standard deviation of split frequencies: 0.008063
670500 -- (-692.398) (-690.029) [-691.380] (-690.409) * (-691.525) [-689.632] (-691.174) (-689.142) -- 0:00:19
671000 -- (-690.814) [-690.142] (-690.710) (-691.022) * (-690.920) (-694.065) (-689.704) [-690.552] -- 0:00:19
671500 -- (-690.641) (-691.095) [-689.528] (-690.797) * (-691.738) [-690.648] (-690.003) (-696.332) -- 0:00:19
672000 -- (-693.419) (-692.220) (-690.148) [-689.224] * [-689.649] (-693.465) (-691.805) (-691.118) -- 0:00:19
672500 -- (-692.954) [-690.397] (-690.140) (-689.499) * [-690.257] (-697.140) (-690.289) (-689.561) -- 0:00:19
673000 -- (-689.164) (-691.757) [-690.675] (-690.729) * (-691.029) [-691.859] (-689.155) (-690.331) -- 0:00:19
673500 -- [-689.333] (-689.450) (-690.910) (-690.829) * (-691.074) [-692.094] (-690.642) (-689.339) -- 0:00:19
674000 -- [-690.155] (-689.339) (-689.991) (-690.221) * (-689.431) (-693.023) (-692.304) [-690.545] -- 0:00:19
674500 -- (-690.505) [-690.472] (-690.825) (-690.942) * (-689.938) [-691.833] (-689.294) (-693.078) -- 0:00:19
675000 -- (-690.476) (-691.393) [-693.605] (-690.783) * (-695.703) [-689.775] (-690.718) (-692.425) -- 0:00:19
Average standard deviation of split frequencies: 0.007712
675500 -- [-691.512] (-691.340) (-692.084) (-690.913) * [-691.137] (-689.327) (-690.833) (-692.474) -- 0:00:19
676000 -- (-689.517) (-691.363) (-693.043) [-689.990] * (-696.915) [-691.454] (-692.394) (-689.449) -- 0:00:19
676500 -- [-691.297] (-692.029) (-694.570) (-690.779) * [-692.423] (-689.964) (-691.796) (-696.802) -- 0:00:19
677000 -- (-690.061) (-691.317) [-691.820] (-692.259) * [-690.179] (-689.221) (-689.235) (-690.903) -- 0:00:19
677500 -- [-691.079] (-694.842) (-691.488) (-691.649) * (-690.960) (-689.236) (-690.969) [-691.066] -- 0:00:19
678000 -- (-690.370) [-691.119] (-691.850) (-694.396) * (-694.888) (-690.655) (-691.893) [-691.357] -- 0:00:18
678500 -- (-689.701) (-696.317) (-692.122) [-691.704] * (-691.565) (-690.795) [-692.072] (-691.282) -- 0:00:18
679000 -- (-692.403) (-692.977) [-690.463] (-694.243) * (-694.176) (-692.574) (-695.113) [-691.535] -- 0:00:18
679500 -- [-690.406] (-690.946) (-690.134) (-692.183) * (-692.631) (-692.517) [-695.162] (-692.101) -- 0:00:18
680000 -- (-690.528) [-691.383] (-690.623) (-694.140) * (-690.973) [-693.950] (-694.807) (-693.496) -- 0:00:18
Average standard deviation of split frequencies: 0.007374
680500 -- (-689.927) [-693.986] (-691.204) (-695.986) * (-690.681) (-695.437) [-693.964] (-691.569) -- 0:00:18
681000 -- (-690.432) (-691.260) (-694.325) [-691.294] * (-691.394) (-694.115) [-693.625] (-691.330) -- 0:00:18
681500 -- [-692.214] (-690.790) (-690.112) (-691.614) * (-690.709) (-692.411) [-692.305] (-693.810) -- 0:00:18
682000 -- (-696.317) (-691.212) (-690.819) [-691.387] * (-689.559) (-694.027) [-691.410] (-697.788) -- 0:00:18
682500 -- (-693.608) (-692.021) (-690.983) [-692.069] * (-693.235) [-690.513] (-691.379) (-690.517) -- 0:00:18
683000 -- [-691.075] (-693.726) (-696.418) (-692.426) * [-692.004] (-690.647) (-691.805) (-694.427) -- 0:00:18
683500 -- [-691.509] (-691.408) (-692.713) (-691.425) * (-695.145) (-689.874) (-689.337) [-694.912] -- 0:00:18
684000 -- (-691.540) [-689.831] (-694.275) (-692.735) * (-692.778) [-689.664] (-689.929) (-690.838) -- 0:00:18
684500 -- (-690.905) [-689.461] (-692.330) (-696.231) * [-692.080] (-690.014) (-690.157) (-691.223) -- 0:00:18
685000 -- (-691.598) (-690.780) [-690.485] (-695.794) * (-692.731) [-691.639] (-690.955) (-690.899) -- 0:00:18
Average standard deviation of split frequencies: 0.007438
685500 -- (-690.504) (-692.296) (-689.887) [-696.216] * (-693.882) [-695.831] (-691.395) (-693.052) -- 0:00:18
686000 -- (-690.558) (-693.207) [-691.966] (-690.837) * (-693.192) [-693.629] (-691.004) (-691.676) -- 0:00:18
686500 -- [-691.159] (-696.017) (-690.574) (-689.681) * (-694.820) (-694.822) (-689.733) [-690.896] -- 0:00:18
687000 -- (-691.917) (-689.572) (-691.283) [-692.729] * (-691.682) [-690.644] (-692.402) (-691.388) -- 0:00:18
687500 -- [-693.975] (-689.016) (-689.464) (-690.536) * (-692.141) (-700.068) (-689.997) [-689.608] -- 0:00:18
688000 -- (-693.670) (-689.349) (-689.948) [-690.614] * (-692.003) (-692.142) [-689.941] (-691.855) -- 0:00:18
688500 -- (-690.776) (-689.761) (-690.374) [-690.509] * (-691.445) (-690.812) (-694.877) [-690.176] -- 0:00:18
689000 -- (-691.961) (-697.999) [-692.321] (-689.873) * (-692.323) (-689.878) [-692.067] (-691.467) -- 0:00:18
689500 -- [-690.681] (-690.004) (-692.222) (-689.884) * [-692.381] (-691.849) (-693.644) (-691.628) -- 0:00:18
690000 -- (-692.091) (-695.317) [-692.333] (-690.985) * [-690.698] (-690.732) (-691.047) (-690.865) -- 0:00:18
Average standard deviation of split frequencies: 0.008070
690500 -- (-691.988) [-701.761] (-693.119) (-690.742) * (-692.153) [-691.123] (-690.886) (-690.497) -- 0:00:18
691000 -- (-696.089) (-691.234) (-690.497) [-690.394] * (-692.920) (-693.138) [-689.384] (-690.647) -- 0:00:18
691500 -- (-694.429) [-691.883] (-691.170) (-694.367) * (-689.918) (-691.673) (-692.543) [-689.434] -- 0:00:18
692000 -- (-695.205) [-689.321] (-691.453) (-691.465) * (-689.568) (-692.489) (-692.151) [-691.721] -- 0:00:18
692500 -- (-693.511) (-690.736) [-689.963] (-692.750) * (-691.161) [-694.788] (-690.097) (-694.650) -- 0:00:18
693000 -- (-690.098) [-690.090] (-689.782) (-690.611) * (-689.155) [-691.059] (-690.855) (-692.789) -- 0:00:18
693500 -- [-691.704] (-691.638) (-690.989) (-695.890) * (-691.060) (-690.433) (-696.794) [-690.977] -- 0:00:18
694000 -- [-689.642] (-691.088) (-691.507) (-691.560) * (-692.168) (-690.463) [-691.921] (-693.309) -- 0:00:18
694500 -- [-690.537] (-691.368) (-695.136) (-689.166) * [-695.301] (-697.083) (-690.794) (-691.497) -- 0:00:18
695000 -- (-690.913) [-691.647] (-690.655) (-690.000) * (-692.657) (-692.759) (-693.777) [-691.825] -- 0:00:17
Average standard deviation of split frequencies: 0.008486
695500 -- (-692.960) (-689.885) [-690.992] (-690.177) * [-689.857] (-697.659) (-692.686) (-692.107) -- 0:00:17
696000 -- (-693.775) (-691.316) (-689.859) [-695.259] * [-692.786] (-689.460) (-691.513) (-692.443) -- 0:00:17
696500 -- (-690.302) [-691.834] (-692.677) (-691.433) * (-693.561) [-689.189] (-690.125) (-689.917) -- 0:00:17
697000 -- (-694.649) (-694.109) [-691.322] (-692.693) * (-690.079) [-689.227] (-691.599) (-689.823) -- 0:00:17
697500 -- (-690.071) (-693.402) [-690.292] (-692.503) * (-694.822) (-693.689) [-693.731] (-695.455) -- 0:00:17
698000 -- (-693.783) (-692.873) [-690.357] (-693.099) * (-691.647) (-694.731) [-689.188] (-692.228) -- 0:00:17
698500 -- (-691.115) (-691.933) [-689.948] (-690.935) * (-691.394) (-691.172) [-692.189] (-689.861) -- 0:00:17
699000 -- (-695.967) [-691.129] (-690.323) (-693.039) * (-690.344) (-691.841) [-692.753] (-690.391) -- 0:00:17
699500 -- (-690.089) (-691.517) (-689.703) [-699.989] * (-691.408) [-690.478] (-690.141) (-692.971) -- 0:00:17
700000 -- [-691.213] (-692.414) (-692.349) (-698.928) * [-694.641] (-692.757) (-693.145) (-692.740) -- 0:00:17
Average standard deviation of split frequencies: 0.008232
700500 -- (-689.379) (-691.077) [-690.921] (-695.997) * (-690.285) (-689.944) [-690.344] (-698.465) -- 0:00:17
701000 -- (-690.050) [-689.954] (-692.252) (-694.969) * (-690.453) (-690.989) [-690.208] (-692.789) -- 0:00:17
701500 -- (-695.360) (-690.301) (-690.477) [-691.507] * (-691.417) (-690.991) [-691.694] (-690.872) -- 0:00:17
702000 -- [-695.296] (-690.384) (-690.512) (-697.946) * (-690.070) (-692.244) [-690.103] (-690.080) -- 0:00:17
702500 -- (-690.953) (-691.746) [-690.224] (-695.783) * (-690.899) (-690.425) [-689.737] (-689.260) -- 0:00:17
703000 -- (-693.842) (-693.042) (-690.128) [-690.389] * (-693.214) (-692.433) [-690.058] (-691.623) -- 0:00:17
703500 -- (-693.810) [-690.280] (-695.059) (-694.437) * (-689.222) (-692.359) (-695.561) [-690.096] -- 0:00:17
704000 -- (-692.069) [-691.446] (-698.163) (-697.056) * (-691.507) (-693.876) (-696.121) [-692.568] -- 0:00:17
704500 -- [-689.946] (-693.015) (-697.434) (-693.159) * [-693.500] (-691.692) (-690.705) (-693.636) -- 0:00:17
705000 -- (-691.468) (-692.437) [-693.378] (-697.014) * [-694.615] (-695.126) (-691.157) (-690.885) -- 0:00:17
Average standard deviation of split frequencies: 0.008287
705500 -- (-689.775) [-694.688] (-691.493) (-692.755) * [-691.249] (-691.014) (-690.170) (-689.855) -- 0:00:17
706000 -- (-691.866) (-692.529) (-695.598) [-691.281] * (-690.715) [-693.656] (-691.960) (-690.759) -- 0:00:17
706500 -- (-690.034) [-690.819] (-691.318) (-690.162) * (-691.618) (-693.849) (-696.017) [-689.707] -- 0:00:17
707000 -- (-693.646) (-691.799) [-691.159] (-690.082) * (-691.118) (-694.922) (-690.467) [-690.042] -- 0:00:17
707500 -- (-693.934) (-690.020) [-691.479] (-694.199) * (-690.302) (-691.564) [-689.983] (-689.129) -- 0:00:17
708000 -- (-693.402) (-690.097) [-690.976] (-693.544) * (-689.775) [-695.145] (-692.857) (-692.306) -- 0:00:17
708500 -- (-697.465) [-689.787] (-689.935) (-690.447) * (-695.605) (-693.782) (-693.003) [-691.190] -- 0:00:17
709000 -- (-689.458) (-691.108) [-694.079] (-695.934) * (-693.245) [-691.946] (-692.010) (-693.342) -- 0:00:17
709500 -- (-694.600) [-692.833] (-691.936) (-696.947) * (-690.666) (-690.748) (-692.125) [-689.886] -- 0:00:17
710000 -- (-697.622) (-690.560) (-697.788) [-690.823] * (-690.448) [-693.689] (-695.380) (-691.935) -- 0:00:17
Average standard deviation of split frequencies: 0.007843
710500 -- (-693.669) (-690.613) (-694.791) [-689.877] * (-690.585) [-695.128] (-696.234) (-690.879) -- 0:00:17
711000 -- (-693.269) [-691.565] (-693.190) (-691.208) * (-689.756) (-692.990) [-691.174] (-690.407) -- 0:00:17
711500 -- (-693.351) (-691.949) (-690.767) [-692.679] * (-691.256) (-691.492) (-690.467) [-690.295] -- 0:00:17
712000 -- [-689.789] (-692.294) (-690.824) (-694.073) * [-693.989] (-690.950) (-695.268) (-690.133) -- 0:00:16
712500 -- [-692.200] (-691.306) (-689.912) (-696.280) * (-690.834) [-692.151] (-694.215) (-695.314) -- 0:00:16
713000 -- (-691.751) [-690.445] (-689.517) (-695.210) * (-692.836) (-692.400) (-691.061) [-692.207] -- 0:00:16
713500 -- (-692.112) (-696.942) (-694.296) [-692.228] * (-691.261) (-690.828) (-696.794) [-689.267] -- 0:00:16
714000 -- [-692.094] (-695.120) (-691.152) (-695.613) * (-691.005) (-694.873) [-692.881] (-689.802) -- 0:00:16
714500 -- [-690.903] (-691.187) (-691.445) (-694.368) * [-691.472] (-693.919) (-689.768) (-691.945) -- 0:00:16
715000 -- (-690.699) (-690.455) [-690.511] (-689.497) * (-693.009) (-691.172) (-690.548) [-691.127] -- 0:00:16
Average standard deviation of split frequencies: 0.008249
715500 -- (-689.292) (-690.582) (-691.892) [-691.891] * (-691.595) (-692.160) (-694.611) [-690.382] -- 0:00:16
716000 -- (-691.020) (-689.938) [-692.798] (-692.511) * (-691.026) (-693.724) (-691.927) [-689.763] -- 0:00:16
716500 -- (-694.269) [-689.453] (-689.903) (-690.034) * [-690.128] (-691.215) (-692.336) (-689.968) -- 0:00:16
717000 -- (-693.159) (-690.495) (-692.996) [-689.947] * (-690.014) (-690.948) [-694.216] (-692.519) -- 0:00:16
717500 -- (-690.978) (-694.030) [-691.729] (-689.024) * (-691.033) (-692.062) [-693.322] (-690.600) -- 0:00:16
718000 -- (-689.195) (-689.736) [-690.679] (-689.229) * [-690.105] (-691.517) (-697.163) (-692.191) -- 0:00:16
718500 -- (-690.438) (-690.919) (-692.633) [-690.821] * [-691.139] (-691.978) (-693.284) (-691.871) -- 0:00:16
719000 -- (-689.810) (-692.944) (-694.704) [-693.671] * (-691.077) (-692.383) [-694.814] (-690.585) -- 0:00:16
719500 -- (-694.471) (-696.201) [-691.784] (-690.433) * (-691.107) [-690.997] (-691.432) (-690.324) -- 0:00:16
720000 -- (-694.624) (-690.850) [-691.784] (-696.406) * (-691.261) (-691.690) [-691.148] (-693.660) -- 0:00:16
Average standard deviation of split frequencies: 0.007888
720500 -- (-689.805) (-690.855) [-689.738] (-694.484) * [-691.143] (-689.947) (-690.858) (-690.783) -- 0:00:16
721000 -- (-692.156) (-689.737) (-694.166) [-693.770] * (-689.110) (-691.116) [-692.599] (-693.094) -- 0:00:16
721500 -- (-694.135) [-691.032] (-689.565) (-692.880) * [-691.083] (-694.453) (-696.105) (-693.549) -- 0:00:16
722000 -- (-691.013) (-692.532) [-689.590] (-689.217) * (-689.649) [-689.914] (-693.149) (-690.916) -- 0:00:16
722500 -- (-693.095) (-690.700) (-690.604) [-692.239] * (-690.166) (-690.981) [-691.085] (-691.888) -- 0:00:16
723000 -- (-691.244) (-692.069) (-692.617) [-692.487] * (-689.877) (-690.014) [-692.194] (-697.222) -- 0:00:16
723500 -- (-691.313) (-691.341) [-690.031] (-692.287) * (-693.601) (-689.712) (-691.216) [-690.325] -- 0:00:16
724000 -- [-689.461] (-691.663) (-689.660) (-691.424) * (-690.677) (-691.281) [-692.728] (-692.784) -- 0:00:16
724500 -- (-691.399) (-692.108) [-690.458] (-691.585) * (-690.929) (-692.013) (-691.719) [-690.917] -- 0:00:16
725000 -- (-692.062) (-692.217) (-690.816) [-689.303] * (-689.427) (-691.935) (-691.979) [-690.794] -- 0:00:16
Average standard deviation of split frequencies: 0.008365
725500 -- (-689.662) [-689.627] (-692.075) (-690.262) * [-690.942] (-690.672) (-693.732) (-692.464) -- 0:00:16
726000 -- [-689.670] (-689.726) (-690.862) (-691.901) * (-691.841) (-690.504) [-694.031] (-691.197) -- 0:00:16
726500 -- (-690.897) (-694.327) [-689.594] (-690.313) * (-694.168) (-691.155) [-692.761] (-691.390) -- 0:00:16
727000 -- (-690.890) (-692.595) (-689.563) [-690.373] * (-690.959) (-692.367) [-696.923] (-691.994) -- 0:00:16
727500 -- (-691.382) (-692.353) [-689.159] (-692.276) * [-695.012] (-693.224) (-691.305) (-692.023) -- 0:00:16
728000 -- (-690.743) [-691.114] (-693.878) (-690.069) * (-690.603) (-691.239) (-692.318) [-689.368] -- 0:00:16
728500 -- (-690.364) (-694.383) [-689.673] (-691.191) * (-693.552) (-690.379) [-690.671] (-689.431) -- 0:00:16
729000 -- [-693.467] (-697.550) (-689.683) (-690.884) * (-692.725) (-695.595) [-691.786] (-690.655) -- 0:00:15
729500 -- (-689.790) (-698.937) [-689.605] (-690.531) * [-692.584] (-692.872) (-695.348) (-692.165) -- 0:00:15
730000 -- (-691.490) (-689.876) [-690.042] (-690.274) * [-693.241] (-689.523) (-693.209) (-689.586) -- 0:00:15
Average standard deviation of split frequencies: 0.008729
730500 -- [-691.069] (-691.036) (-689.656) (-691.233) * (-695.477) [-689.717] (-691.340) (-689.579) -- 0:00:15
731000 -- (-690.086) [-691.445] (-689.873) (-696.328) * (-693.667) [-689.826] (-699.695) (-689.808) -- 0:00:15
731500 -- (-690.191) (-690.453) (-695.484) [-689.439] * (-690.029) (-692.699) [-697.693] (-690.995) -- 0:00:15
732000 -- [-692.894] (-690.130) (-694.112) (-689.870) * [-689.999] (-689.944) (-698.652) (-692.682) -- 0:00:15
732500 -- [-696.259] (-694.876) (-692.234) (-689.583) * (-689.892) (-691.566) (-694.387) [-690.883] -- 0:00:15
733000 -- (-689.977) (-693.589) (-690.197) [-690.108] * [-693.570] (-690.892) (-692.931) (-690.881) -- 0:00:15
733500 -- (-693.649) (-701.619) [-690.104] (-689.466) * [-691.386] (-690.081) (-690.071) (-689.440) -- 0:00:15
734000 -- (-694.716) (-691.431) (-691.250) [-691.086] * (-692.202) (-689.577) (-689.500) [-689.971] -- 0:00:15
734500 -- [-690.661] (-692.384) (-693.209) (-690.227) * (-691.729) [-692.344] (-691.806) (-690.327) -- 0:00:15
735000 -- (-690.698) (-692.433) [-690.938] (-693.177) * (-690.360) (-689.760) [-689.770] (-693.422) -- 0:00:15
Average standard deviation of split frequencies: 0.008628
735500 -- [-689.694] (-691.807) (-690.992) (-689.783) * (-692.706) [-691.320] (-697.442) (-692.359) -- 0:00:15
736000 -- [-689.822] (-692.624) (-691.780) (-690.976) * (-691.008) [-690.259] (-694.760) (-691.232) -- 0:00:15
736500 -- [-689.312] (-691.265) (-692.106) (-691.985) * [-691.582] (-689.483) (-692.480) (-693.308) -- 0:00:15
737000 -- (-691.273) (-689.152) [-691.829] (-691.379) * (-690.382) [-690.271] (-695.160) (-692.447) -- 0:00:15
737500 -- (-692.768) (-692.121) [-690.730] (-695.327) * [-690.426] (-690.669) (-689.958) (-692.376) -- 0:00:15
738000 -- (-691.378) [-689.211] (-690.255) (-695.139) * (-689.624) (-691.287) [-691.927] (-690.652) -- 0:00:15
738500 -- [-691.699] (-690.320) (-689.452) (-692.009) * [-690.996] (-690.883) (-690.757) (-691.309) -- 0:00:15
739000 -- (-692.055) (-690.375) (-688.955) [-691.585] * (-689.566) (-690.342) (-692.606) [-690.512] -- 0:00:15
739500 -- [-690.881] (-692.925) (-689.127) (-695.858) * [-689.313] (-693.862) (-691.457) (-694.268) -- 0:00:15
740000 -- (-692.333) (-690.188) (-689.148) [-692.354] * (-689.477) [-691.803] (-691.010) (-691.448) -- 0:00:15
Average standard deviation of split frequencies: 0.008536
740500 -- (-692.045) (-690.271) (-690.212) [-690.205] * [-689.155] (-692.865) (-690.431) (-691.584) -- 0:00:15
741000 -- [-689.936] (-689.197) (-689.199) (-691.126) * [-689.565] (-690.695) (-689.608) (-693.639) -- 0:00:15
741500 -- (-691.931) [-690.711] (-691.072) (-692.432) * (-689.887) (-690.861) [-689.886] (-692.157) -- 0:00:15
742000 -- (-691.022) (-693.118) [-692.220] (-694.573) * (-690.792) [-689.340] (-694.148) (-689.412) -- 0:00:15
742500 -- (-691.760) (-690.724) [-693.831] (-693.784) * (-690.683) (-692.712) [-691.229] (-689.159) -- 0:00:15
743000 -- (-690.845) (-691.475) (-692.944) [-690.460] * [-689.418] (-691.453) (-691.728) (-689.290) -- 0:00:15
743500 -- (-689.445) (-693.039) [-693.720] (-691.570) * [-690.052] (-692.026) (-692.771) (-690.923) -- 0:00:15
744000 -- [-690.440] (-694.255) (-693.545) (-690.799) * (-690.201) [-692.018] (-694.213) (-693.196) -- 0:00:15
744500 -- [-690.614] (-691.473) (-689.684) (-691.005) * (-689.957) (-695.185) (-691.220) [-694.562] -- 0:00:15
745000 -- (-693.238) [-692.340] (-690.245) (-691.258) * [-689.578] (-692.952) (-691.661) (-692.355) -- 0:00:15
Average standard deviation of split frequencies: 0.008401
745500 -- (-695.240) (-691.124) (-691.093) [-690.187] * (-690.210) [-693.678] (-690.968) (-690.123) -- 0:00:15
746000 -- [-691.686] (-695.222) (-694.250) (-690.075) * (-690.412) (-690.079) [-691.554] (-692.643) -- 0:00:14
746500 -- (-690.138) (-689.331) (-690.490) [-691.795] * (-692.036) [-690.480] (-693.604) (-690.193) -- 0:00:14
747000 -- (-692.097) (-693.595) [-689.305] (-693.217) * [-690.959] (-692.210) (-691.178) (-690.373) -- 0:00:14
747500 -- (-691.666) (-693.953) (-689.242) [-691.017] * [-689.637] (-689.439) (-692.676) (-693.224) -- 0:00:14
748000 -- (-691.696) [-689.595] (-694.595) (-697.485) * (-689.624) (-689.676) (-690.336) [-689.966] -- 0:00:14
748500 -- (-692.140) [-691.529] (-694.135) (-692.866) * (-690.581) (-689.657) (-695.539) [-691.139] -- 0:00:14
749000 -- [-692.475] (-690.926) (-691.695) (-694.252) * (-689.695) (-692.308) [-692.185] (-695.241) -- 0:00:14
749500 -- (-690.625) (-694.087) [-695.282] (-697.632) * [-692.778] (-692.754) (-692.685) (-691.569) -- 0:00:14
750000 -- (-691.252) (-691.634) (-690.586) [-691.369] * [-691.085] (-690.635) (-692.752) (-689.694) -- 0:00:14
Average standard deviation of split frequencies: 0.007831
750500 -- (-690.437) [-691.599] (-689.727) (-691.712) * (-690.286) (-691.913) [-691.507] (-694.321) -- 0:00:14
751000 -- [-694.191] (-691.901) (-689.749) (-691.103) * (-694.016) (-690.456) [-688.993] (-693.560) -- 0:00:14
751500 -- (-691.006) (-692.630) [-689.767] (-689.275) * (-692.313) (-689.771) [-689.736] (-689.871) -- 0:00:14
752000 -- (-690.100) (-693.813) (-691.434) [-691.553] * (-690.146) [-691.315] (-692.690) (-690.930) -- 0:00:14
752500 -- (-692.155) (-690.290) (-692.796) [-690.342] * (-690.146) [-693.429] (-692.956) (-690.341) -- 0:00:14
753000 -- (-689.284) (-690.650) (-691.627) [-691.698] * (-693.000) [-692.518] (-691.741) (-691.004) -- 0:00:14
753500 -- [-689.835] (-692.734) (-691.512) (-691.886) * (-690.139) (-695.003) (-690.503) [-691.793] -- 0:00:14
754000 -- (-692.469) [-690.903] (-690.767) (-695.151) * (-690.345) (-689.536) [-691.558] (-694.997) -- 0:00:14
754500 -- (-690.817) [-699.393] (-695.452) (-693.285) * (-690.247) (-691.584) [-691.157] (-691.294) -- 0:00:14
755000 -- (-693.676) [-689.356] (-690.646) (-692.686) * (-693.829) (-691.033) (-690.481) [-689.970] -- 0:00:14
Average standard deviation of split frequencies: 0.007813
755500 -- [-691.068] (-689.837) (-690.632) (-690.804) * (-690.797) (-691.211) [-692.406] (-694.780) -- 0:00:14
756000 -- (-689.939) (-692.097) (-691.057) [-692.497] * (-690.971) [-690.900] (-693.294) (-690.597) -- 0:00:14
756500 -- (-691.694) [-691.068] (-692.481) (-691.867) * (-693.752) (-689.768) [-693.825] (-691.408) -- 0:00:14
757000 -- (-691.116) [-692.537] (-689.155) (-689.507) * (-694.025) (-693.072) (-691.173) [-693.243] -- 0:00:14
757500 -- (-690.791) (-691.522) [-690.082] (-690.021) * [-690.331] (-691.499) (-693.158) (-696.011) -- 0:00:14
758000 -- (-690.155) [-689.662] (-692.946) (-690.473) * (-690.013) (-700.840) [-694.553] (-690.323) -- 0:00:14
758500 -- [-691.893] (-690.774) (-693.549) (-690.132) * [-691.430] (-692.413) (-691.432) (-693.407) -- 0:00:14
759000 -- [-691.378] (-692.165) (-693.859) (-691.173) * (-692.382) (-694.236) (-692.204) [-689.488] -- 0:00:14
759500 -- (-693.175) (-692.211) (-692.598) [-689.272] * (-692.958) (-693.402) (-692.866) [-692.619] -- 0:00:14
760000 -- (-694.886) (-692.139) [-689.984] (-689.808) * (-691.248) (-689.720) (-694.559) [-693.442] -- 0:00:14
Average standard deviation of split frequencies: 0.008312
760500 -- [-691.850] (-691.786) (-693.505) (-689.544) * (-694.194) [-691.031] (-689.819) (-692.005) -- 0:00:14
761000 -- (-692.289) (-693.182) (-689.881) [-691.655] * (-694.061) (-689.278) (-690.254) [-692.225] -- 0:00:14
761500 -- (-689.966) (-693.610) (-689.462) [-691.183] * [-690.893] (-689.121) (-690.192) (-690.784) -- 0:00:14
762000 -- [-690.903] (-690.210) (-690.275) (-692.947) * (-692.129) [-691.042] (-693.052) (-691.487) -- 0:00:14
762500 -- (-692.078) (-691.278) [-690.075] (-690.671) * (-694.098) [-690.231] (-690.334) (-690.064) -- 0:00:14
763000 -- (-693.952) (-693.095) (-690.105) [-690.907] * [-690.678] (-693.662) (-690.106) (-689.674) -- 0:00:13
763500 -- (-693.035) [-689.913] (-693.559) (-690.827) * (-690.152) (-691.551) (-692.413) [-692.234] -- 0:00:13
764000 -- (-691.288) [-691.275] (-690.905) (-691.825) * (-691.529) [-691.006] (-689.260) (-690.575) -- 0:00:13
764500 -- (-689.641) (-693.285) [-694.085] (-690.266) * (-694.756) [-691.374] (-690.085) (-689.450) -- 0:00:13
765000 -- (-691.001) (-693.104) [-692.131] (-690.368) * (-694.470) [-689.975] (-690.602) (-691.271) -- 0:00:13
Average standard deviation of split frequencies: 0.008652
765500 -- (-689.883) (-694.450) [-693.514] (-692.517) * (-691.523) (-692.469) (-690.887) [-689.881] -- 0:00:13
766000 -- (-695.804) [-691.009] (-690.170) (-690.075) * [-692.978] (-690.260) (-691.073) (-690.015) -- 0:00:13
766500 -- (-691.922) (-692.656) [-690.067] (-691.348) * [-694.434] (-690.293) (-690.193) (-689.721) -- 0:00:13
767000 -- [-690.536] (-690.024) (-690.876) (-689.431) * (-691.941) [-691.470] (-689.661) (-691.294) -- 0:00:13
767500 -- [-690.155] (-689.751) (-691.236) (-690.180) * [-690.265] (-691.588) (-689.292) (-690.404) -- 0:00:13
768000 -- [-690.413] (-691.081) (-693.909) (-690.621) * (-691.166) [-693.865] (-689.996) (-691.724) -- 0:00:13
768500 -- (-690.972) (-691.569) (-691.333) [-690.331] * [-690.866] (-693.164) (-691.073) (-690.537) -- 0:00:13
769000 -- (-693.063) (-693.994) (-691.919) [-692.243] * (-689.775) (-693.455) (-690.589) [-696.340] -- 0:00:13
769500 -- [-689.359] (-691.535) (-694.310) (-694.624) * [-690.961] (-690.463) (-690.674) (-693.489) -- 0:00:13
770000 -- (-694.146) (-690.646) [-691.891] (-692.386) * [-691.937] (-689.551) (-691.164) (-691.797) -- 0:00:13
Average standard deviation of split frequencies: 0.008600
770500 -- [-691.432] (-690.508) (-693.302) (-692.506) * (-690.935) (-689.706) (-694.018) [-695.621] -- 0:00:13
771000 -- (-691.031) (-691.763) [-691.140] (-692.685) * (-691.104) (-692.118) (-690.431) [-690.431] -- 0:00:13
771500 -- [-690.645] (-690.945) (-692.009) (-693.392) * (-697.253) (-690.709) (-692.972) [-690.574] -- 0:00:13
772000 -- (-692.609) (-689.623) (-691.516) [-694.492] * (-691.782) [-691.490] (-689.901) (-690.885) -- 0:00:13
772500 -- (-692.176) (-689.747) (-694.145) [-690.118] * (-690.332) [-691.633] (-689.985) (-691.953) -- 0:00:13
773000 -- (-690.326) (-689.543) (-690.695) [-693.404] * [-689.133] (-689.402) (-690.978) (-691.074) -- 0:00:13
773500 -- (-689.270) (-690.390) [-691.666] (-689.912) * (-688.979) (-691.548) (-690.283) [-692.668] -- 0:00:13
774000 -- (-693.008) (-691.097) (-690.789) [-689.553] * [-689.016] (-689.676) (-690.793) (-691.247) -- 0:00:13
774500 -- (-689.730) [-690.283] (-689.430) (-689.284) * [-691.385] (-691.533) (-691.151) (-694.190) -- 0:00:13
775000 -- (-693.397) (-691.394) [-694.967] (-692.510) * [-691.347] (-691.635) (-690.655) (-697.241) -- 0:00:13
Average standard deviation of split frequencies: 0.008290
775500 -- [-690.546] (-692.812) (-692.994) (-693.523) * (-692.913) (-694.406) [-693.277] (-694.588) -- 0:00:13
776000 -- (-691.155) (-689.255) (-692.128) [-690.961] * [-689.710] (-692.335) (-691.282) (-692.925) -- 0:00:13
776500 -- (-689.518) (-689.840) (-690.800) [-691.253] * (-689.073) [-690.530] (-692.990) (-689.254) -- 0:00:13
777000 -- (-690.206) (-689.448) [-691.225] (-690.237) * (-690.053) (-694.154) [-691.863] (-690.141) -- 0:00:13
777500 -- (-690.366) (-692.731) (-691.420) [-690.406] * (-693.487) (-695.538) [-691.124] (-689.278) -- 0:00:13
778000 -- (-689.657) (-693.499) (-691.189) [-690.334] * (-693.748) (-692.038) (-689.902) [-689.555] -- 0:00:13
778500 -- [-693.365] (-689.550) (-689.786) (-693.231) * (-691.536) (-693.109) (-690.460) [-690.582] -- 0:00:13
779000 -- (-693.345) (-692.672) (-689.005) [-695.336] * (-691.446) [-689.045] (-691.508) (-692.250) -- 0:00:13
779500 -- (-691.111) (-691.024) [-689.111] (-690.652) * (-692.219) [-692.198] (-692.493) (-690.491) -- 0:00:13
780000 -- (-693.758) (-691.307) (-689.773) [-691.478] * (-691.348) (-691.126) (-689.653) [-690.378] -- 0:00:12
Average standard deviation of split frequencies: 0.008241
780500 -- (-689.360) (-693.055) [-691.422] (-689.703) * [-690.272] (-690.250) (-692.447) (-689.830) -- 0:00:12
781000 -- (-689.944) (-696.285) (-690.802) [-691.449] * (-690.259) [-689.803] (-690.225) (-689.952) -- 0:00:12
781500 -- (-692.846) [-692.227] (-693.966) (-691.042) * (-692.387) (-689.438) (-690.046) [-690.020] -- 0:00:12
782000 -- [-692.403] (-696.519) (-690.993) (-690.062) * [-694.221] (-690.977) (-690.529) (-691.119) -- 0:00:12
782500 -- [-693.347] (-691.782) (-695.009) (-690.169) * (-692.648) (-692.073) [-691.394] (-695.481) -- 0:00:12
783000 -- (-692.495) [-689.050] (-690.108) (-690.917) * (-695.238) (-693.602) (-689.319) [-691.814] -- 0:00:12
783500 -- (-698.591) (-692.087) (-693.798) [-689.374] * (-692.384) [-692.705] (-693.421) (-689.658) -- 0:00:12
784000 -- (-689.801) (-691.616) (-695.164) [-690.265] * [-689.827] (-697.290) (-691.624) (-690.773) -- 0:00:12
784500 -- [-695.056] (-695.185) (-692.484) (-689.736) * [-690.634] (-691.259) (-696.486) (-689.369) -- 0:00:12
785000 -- (-692.146) (-692.248) [-690.154] (-696.312) * (-691.159) (-689.957) (-695.300) [-689.482] -- 0:00:12
Average standard deviation of split frequencies: 0.008397
785500 -- (-694.473) (-691.092) (-689.674) [-691.067] * [-692.965] (-697.776) (-693.254) (-692.157) -- 0:00:12
786000 -- (-690.903) (-691.739) (-693.618) [-691.250] * [-691.286] (-690.822) (-692.137) (-693.365) -- 0:00:12
786500 -- [-691.099] (-690.055) (-690.646) (-692.380) * (-692.611) (-692.244) [-689.899] (-692.785) -- 0:00:12
787000 -- (-693.345) (-691.663) (-690.196) [-693.520] * (-690.412) (-690.510) (-693.304) [-692.166] -- 0:00:12
787500 -- [-690.799] (-692.447) (-689.504) (-691.955) * (-690.695) (-689.778) (-692.614) [-691.758] -- 0:00:12
788000 -- (-689.451) (-692.136) (-694.825) [-689.937] * (-689.551) (-691.378) (-691.046) [-690.187] -- 0:00:12
788500 -- [-689.970] (-693.496) (-691.193) (-696.413) * (-693.393) (-690.536) (-692.557) [-690.280] -- 0:00:12
789000 -- (-690.316) (-691.198) [-690.715] (-692.591) * (-691.320) (-689.927) (-691.428) [-691.447] -- 0:00:12
789500 -- (-691.751) (-692.864) (-689.517) [-692.091] * [-690.858] (-692.921) (-692.022) (-691.116) -- 0:00:12
790000 -- (-690.246) (-692.676) [-690.382] (-694.233) * (-692.517) (-691.213) [-692.045] (-690.582) -- 0:00:12
Average standard deviation of split frequencies: 0.008382
790500 -- [-689.320] (-694.103) (-690.562) (-693.711) * [-689.372] (-691.268) (-691.230) (-692.660) -- 0:00:12
791000 -- (-689.903) [-691.695] (-691.147) (-690.514) * (-690.394) [-689.584] (-692.493) (-690.441) -- 0:00:12
791500 -- (-690.210) (-690.438) (-692.309) [-690.253] * (-693.839) [-691.305] (-690.717) (-690.402) -- 0:00:12
792000 -- (-691.785) (-692.248) (-689.187) [-693.334] * (-691.681) [-691.256] (-691.487) (-692.689) -- 0:00:12
792500 -- [-691.099] (-691.230) (-688.943) (-691.064) * (-691.139) (-690.784) [-692.179] (-690.314) -- 0:00:12
793000 -- (-692.121) (-691.014) (-691.674) [-692.668] * (-700.812) (-691.829) (-693.696) [-690.533] -- 0:00:12
793500 -- (-692.128) (-694.003) (-692.908) [-690.179] * (-690.147) [-691.006] (-689.886) (-694.471) -- 0:00:12
794000 -- (-690.963) (-693.568) (-693.847) [-689.415] * [-691.125] (-691.944) (-689.287) (-689.379) -- 0:00:12
794500 -- (-689.993) [-691.713] (-695.731) (-690.518) * (-693.578) (-692.448) [-692.804] (-690.106) -- 0:00:12
795000 -- (-692.161) (-692.867) (-693.845) [-690.365] * (-691.067) [-692.740] (-698.894) (-691.290) -- 0:00:12
Average standard deviation of split frequencies: 0.008465
795500 -- (-692.359) (-689.014) (-692.688) [-690.667] * (-690.998) [-695.549] (-690.841) (-690.449) -- 0:00:12
796000 -- (-694.981) (-690.223) (-691.484) [-691.061] * (-690.545) (-690.416) (-690.347) [-690.703] -- 0:00:12
796500 -- (-691.488) (-691.900) (-691.164) [-691.575] * [-690.385] (-692.217) (-692.027) (-697.916) -- 0:00:12
797000 -- (-692.812) (-690.395) [-691.711] (-691.030) * (-690.327) (-690.899) (-691.131) [-689.694] -- 0:00:11
797500 -- (-692.601) (-689.454) (-693.096) [-690.706] * [-690.154] (-694.156) (-689.728) (-690.212) -- 0:00:11
798000 -- (-693.616) (-692.968) (-689.667) [-690.700] * (-691.614) [-692.478] (-689.474) (-691.179) -- 0:00:11
798500 -- (-695.713) (-692.055) [-691.880] (-692.075) * (-692.287) (-690.330) [-691.137] (-692.388) -- 0:00:11
799000 -- (-690.899) [-689.796] (-690.613) (-689.874) * [-696.950] (-690.515) (-692.659) (-689.873) -- 0:00:11
799500 -- [-695.055] (-691.067) (-690.421) (-689.463) * (-690.270) [-691.954] (-692.901) (-691.509) -- 0:00:11
800000 -- (-689.927) [-691.735] (-691.059) (-690.849) * (-692.088) [-692.042] (-690.239) (-689.916) -- 0:00:11
Average standard deviation of split frequencies: 0.008554
800500 -- (-689.745) (-691.360) (-692.121) [-690.798] * (-697.901) [-690.727] (-691.605) (-691.657) -- 0:00:11
801000 -- (-690.239) (-690.169) (-692.727) [-692.051] * [-691.526] (-692.210) (-691.592) (-689.049) -- 0:00:11
801500 -- (-689.435) [-689.662] (-689.558) (-691.142) * (-690.975) [-692.282] (-690.163) (-690.330) -- 0:00:11
802000 -- (-689.134) (-690.981) [-694.841] (-691.971) * (-690.321) (-690.493) [-689.708] (-690.238) -- 0:00:11
802500 -- (-693.862) [-690.327] (-693.223) (-692.153) * (-692.512) [-693.193] (-690.734) (-691.376) -- 0:00:11
803000 -- [-692.512] (-694.156) (-693.813) (-691.076) * [-693.653] (-693.628) (-690.724) (-691.143) -- 0:00:11
803500 -- [-691.872] (-691.029) (-695.231) (-690.880) * (-695.698) (-695.599) (-692.995) [-693.254] -- 0:00:11
804000 -- (-690.594) [-691.047] (-693.359) (-692.117) * (-690.929) [-691.510] (-689.743) (-689.730) -- 0:00:11
804500 -- (-691.591) [-696.260] (-693.944) (-692.115) * (-691.098) (-691.955) (-689.834) [-691.234] -- 0:00:11
805000 -- (-691.143) (-691.876) (-689.174) [-689.839] * [-693.282] (-694.761) (-691.784) (-690.978) -- 0:00:11
Average standard deviation of split frequencies: 0.008773
805500 -- (-693.260) [-692.604] (-690.170) (-689.405) * (-690.438) [-689.757] (-692.916) (-692.532) -- 0:00:11
806000 -- (-696.126) (-690.812) (-692.980) [-690.355] * [-692.032] (-689.827) (-690.378) (-691.953) -- 0:00:11
806500 -- [-692.239] (-693.344) (-690.659) (-693.422) * [-691.115] (-693.449) (-689.940) (-696.806) -- 0:00:11
807000 -- (-689.264) [-690.503] (-691.279) (-691.214) * (-691.047) [-692.836] (-690.957) (-691.062) -- 0:00:11
807500 -- [-689.657] (-690.844) (-691.442) (-692.170) * (-690.110) (-696.109) (-691.891) [-690.543] -- 0:00:11
808000 -- (-690.730) [-689.805] (-693.049) (-695.212) * (-690.526) [-691.520] (-690.189) (-690.873) -- 0:00:11
808500 -- (-693.596) (-694.291) (-691.624) [-689.551] * (-695.523) (-692.149) (-691.557) [-691.195] -- 0:00:11
809000 -- (-692.572) [-690.609] (-691.690) (-692.023) * (-691.576) (-691.007) (-693.521) [-692.137] -- 0:00:11
809500 -- [-690.885] (-690.849) (-692.782) (-692.281) * [-690.825] (-689.498) (-694.582) (-689.799) -- 0:00:11
810000 -- (-691.222) (-691.480) [-692.381] (-690.521) * [-689.636] (-691.539) (-690.344) (-690.450) -- 0:00:11
Average standard deviation of split frequencies: 0.009133
810500 -- (-692.122) (-691.911) [-692.677] (-689.445) * [-693.525] (-690.310) (-694.915) (-689.404) -- 0:00:11
811000 -- (-690.945) (-691.491) (-691.885) [-690.572] * (-691.951) (-691.896) (-690.460) [-689.833] -- 0:00:11
811500 -- (-693.331) (-689.760) [-690.497] (-698.782) * (-691.518) [-697.256] (-690.929) (-694.297) -- 0:00:11
812000 -- (-693.350) (-691.556) (-692.300) [-691.188] * (-691.789) (-696.153) [-689.989] (-693.239) -- 0:00:11
812500 -- (-693.572) (-689.407) (-691.793) [-690.506] * (-691.596) (-691.070) [-689.471] (-692.858) -- 0:00:11
813000 -- (-690.269) (-697.308) [-689.408] (-690.973) * [-691.923] (-691.866) (-691.295) (-692.793) -- 0:00:11
813500 -- [-690.856] (-698.861) (-695.608) (-691.393) * [-690.144] (-694.036) (-690.973) (-692.855) -- 0:00:11
814000 -- (-691.169) [-696.375] (-696.191) (-692.008) * [-690.318] (-689.034) (-693.301) (-693.329) -- 0:00:10
814500 -- (-691.227) (-689.710) (-691.006) [-691.945] * (-692.064) [-691.869] (-696.583) (-692.048) -- 0:00:10
815000 -- (-694.051) (-690.474) [-690.752] (-692.823) * (-690.504) (-691.997) [-690.956] (-692.102) -- 0:00:10
Average standard deviation of split frequencies: 0.009243
815500 -- (-690.334) [-691.199] (-693.908) (-689.150) * (-689.451) [-691.161] (-690.315) (-689.731) -- 0:00:10
816000 -- (-690.176) [-691.090] (-693.697) (-689.126) * (-693.031) (-690.001) (-690.046) [-690.692] -- 0:00:10
816500 -- (-692.543) (-693.425) (-692.296) [-690.955] * [-691.078] (-691.018) (-689.903) (-690.160) -- 0:00:10
817000 -- (-689.816) (-695.062) (-691.252) [-689.840] * (-692.619) (-690.961) (-689.749) [-689.943] -- 0:00:10
817500 -- (-689.922) (-690.960) (-692.865) [-689.229] * (-697.228) (-690.181) [-690.620] (-692.570) -- 0:00:10
818000 -- (-691.819) [-692.348] (-690.379) (-693.129) * (-693.514) [-689.555] (-690.881) (-691.541) -- 0:00:10
818500 -- (-691.142) (-691.140) (-692.716) [-689.930] * (-689.581) (-689.884) (-694.759) [-690.305] -- 0:00:10
819000 -- (-695.344) [-690.229] (-690.858) (-691.509) * [-693.073] (-689.404) (-694.519) (-689.546) -- 0:00:10
819500 -- (-690.652) [-689.882] (-689.938) (-690.025) * (-692.413) (-690.426) [-689.542] (-689.656) -- 0:00:10
820000 -- (-691.633) (-693.209) (-692.598) [-690.987] * (-691.165) (-690.098) [-690.192] (-690.366) -- 0:00:10
Average standard deviation of split frequencies: 0.009011
820500 -- (-691.419) (-691.745) (-690.847) [-690.319] * (-690.386) (-690.250) [-690.889] (-691.836) -- 0:00:10
821000 -- (-691.641) [-691.250] (-695.588) (-691.558) * (-694.427) (-692.560) (-693.298) [-690.002] -- 0:00:10
821500 -- (-695.092) [-694.802] (-690.082) (-689.704) * [-690.902] (-692.057) (-689.796) (-691.656) -- 0:00:10
822000 -- [-689.608] (-690.514) (-695.596) (-692.022) * (-693.923) (-690.064) [-689.330] (-691.066) -- 0:00:10
822500 -- (-690.763) [-690.401] (-696.901) (-692.528) * (-690.750) (-689.788) [-690.346] (-691.102) -- 0:00:10
823000 -- [-690.449] (-690.185) (-693.428) (-697.949) * (-689.516) (-689.354) (-690.093) [-692.575] -- 0:00:10
823500 -- (-691.214) [-690.007] (-691.226) (-691.492) * [-689.816] (-695.606) (-692.650) (-690.774) -- 0:00:10
824000 -- (-691.301) [-690.502] (-695.513) (-690.809) * [-692.917] (-690.962) (-690.584) (-690.622) -- 0:00:10
824500 -- (-689.692) (-690.630) (-692.699) [-691.381] * (-691.822) (-694.481) (-691.441) [-689.914] -- 0:00:10
825000 -- (-691.393) (-690.400) [-690.525] (-693.215) * (-691.909) (-689.517) (-692.694) [-691.340] -- 0:00:10
Average standard deviation of split frequencies: 0.009870
825500 -- [-690.379] (-691.392) (-690.932) (-689.831) * (-693.617) (-692.504) [-694.166] (-690.335) -- 0:00:10
826000 -- (-691.972) [-692.645] (-690.473) (-693.689) * (-692.061) [-689.672] (-690.818) (-689.870) -- 0:00:10
826500 -- (-691.275) (-693.222) [-691.622] (-690.045) * (-692.971) (-691.408) (-692.877) [-690.391] -- 0:00:10
827000 -- [-690.627] (-690.415) (-693.996) (-691.513) * (-690.888) [-691.701] (-691.934) (-693.481) -- 0:00:10
827500 -- [-691.585] (-691.389) (-693.007) (-689.772) * (-691.731) (-691.364) [-693.789] (-698.295) -- 0:00:10
828000 -- [-692.177] (-691.230) (-690.498) (-693.520) * (-689.328) (-689.862) (-693.591) [-691.752] -- 0:00:10
828500 -- [-691.761] (-692.030) (-694.859) (-690.701) * (-690.156) [-689.812] (-695.104) (-691.536) -- 0:00:10
829000 -- (-689.614) (-690.849) (-693.747) [-690.138] * (-689.960) (-691.481) [-691.261] (-695.212) -- 0:00:10
829500 -- (-689.792) (-693.110) (-691.025) [-689.881] * (-698.605) [-690.545] (-692.965) (-691.571) -- 0:00:10
830000 -- (-690.674) (-692.711) [-689.330] (-693.322) * (-691.228) (-690.054) [-690.494] (-694.309) -- 0:00:10
Average standard deviation of split frequencies: 0.009881
830500 -- [-689.755] (-690.995) (-689.604) (-695.374) * (-691.260) [-692.687] (-691.461) (-691.645) -- 0:00:10
831000 -- (-690.480) (-691.250) (-689.943) [-692.768] * [-690.061] (-695.135) (-690.830) (-696.344) -- 0:00:09
831500 -- (-690.792) (-692.816) [-691.918] (-692.157) * (-692.070) (-692.793) (-690.922) [-697.352] -- 0:00:09
832000 -- [-691.783] (-692.224) (-695.987) (-690.981) * (-691.272) [-691.854] (-689.857) (-691.175) -- 0:00:09
832500 -- (-692.955) [-689.406] (-691.292) (-691.410) * [-691.246] (-690.819) (-690.460) (-691.205) -- 0:00:10
833000 -- (-691.950) (-694.334) (-691.363) [-690.754] * (-694.495) (-690.108) [-690.900] (-691.723) -- 0:00:10
833500 -- (-690.847) (-691.986) (-689.643) [-691.943] * (-690.258) (-690.315) [-693.606] (-691.254) -- 0:00:09
834000 -- (-690.022) (-696.326) [-689.687] (-692.614) * (-690.633) (-691.416) [-689.923] (-690.076) -- 0:00:09
834500 -- (-689.017) (-692.536) [-690.023] (-690.330) * (-692.675) [-691.378] (-689.988) (-691.457) -- 0:00:09
835000 -- [-690.886] (-691.687) (-691.740) (-696.952) * (-689.677) (-692.251) [-692.166] (-692.603) -- 0:00:09
Average standard deviation of split frequencies: 0.009410
835500 -- (-690.419) (-690.466) (-691.295) [-690.637] * (-698.627) (-690.870) (-692.704) [-692.416] -- 0:00:09
836000 -- (-690.795) [-691.083] (-690.901) (-690.799) * (-690.510) (-690.197) [-690.527] (-694.516) -- 0:00:09
836500 -- (-690.463) (-691.877) (-689.983) [-692.921] * (-690.971) [-691.990] (-694.022) (-695.088) -- 0:00:09
837000 -- (-689.460) (-695.876) [-692.245] (-692.577) * (-694.223) [-689.282] (-689.463) (-694.209) -- 0:00:09
837500 -- [-689.279] (-695.984) (-692.184) (-689.306) * (-692.669) (-691.634) (-689.925) [-696.495] -- 0:00:09
838000 -- (-690.457) (-693.038) (-689.370) [-691.412] * (-692.029) (-695.351) [-689.451] (-700.203) -- 0:00:09
838500 -- (-692.582) (-692.408) [-692.719] (-691.233) * (-693.677) [-693.997] (-697.130) (-692.193) -- 0:00:09
839000 -- [-690.710] (-692.964) (-689.971) (-692.095) * (-690.772) (-693.180) [-691.849] (-690.116) -- 0:00:09
839500 -- [-691.803] (-691.668) (-690.648) (-691.498) * [-689.991] (-692.279) (-695.126) (-690.671) -- 0:00:09
840000 -- (-691.711) (-691.436) [-691.344] (-692.901) * (-696.212) [-690.681] (-690.018) (-689.564) -- 0:00:09
Average standard deviation of split frequencies: 0.008867
840500 -- (-690.324) [-690.931] (-693.081) (-693.560) * (-691.465) [-690.808] (-694.385) (-691.700) -- 0:00:09
841000 -- [-690.854] (-693.281) (-690.578) (-690.352) * [-692.677] (-689.874) (-698.841) (-690.773) -- 0:00:09
841500 -- (-691.933) [-689.835] (-690.805) (-690.958) * (-691.298) (-691.815) [-690.167] (-690.738) -- 0:00:09
842000 -- (-693.884) [-690.721] (-690.971) (-691.385) * [-691.346] (-691.485) (-694.400) (-688.948) -- 0:00:09
842500 -- [-690.941] (-690.874) (-690.249) (-693.649) * (-690.027) (-695.577) (-691.660) [-696.289] -- 0:00:09
843000 -- (-690.991) (-691.328) [-692.683] (-689.327) * (-690.280) (-690.114) [-689.676] (-692.949) -- 0:00:09
843500 -- (-692.018) [-692.025] (-692.794) (-689.809) * (-691.955) (-689.627) (-690.169) [-690.506] -- 0:00:09
844000 -- (-689.274) (-688.882) (-691.778) [-689.729] * (-692.617) (-689.526) [-692.861] (-689.710) -- 0:00:09
844500 -- (-692.387) (-691.275) [-693.151] (-689.441) * (-694.436) [-691.387] (-692.598) (-692.351) -- 0:00:09
845000 -- (-690.645) (-692.000) (-693.793) [-689.237] * (-695.124) (-690.333) [-693.289] (-690.331) -- 0:00:09
Average standard deviation of split frequencies: 0.009229
845500 -- (-689.966) (-689.659) [-691.466] (-689.719) * (-695.059) [-690.815] (-693.734) (-690.235) -- 0:00:09
846000 -- (-691.069) (-689.727) [-691.069] (-689.178) * (-692.447) (-692.115) [-695.024] (-693.326) -- 0:00:09
846500 -- [-690.986] (-689.825) (-693.205) (-690.599) * [-691.290] (-690.463) (-693.528) (-689.705) -- 0:00:09
847000 -- (-692.618) (-691.450) (-689.393) [-691.760] * (-690.409) (-692.178) (-692.343) [-692.809] -- 0:00:09
847500 -- (-690.865) (-689.755) (-689.831) [-690.412] * (-691.046) [-689.363] (-695.356) (-694.155) -- 0:00:09
848000 -- [-695.111] (-694.462) (-691.033) (-689.375) * (-691.796) (-689.165) (-695.615) [-692.588] -- 0:00:09
848500 -- (-690.069) [-692.917] (-690.753) (-690.049) * (-690.095) [-690.040] (-693.048) (-692.156) -- 0:00:09
849000 -- (-690.299) (-692.340) (-689.899) [-690.513] * (-689.825) [-693.331] (-690.823) (-689.800) -- 0:00:09
849500 -- (-689.737) [-691.352] (-693.063) (-691.805) * (-694.398) [-691.050] (-689.900) (-692.440) -- 0:00:09
850000 -- [-690.747] (-691.104) (-691.482) (-693.177) * (-693.529) (-696.947) [-689.575] (-691.102) -- 0:00:09
Average standard deviation of split frequencies: 0.009248
850500 -- (-690.847) (-692.488) [-690.139] (-690.457) * (-701.055) (-692.692) (-690.359) [-691.489] -- 0:00:08
851000 -- (-690.062) (-691.689) [-695.221] (-689.885) * (-693.886) [-694.724] (-691.301) (-690.607) -- 0:00:08
851500 -- (-690.586) (-689.936) [-691.790] (-692.864) * (-694.208) (-693.864) [-691.686] (-693.698) -- 0:00:08
852000 -- (-690.377) (-696.910) (-691.428) [-691.946] * (-694.194) (-689.263) (-692.352) [-690.168] -- 0:00:08
852500 -- (-693.137) (-691.693) [-690.636] (-691.249) * [-689.661] (-689.847) (-690.715) (-690.957) -- 0:00:08
853000 -- (-691.199) (-689.810) (-691.738) [-696.526] * [-691.399] (-689.571) (-689.654) (-693.481) -- 0:00:08
853500 -- (-696.129) (-692.642) (-689.597) [-693.069] * (-693.029) [-690.621] (-691.084) (-692.806) -- 0:00:08
854000 -- (-690.121) (-693.077) (-689.397) [-690.545] * (-693.275) (-691.780) (-691.171) [-690.916] -- 0:00:08
854500 -- (-690.248) (-693.263) (-691.025) [-692.010] * (-690.551) (-689.958) (-690.745) [-691.067] -- 0:00:08
855000 -- [-690.962] (-692.062) (-689.206) (-690.184) * (-690.777) (-689.330) (-690.527) [-690.718] -- 0:00:08
Average standard deviation of split frequencies: 0.009362
855500 -- (-690.145) [-690.801] (-689.799) (-693.633) * (-691.450) [-689.118] (-692.858) (-691.649) -- 0:00:08
856000 -- (-691.877) (-689.154) (-690.105) [-696.006] * (-690.330) (-690.608) [-691.537] (-690.708) -- 0:00:08
856500 -- (-690.625) (-694.042) [-690.106] (-690.606) * (-689.984) [-689.168] (-693.420) (-689.407) -- 0:00:08
857000 -- (-694.920) [-692.879] (-690.935) (-693.262) * (-691.598) (-689.615) [-691.401] (-690.740) -- 0:00:08
857500 -- (-693.551) (-692.057) [-694.236] (-690.608) * [-691.460] (-689.611) (-691.084) (-692.828) -- 0:00:08
858000 -- (-696.504) (-691.866) (-695.527) [-690.521] * (-691.330) [-691.216] (-691.501) (-693.791) -- 0:00:08
858500 -- (-692.686) (-690.973) (-695.752) [-690.555] * (-691.450) (-691.946) [-690.985] (-693.526) -- 0:00:08
859000 -- (-695.287) (-692.812) [-693.615] (-689.198) * (-689.983) (-691.575) (-690.230) [-690.273] -- 0:00:08
859500 -- (-692.479) [-692.950] (-692.611) (-691.071) * (-689.891) (-691.147) [-692.300] (-693.057) -- 0:00:08
860000 -- (-690.733) (-691.819) (-690.455) [-698.853] * (-693.456) (-689.643) [-691.347] (-694.930) -- 0:00:08
Average standard deviation of split frequencies: 0.009345
860500 -- (-690.641) [-690.465] (-690.705) (-690.524) * (-691.745) (-693.371) (-692.116) [-696.857] -- 0:00:08
861000 -- [-691.240] (-689.642) (-693.030) (-690.871) * (-689.787) (-690.959) [-689.796] (-691.737) -- 0:00:08
861500 -- (-694.674) [-692.062] (-690.238) (-691.299) * [-690.494] (-690.984) (-692.349) (-694.438) -- 0:00:08
862000 -- (-690.171) (-690.833) [-690.117] (-690.897) * [-690.441] (-690.541) (-692.834) (-694.533) -- 0:00:08
862500 -- (-692.939) (-694.489) (-695.387) [-692.080] * [-691.200] (-689.830) (-693.517) (-694.323) -- 0:00:08
863000 -- (-690.468) (-692.408) (-692.089) [-691.291] * (-691.974) [-690.860] (-689.661) (-694.431) -- 0:00:08
863500 -- (-694.221) [-692.370] (-690.583) (-690.345) * (-691.741) [-692.267] (-691.484) (-696.218) -- 0:00:08
864000 -- [-692.353] (-690.415) (-690.044) (-689.727) * (-689.643) (-690.898) (-693.460) [-690.856] -- 0:00:08
864500 -- (-690.605) [-689.256] (-691.223) (-689.725) * (-689.215) (-692.382) (-689.557) [-690.818] -- 0:00:08
865000 -- (-692.626) (-689.903) (-693.092) [-689.316] * (-690.986) [-694.074] (-697.268) (-692.025) -- 0:00:08
Average standard deviation of split frequencies: 0.009050
865500 -- (-692.818) (-690.491) [-693.214] (-689.789) * (-692.808) (-691.498) (-691.995) [-692.234] -- 0:00:08
866000 -- (-690.983) [-691.305] (-690.751) (-691.209) * [-693.091] (-691.156) (-690.168) (-689.246) -- 0:00:08
866500 -- (-691.085) (-693.261) (-690.466) [-690.148] * (-693.575) (-698.346) [-692.100] (-692.389) -- 0:00:08
867000 -- (-692.583) (-695.218) [-691.331] (-691.761) * (-692.710) (-690.440) (-691.109) [-692.294] -- 0:00:07
867500 -- (-691.735) [-689.679] (-694.883) (-691.502) * (-691.704) (-689.130) [-695.250] (-693.331) -- 0:00:07
868000 -- [-692.531] (-691.401) (-693.514) (-690.598) * (-694.310) (-688.916) (-700.843) [-693.175] -- 0:00:07
868500 -- (-690.009) [-692.472] (-692.125) (-694.618) * [-690.853] (-692.314) (-694.962) (-693.752) -- 0:00:07
869000 -- (-692.321) (-689.773) (-691.352) [-691.122] * (-689.587) [-692.168] (-691.775) (-692.181) -- 0:00:07
869500 -- (-690.191) [-689.247] (-690.604) (-689.233) * (-690.557) (-690.602) [-691.814] (-689.534) -- 0:00:07
870000 -- (-690.854) [-690.994] (-689.793) (-689.048) * (-692.323) (-692.112) [-689.986] (-690.181) -- 0:00:07
Average standard deviation of split frequencies: 0.008494
870500 -- (-691.909) [-689.476] (-694.482) (-692.499) * [-693.106] (-689.679) (-690.608) (-689.514) -- 0:00:07
871000 -- [-691.144] (-689.637) (-698.035) (-692.494) * (-692.370) (-691.010) [-691.043] (-692.401) -- 0:00:07
871500 -- (-690.793) [-691.848] (-694.742) (-690.949) * (-689.764) (-692.196) (-690.531) [-694.084] -- 0:00:07
872000 -- (-695.642) (-694.345) (-690.109) [-689.444] * [-690.954] (-691.533) (-689.908) (-690.926) -- 0:00:07
872500 -- [-691.057] (-690.865) (-691.197) (-690.121) * (-690.829) [-693.145] (-689.656) (-690.824) -- 0:00:07
873000 -- (-691.455) [-690.289] (-691.445) (-692.799) * [-693.250] (-692.990) (-690.539) (-691.800) -- 0:00:07
873500 -- (-690.576) [-689.780] (-689.463) (-691.566) * (-690.007) [-692.224] (-689.552) (-689.366) -- 0:00:07
874000 -- (-696.457) (-690.693) [-690.286] (-692.314) * (-690.816) (-690.046) [-690.682] (-699.719) -- 0:00:07
874500 -- (-691.308) (-690.280) [-690.158] (-690.458) * [-691.430] (-690.894) (-692.531) (-694.835) -- 0:00:07
875000 -- [-691.391] (-692.452) (-692.398) (-691.971) * (-691.810) (-690.432) [-689.653] (-693.881) -- 0:00:07
Average standard deviation of split frequencies: 0.008408
875500 -- [-691.823] (-690.667) (-697.390) (-692.892) * (-691.807) [-693.450] (-693.521) (-690.756) -- 0:00:07
876000 -- (-692.484) (-690.545) [-692.737] (-692.986) * (-690.854) [-690.392] (-691.576) (-694.298) -- 0:00:07
876500 -- (-691.807) (-689.820) [-690.417] (-691.836) * (-689.264) [-690.599] (-690.169) (-692.138) -- 0:00:07
877000 -- (-689.667) (-691.097) (-689.075) [-692.218] * (-691.613) (-691.872) [-692.022] (-692.455) -- 0:00:07
877500 -- (-694.456) [-691.059] (-690.134) (-691.597) * (-694.644) (-691.470) [-690.938] (-690.431) -- 0:00:07
878000 -- [-691.648] (-691.749) (-692.435) (-690.795) * (-693.699) (-697.722) [-691.393] (-693.518) -- 0:00:07
878500 -- [-692.367] (-692.102) (-692.183) (-695.107) * (-690.000) (-692.224) [-689.991] (-689.767) -- 0:00:07
879000 -- (-691.496) (-691.551) (-695.546) [-695.107] * (-689.307) [-690.334] (-691.230) (-691.234) -- 0:00:07
879500 -- [-692.961] (-690.123) (-692.547) (-689.459) * (-690.650) [-692.074] (-693.270) (-691.357) -- 0:00:07
880000 -- (-691.419) (-690.337) (-691.311) [-689.451] * (-692.520) (-689.803) [-694.804] (-691.117) -- 0:00:07
Average standard deviation of split frequencies: 0.008196
880500 -- [-689.880] (-690.569) (-689.887) (-694.797) * (-692.775) [-690.365] (-691.293) (-691.129) -- 0:00:07
881000 -- (-692.058) [-690.162] (-690.871) (-692.562) * (-690.867) (-689.660) [-689.844] (-692.966) -- 0:00:07
881500 -- (-693.497) (-689.255) [-692.542] (-692.868) * [-689.622] (-690.862) (-689.761) (-694.948) -- 0:00:07
882000 -- (-691.205) [-689.183] (-690.323) (-691.518) * (-690.147) (-692.922) [-689.463] (-692.675) -- 0:00:07
882500 -- (-690.308) [-690.829] (-690.027) (-693.073) * (-690.621) (-693.488) [-689.464] (-695.408) -- 0:00:07
883000 -- [-691.174] (-690.571) (-693.188) (-695.102) * (-690.339) (-689.071) [-689.460] (-693.402) -- 0:00:07
883500 -- (-690.494) (-689.465) [-689.434] (-693.663) * (-689.247) (-689.174) [-689.675] (-691.850) -- 0:00:06
884000 -- (-691.106) (-690.982) [-690.647] (-690.488) * (-689.430) [-689.535] (-691.120) (-691.940) -- 0:00:06
884500 -- [-689.983] (-691.889) (-691.184) (-691.768) * (-689.831) [-690.517] (-691.921) (-692.044) -- 0:00:06
885000 -- [-691.164] (-695.203) (-689.992) (-692.328) * (-692.046) (-690.540) (-692.446) [-691.891] -- 0:00:06
Average standard deviation of split frequencies: 0.008114
885500 -- [-689.599] (-693.612) (-691.512) (-695.512) * (-690.377) [-694.191] (-696.449) (-699.102) -- 0:00:06
886000 -- (-690.129) (-690.804) (-695.531) [-690.663] * (-690.854) (-691.469) (-692.937) [-693.278] -- 0:00:06
886500 -- (-690.284) (-692.336) [-692.575] (-694.549) * (-692.475) [-693.866] (-691.167) (-693.297) -- 0:00:06
887000 -- [-689.027] (-695.671) (-692.486) (-691.049) * (-692.298) [-690.582] (-692.172) (-695.299) -- 0:00:06
887500 -- (-690.426) (-692.535) [-691.441] (-691.959) * (-690.234) [-690.648] (-692.111) (-692.031) -- 0:00:06
888000 -- [-691.094] (-691.733) (-691.099) (-691.622) * [-693.119] (-691.719) (-693.131) (-693.026) -- 0:00:06
888500 -- (-691.246) [-690.174] (-690.947) (-690.847) * (-693.451) (-692.418) (-690.349) [-689.487] -- 0:00:06
889000 -- (-691.080) (-689.958) [-690.138] (-689.979) * [-690.268] (-690.847) (-694.527) (-690.128) -- 0:00:06
889500 -- (-691.988) (-689.955) [-692.119] (-689.648) * (-689.548) [-690.117] (-692.781) (-689.972) -- 0:00:06
890000 -- (-689.966) (-689.583) [-693.485] (-692.927) * (-689.210) (-689.666) (-695.372) [-692.463] -- 0:00:06
Average standard deviation of split frequencies: 0.008237
890500 -- [-689.872] (-697.172) (-692.575) (-692.720) * (-691.489) (-691.462) (-693.481) [-689.677] -- 0:00:06
891000 -- (-690.836) (-692.224) (-690.646) [-689.684] * [-689.931] (-694.843) (-693.008) (-689.328) -- 0:00:06
891500 -- [-690.681] (-692.410) (-690.743) (-690.093) * (-696.022) (-694.724) (-689.744) [-689.032] -- 0:00:06
892000 -- (-693.189) [-689.692] (-692.766) (-691.712) * (-691.613) (-691.283) (-691.507) [-693.475] -- 0:00:06
892500 -- (-693.687) (-690.569) [-691.562] (-690.057) * (-694.091) (-690.827) [-691.120] (-692.992) -- 0:00:06
893000 -- [-690.470] (-689.885) (-692.894) (-690.468) * (-691.423) (-690.675) (-689.499) [-690.907] -- 0:00:06
893500 -- (-691.789) [-689.876] (-692.547) (-690.468) * (-692.982) [-691.313] (-689.431) (-694.211) -- 0:00:06
894000 -- (-691.938) (-696.501) [-692.358] (-690.346) * (-694.538) [-691.664] (-692.257) (-692.610) -- 0:00:06
894500 -- (-689.427) (-696.795) [-690.733] (-690.977) * (-691.922) (-693.737) (-690.809) [-695.662] -- 0:00:06
895000 -- (-690.108) [-690.377] (-689.738) (-690.043) * (-692.616) (-691.639) (-690.485) [-697.817] -- 0:00:06
Average standard deviation of split frequencies: 0.008418
895500 -- (-690.546) (-693.236) [-689.470] (-692.290) * (-692.887) (-691.388) (-693.524) [-689.983] -- 0:00:06
896000 -- (-691.800) (-693.084) [-688.975] (-689.279) * (-693.351) (-690.810) (-693.899) [-689.584] -- 0:00:06
896500 -- (-690.651) [-690.224] (-689.174) (-691.169) * (-693.590) (-690.917) (-691.278) [-689.587] -- 0:00:06
897000 -- (-690.578) [-692.330] (-690.509) (-690.222) * (-692.266) (-692.947) (-699.132) [-689.648] -- 0:00:06
897500 -- (-690.574) (-690.513) (-692.638) [-693.977] * (-689.315) (-691.417) (-694.396) [-690.128] -- 0:00:06
898000 -- (-691.735) [-690.109] (-692.963) (-691.982) * (-691.946) [-689.852] (-693.733) (-689.901) -- 0:00:06
898500 -- (-692.146) (-692.659) (-689.378) [-692.141] * (-690.652) (-693.397) [-691.995] (-693.727) -- 0:00:06
899000 -- (-693.267) (-693.810) [-691.026] (-694.792) * [-690.966] (-691.359) (-690.459) (-696.853) -- 0:00:06
899500 -- (-691.473) [-696.396] (-693.872) (-692.632) * [-692.807] (-690.259) (-692.968) (-689.932) -- 0:00:06
900000 -- [-691.103] (-691.125) (-693.817) (-693.697) * [-689.652] (-691.955) (-690.816) (-689.909) -- 0:00:06
Average standard deviation of split frequencies: 0.008276
900500 -- (-691.724) [-694.407] (-692.377) (-693.249) * (-689.703) (-693.068) (-691.429) [-691.174] -- 0:00:05
901000 -- (-689.748) (-694.193) (-691.793) [-690.932] * [-690.141] (-692.912) (-690.859) (-691.536) -- 0:00:05
901500 -- [-689.504] (-689.955) (-691.293) (-690.562) * (-688.875) (-692.047) (-690.824) [-690.245] -- 0:00:05
902000 -- (-690.494) (-692.648) (-691.135) [-690.397] * (-689.798) [-692.142] (-691.863) (-694.063) -- 0:00:05
902500 -- (-691.067) (-692.268) (-692.192) [-691.090] * (-693.366) [-689.871] (-694.052) (-696.373) -- 0:00:05
903000 -- (-691.270) (-689.783) [-689.611] (-689.316) * (-690.733) [-691.068] (-694.096) (-690.843) -- 0:00:05
903500 -- (-691.963) [-694.324] (-691.674) (-694.947) * (-690.348) (-692.700) [-690.708] (-691.291) -- 0:00:05
904000 -- (-692.570) [-692.514] (-692.295) (-689.685) * [-692.937] (-691.290) (-693.585) (-692.517) -- 0:00:05
904500 -- (-691.246) (-690.557) (-693.556) [-689.583] * (-690.340) (-692.552) (-690.708) [-691.868] -- 0:00:05
905000 -- (-691.218) [-690.124] (-690.117) (-695.546) * [-689.928] (-692.668) (-694.169) (-690.565) -- 0:00:05
Average standard deviation of split frequencies: 0.008097
905500 -- (-691.318) [-692.919] (-693.606) (-692.799) * [-690.540] (-691.730) (-692.708) (-690.796) -- 0:00:05
906000 -- (-693.239) (-695.117) (-693.041) [-690.894] * (-692.032) (-693.938) (-690.638) [-692.029] -- 0:00:05
906500 -- (-695.932) [-691.946] (-691.437) (-696.143) * (-696.465) (-697.093) [-689.925] (-691.446) -- 0:00:05
907000 -- [-689.798] (-690.462) (-689.389) (-694.181) * (-693.532) (-691.143) [-689.793] (-691.872) -- 0:00:05
907500 -- (-690.633) [-692.254] (-693.650) (-692.740) * [-692.122] (-694.026) (-692.494) (-694.036) -- 0:00:05
908000 -- (-690.166) (-690.439) (-692.099) [-690.022] * (-695.488) (-690.778) (-689.872) [-689.970] -- 0:00:05
908500 -- (-695.054) (-690.810) (-690.324) [-691.482] * [-692.692] (-691.346) (-694.700) (-693.032) -- 0:00:05
909000 -- (-689.864) (-690.593) (-691.453) [-690.974] * (-692.256) [-691.060] (-693.613) (-689.220) -- 0:00:05
909500 -- (-695.321) [-690.566] (-690.779) (-693.455) * (-694.016) (-691.373) (-694.113) [-692.522] -- 0:00:05
910000 -- (-690.790) [-692.218] (-692.860) (-690.456) * [-694.569] (-691.540) (-689.126) (-689.516) -- 0:00:05
Average standard deviation of split frequencies: 0.007991
910500 -- (-689.534) (-691.297) [-693.515] (-689.348) * (-694.351) [-691.864] (-690.264) (-692.069) -- 0:00:05
911000 -- (-691.261) [-690.223] (-692.148) (-690.079) * [-692.068] (-690.914) (-691.483) (-691.221) -- 0:00:05
911500 -- (-689.595) (-690.375) (-690.564) [-690.690] * [-692.445] (-691.491) (-691.451) (-696.459) -- 0:00:05
912000 -- (-692.894) (-693.231) [-690.508] (-692.419) * (-692.321) (-694.525) [-691.096] (-696.698) -- 0:00:05
912500 -- (-690.044) (-691.305) (-690.134) [-693.606] * (-691.889) (-692.036) [-691.730] (-693.698) -- 0:00:05
913000 -- [-693.288] (-690.528) (-691.509) (-695.071) * (-694.125) (-689.234) [-691.001] (-695.199) -- 0:00:05
913500 -- (-691.137) [-690.018] (-691.506) (-694.731) * (-692.932) (-691.303) [-690.957] (-689.778) -- 0:00:05
914000 -- [-690.033] (-690.840) (-696.023) (-693.178) * [-689.094] (-690.339) (-692.253) (-690.608) -- 0:00:05
914500 -- (-689.493) [-692.673] (-693.143) (-690.890) * [-689.577] (-691.819) (-690.803) (-689.581) -- 0:00:05
915000 -- (-692.181) [-695.025] (-693.344) (-691.659) * (-689.648) [-691.727] (-691.375) (-690.742) -- 0:00:05
Average standard deviation of split frequencies: 0.008138
915500 -- [-691.625] (-692.722) (-694.089) (-695.441) * (-691.903) (-691.813) (-691.842) [-692.397] -- 0:00:05
916000 -- [-691.343] (-693.150) (-690.489) (-689.989) * (-690.407) (-692.632) [-691.907] (-692.367) -- 0:00:05
916500 -- (-689.960) (-692.028) [-689.795] (-692.088) * (-689.723) [-692.685] (-691.216) (-693.412) -- 0:00:05
917000 -- [-689.730] (-692.107) (-692.577) (-690.548) * (-690.739) (-692.110) [-693.183] (-689.432) -- 0:00:04
917500 -- (-689.481) (-693.923) (-690.686) [-689.837] * (-692.501) [-691.447] (-692.016) (-689.395) -- 0:00:04
918000 -- (-690.090) [-690.341] (-691.798) (-690.775) * [-689.508] (-692.751) (-689.693) (-690.287) -- 0:00:04
918500 -- (-690.205) (-691.713) [-689.819] (-689.764) * (-690.667) [-689.202] (-693.844) (-691.996) -- 0:00:04
919000 -- (-693.201) (-693.091) (-690.010) [-692.827] * (-690.152) [-691.747] (-689.635) (-692.877) -- 0:00:04
919500 -- (-693.059) [-689.925] (-689.649) (-693.203) * [-690.400] (-689.623) (-693.561) (-691.342) -- 0:00:04
920000 -- (-692.651) (-690.358) (-690.757) [-693.102] * (-690.211) (-690.090) (-692.054) [-692.744] -- 0:00:04
Average standard deviation of split frequencies: 0.008128
920500 -- (-693.696) [-693.318] (-689.992) (-690.802) * (-689.866) [-691.956] (-693.360) (-690.955) -- 0:00:04
921000 -- (-691.418) (-691.513) [-690.997] (-690.094) * (-693.707) (-690.076) (-692.669) [-690.610] -- 0:00:04
921500 -- (-692.480) [-691.360] (-692.190) (-691.348) * (-693.223) [-690.793] (-690.479) (-692.399) -- 0:00:04
922000 -- (-690.784) (-691.150) (-690.599) [-692.749] * (-691.971) (-697.021) (-689.593) [-689.134] -- 0:00:04
922500 -- (-690.134) (-690.579) [-690.622] (-690.240) * [-691.618] (-692.135) (-691.747) (-693.148) -- 0:00:04
923000 -- (-691.386) (-691.938) (-693.037) [-689.446] * (-691.995) (-689.909) (-692.324) [-693.355] -- 0:00:04
923500 -- [-689.128] (-692.236) (-689.132) (-690.341) * (-690.335) [-691.145] (-692.526) (-692.167) -- 0:00:04
924000 -- [-691.120] (-691.442) (-689.085) (-692.912) * (-691.616) [-693.620] (-689.288) (-693.719) -- 0:00:04
924500 -- (-690.484) (-692.941) (-690.624) [-695.460] * (-691.070) (-692.745) [-689.821] (-689.538) -- 0:00:04
925000 -- (-690.187) (-691.057) [-691.554] (-692.045) * (-692.780) (-692.903) [-689.907] (-694.850) -- 0:00:04
Average standard deviation of split frequencies: 0.008050
925500 -- [-690.812] (-691.141) (-689.291) (-691.838) * (-690.749) (-693.824) [-690.009] (-690.671) -- 0:00:04
926000 -- (-692.125) [-690.565] (-691.412) (-691.859) * (-693.740) (-691.391) (-690.773) [-689.500] -- 0:00:04
926500 -- [-690.898] (-689.866) (-692.099) (-689.849) * (-694.458) [-692.379] (-690.211) (-689.811) -- 0:00:04
927000 -- (-690.873) [-693.083] (-690.195) (-689.722) * [-689.567] (-691.856) (-691.701) (-689.287) -- 0:00:04
927500 -- (-690.019) (-690.358) [-689.970] (-690.745) * (-691.244) (-693.968) [-692.635] (-691.101) -- 0:00:04
928000 -- (-689.717) (-691.530) [-690.200] (-689.902) * [-691.313] (-691.902) (-691.429) (-693.883) -- 0:00:04
928500 -- (-693.044) (-690.843) [-691.129] (-689.428) * (-696.232) (-690.397) [-690.387] (-692.747) -- 0:00:04
929000 -- (-694.326) [-691.558] (-689.448) (-689.414) * (-693.346) (-693.340) (-691.660) [-690.070] -- 0:00:04
929500 -- (-693.637) (-691.790) (-690.337) [-690.537] * [-691.964] (-693.565) (-698.812) (-694.299) -- 0:00:04
930000 -- (-690.906) (-691.428) (-692.442) [-691.683] * (-690.143) (-695.527) [-691.728] (-692.683) -- 0:00:04
Average standard deviation of split frequencies: 0.008041
930500 -- [-692.143] (-691.388) (-692.292) (-694.550) * (-689.450) [-689.892] (-693.223) (-689.770) -- 0:00:04
931000 -- (-697.423) (-689.650) [-690.707] (-692.844) * (-691.642) (-689.662) [-689.996] (-691.289) -- 0:00:04
931500 -- (-692.509) (-689.489) (-689.784) [-691.355] * (-691.828) (-689.822) [-689.887] (-693.663) -- 0:00:04
932000 -- (-689.957) (-689.620) (-689.354) [-690.708] * [-689.639] (-689.649) (-694.280) (-696.658) -- 0:00:04
932500 -- (-690.756) (-688.993) [-690.154] (-691.650) * (-692.295) [-689.731] (-694.853) (-690.452) -- 0:00:04
933000 -- [-689.533] (-689.728) (-691.109) (-690.186) * (-690.496) (-689.527) (-689.939) [-690.891] -- 0:00:04
933500 -- (-689.579) [-690.031] (-690.020) (-692.889) * (-701.863) (-692.272) [-690.457] (-694.037) -- 0:00:03
934000 -- (-690.057) [-690.449] (-690.410) (-690.801) * [-691.535] (-690.668) (-690.314) (-691.665) -- 0:00:03
934500 -- [-691.292] (-690.540) (-692.272) (-690.524) * (-693.401) (-689.919) (-693.650) [-692.253] -- 0:00:03
935000 -- [-690.518] (-692.656) (-694.485) (-689.649) * (-693.056) (-689.753) (-693.759) [-689.668] -- 0:00:03
Average standard deviation of split frequencies: 0.008216
935500 -- (-690.028) [-692.782] (-691.125) (-691.915) * (-691.219) (-691.039) [-695.312] (-690.923) -- 0:00:03
936000 -- [-691.778] (-692.258) (-691.145) (-690.660) * (-690.357) (-692.684) (-697.060) [-690.027] -- 0:00:03
936500 -- [-692.301] (-694.184) (-689.885) (-692.360) * (-701.794) (-692.397) (-691.420) [-692.596] -- 0:00:03
937000 -- [-694.873] (-696.893) (-689.678) (-689.596) * [-690.006] (-691.163) (-691.045) (-692.591) -- 0:00:03
937500 -- [-691.907] (-693.080) (-691.035) (-690.324) * (-695.956) [-689.418] (-693.362) (-692.135) -- 0:00:03
938000 -- (-689.951) [-691.776] (-689.984) (-693.017) * (-694.235) (-690.110) (-690.439) [-689.063] -- 0:00:03
938500 -- (-690.344) (-691.551) (-693.155) [-694.117] * [-696.860] (-691.153) (-690.698) (-691.539) -- 0:00:03
939000 -- (-689.614) (-693.068) (-695.184) [-692.840] * (-690.491) (-690.944) [-692.804] (-691.518) -- 0:00:03
939500 -- [-691.327] (-692.476) (-693.475) (-693.138) * (-691.046) (-691.710) [-691.185] (-695.058) -- 0:00:03
940000 -- (-691.526) (-690.878) (-694.700) [-690.887] * (-693.964) [-690.822] (-689.665) (-693.438) -- 0:00:03
Average standard deviation of split frequencies: 0.008488
940500 -- (-689.989) [-690.096] (-692.574) (-691.747) * (-691.052) [-691.832] (-691.818) (-694.941) -- 0:00:03
941000 -- [-691.718] (-689.579) (-692.545) (-690.820) * (-692.844) [-691.429] (-692.825) (-690.208) -- 0:00:03
941500 -- (-689.637) (-689.401) (-692.260) [-695.530] * [-690.613] (-691.422) (-693.658) (-691.717) -- 0:00:03
942000 -- (-690.877) (-689.380) (-692.040) [-695.033] * (-690.001) (-691.150) [-690.742] (-690.872) -- 0:00:03
942500 -- (-690.146) (-690.452) (-690.617) [-689.361] * (-690.141) [-691.092] (-700.936) (-692.411) -- 0:00:03
943000 -- (-690.175) [-691.142] (-691.678) (-693.259) * (-690.483) [-689.907] (-693.066) (-689.934) -- 0:00:03
943500 -- [-691.775] (-690.105) (-689.820) (-694.293) * [-690.546] (-691.831) (-690.020) (-692.273) -- 0:00:03
944000 -- [-692.625] (-691.085) (-690.282) (-689.847) * [-689.644] (-694.611) (-691.267) (-693.372) -- 0:00:03
944500 -- (-692.787) (-690.189) [-692.090] (-692.251) * (-694.569) (-699.332) (-690.776) [-691.595] -- 0:00:03
945000 -- (-692.082) [-691.296] (-690.020) (-689.035) * [-692.782] (-690.818) (-691.324) (-692.320) -- 0:00:03
Average standard deviation of split frequencies: 0.008191
945500 -- (-697.590) (-691.073) (-689.582) [-691.610] * [-692.342] (-692.355) (-692.510) (-692.375) -- 0:00:03
946000 -- (-691.846) (-690.287) [-691.167] (-690.050) * [-689.976] (-694.170) (-692.857) (-690.845) -- 0:00:03
946500 -- (-695.253) [-690.010] (-690.749) (-689.828) * (-690.418) [-694.001] (-694.039) (-691.469) -- 0:00:03
947000 -- (-693.618) (-690.550) (-690.838) [-691.333] * (-693.820) (-689.488) [-693.283] (-690.646) -- 0:00:03
947500 -- [-690.324] (-691.302) (-692.415) (-693.769) * [-689.644] (-690.016) (-703.076) (-691.654) -- 0:00:03
948000 -- (-694.285) (-690.924) (-694.581) [-691.638] * (-690.875) (-693.399) [-695.600] (-690.228) -- 0:00:03
948500 -- [-693.446] (-693.038) (-693.961) (-691.545) * (-691.597) (-696.663) [-691.368] (-691.955) -- 0:00:03
949000 -- (-692.880) (-690.603) (-692.485) [-692.005] * (-689.169) (-690.186) [-691.335] (-690.277) -- 0:00:03
949500 -- (-689.892) [-690.904] (-694.134) (-690.034) * (-689.386) (-689.678) (-690.012) [-689.990] -- 0:00:03
950000 -- (-691.677) [-690.609] (-691.635) (-691.906) * (-688.970) (-689.988) [-691.470] (-692.853) -- 0:00:03
Average standard deviation of split frequencies: 0.008523
950500 -- [-691.948] (-689.752) (-697.938) (-692.586) * (-693.336) (-689.355) (-692.221) [-694.017] -- 0:00:02
951000 -- [-694.060] (-694.030) (-690.038) (-694.327) * (-691.924) [-690.210] (-690.428) (-694.356) -- 0:00:02
951500 -- [-690.631] (-692.307) (-693.261) (-697.735) * (-692.611) (-697.277) [-690.094] (-690.836) -- 0:00:02
952000 -- (-693.723) (-692.210) [-690.063] (-697.349) * [-690.323] (-689.959) (-691.044) (-698.014) -- 0:00:02
952500 -- [-690.898] (-693.154) (-695.413) (-691.714) * (-691.964) [-691.636] (-691.524) (-695.915) -- 0:00:02
953000 -- (-692.921) (-691.625) (-691.704) [-689.506] * [-690.618] (-690.715) (-691.037) (-695.484) -- 0:00:02
953500 -- (-690.417) [-694.156] (-692.526) (-692.939) * (-690.193) (-690.795) (-691.738) [-690.080] -- 0:00:02
954000 -- [-691.333] (-691.206) (-689.433) (-693.129) * [-691.664] (-692.255) (-690.689) (-692.154) -- 0:00:02
954500 -- (-690.169) (-689.415) [-691.062] (-690.726) * (-689.594) [-691.291] (-689.605) (-691.379) -- 0:00:02
955000 -- (-690.466) [-689.812] (-693.412) (-691.676) * (-692.110) [-690.282] (-691.679) (-692.859) -- 0:00:02
Average standard deviation of split frequencies: 0.008475
955500 -- [-690.135] (-689.656) (-693.109) (-689.272) * [-691.755] (-691.019) (-690.562) (-693.044) -- 0:00:02
956000 -- [-690.748] (-693.962) (-690.906) (-690.359) * [-690.669] (-691.007) (-690.676) (-691.160) -- 0:00:02
956500 -- [-690.967] (-694.347) (-690.978) (-690.853) * (-694.137) [-691.673] (-689.900) (-691.245) -- 0:00:02
957000 -- (-694.217) [-694.420] (-694.001) (-691.080) * (-692.470) [-692.509] (-690.239) (-694.357) -- 0:00:02
957500 -- (-690.171) (-695.008) (-690.925) [-689.895] * [-693.685] (-693.892) (-692.515) (-690.552) -- 0:00:02
958000 -- (-691.937) (-695.015) (-691.450) [-691.657] * [-690.296] (-693.452) (-690.306) (-691.573) -- 0:00:02
958500 -- (-689.844) [-693.702] (-692.408) (-692.898) * (-689.553) (-692.313) (-690.107) [-691.145] -- 0:00:02
959000 -- (-692.507) [-692.517] (-690.499) (-691.596) * (-689.732) (-693.240) [-690.304] (-690.391) -- 0:00:02
959500 -- (-692.725) (-690.528) (-692.656) [-690.383] * [-691.340] (-695.706) (-689.881) (-690.773) -- 0:00:02
960000 -- (-691.704) [-690.638] (-692.170) (-691.303) * [-689.739] (-690.795) (-690.606) (-691.486) -- 0:00:02
Average standard deviation of split frequencies: 0.008587
960500 -- [-692.372] (-690.156) (-694.969) (-690.881) * (-691.293) (-690.823) [-692.886] (-690.035) -- 0:00:02
961000 -- (-691.295) (-691.343) (-691.316) [-690.808] * [-689.744] (-692.001) (-692.809) (-690.654) -- 0:00:02
961500 -- (-693.567) [-692.959] (-694.503) (-690.010) * (-692.576) (-695.724) [-692.424] (-689.899) -- 0:00:02
962000 -- [-691.392] (-692.518) (-692.443) (-691.471) * (-694.931) (-690.424) (-689.719) [-690.953] -- 0:00:02
962500 -- (-690.337) (-693.267) [-693.136] (-690.164) * (-689.758) [-689.130] (-693.477) (-691.566) -- 0:00:02
963000 -- (-691.468) (-694.904) [-691.504] (-693.025) * (-691.843) (-689.430) (-691.947) [-690.793] -- 0:00:02
963500 -- [-692.011] (-690.286) (-697.048) (-689.842) * (-691.817) [-690.314] (-691.465) (-691.539) -- 0:00:02
964000 -- (-689.982) (-694.094) (-691.152) [-689.745] * [-693.415] (-690.428) (-691.858) (-690.938) -- 0:00:02
964500 -- (-689.584) [-690.347] (-693.625) (-690.684) * (-689.423) (-690.925) [-689.896] (-689.533) -- 0:00:02
965000 -- (-690.697) [-690.335] (-689.090) (-690.201) * [-690.260] (-693.337) (-689.361) (-690.687) -- 0:00:02
Average standard deviation of split frequencies: 0.008540
965500 -- (-695.194) [-691.726] (-689.377) (-690.872) * (-689.254) [-690.313] (-691.652) (-689.066) -- 0:00:02
966000 -- (-696.926) (-690.415) (-689.601) [-690.997] * (-689.245) (-693.085) (-691.836) [-689.124] -- 0:00:02
966500 -- [-694.113] (-691.640) (-689.979) (-689.985) * (-689.275) [-693.734] (-693.593) (-690.361) -- 0:00:02
967000 -- (-690.283) (-690.837) [-688.969] (-691.862) * [-690.422] (-693.862) (-691.663) (-691.499) -- 0:00:01
967500 -- (-690.934) [-690.202] (-690.138) (-689.873) * (-695.549) (-692.841) (-691.914) [-692.478] -- 0:00:01
968000 -- [-689.329] (-691.212) (-690.370) (-691.035) * (-697.901) [-692.789] (-692.458) (-694.763) -- 0:00:01
968500 -- (-689.671) [-690.875] (-689.466) (-691.441) * (-694.571) (-693.168) [-689.104] (-689.472) -- 0:00:01
969000 -- (-691.116) (-690.525) (-693.929) [-690.507] * [-692.753] (-692.934) (-691.575) (-690.485) -- 0:00:01
969500 -- (-690.264) [-691.808] (-690.020) (-700.830) * (-690.212) [-690.333] (-690.627) (-693.447) -- 0:00:01
970000 -- [-691.922] (-692.186) (-690.280) (-691.050) * (-689.929) [-691.509] (-692.997) (-692.300) -- 0:00:01
Average standard deviation of split frequencies: 0.008560
970500 -- (-689.752) (-690.446) (-691.363) [-689.987] * (-692.272) (-691.420) (-689.407) [-691.985] -- 0:00:01
971000 -- (-693.828) (-691.588) (-690.382) [-689.498] * [-695.062] (-690.782) (-690.949) (-691.650) -- 0:00:01
971500 -- (-691.603) (-692.884) [-691.010] (-690.381) * [-693.119] (-692.249) (-692.314) (-693.666) -- 0:00:01
972000 -- [-689.345] (-695.232) (-694.770) (-689.326) * (-691.577) [-691.193] (-693.391) (-695.040) -- 0:00:01
972500 -- (-694.118) [-689.878] (-694.452) (-690.528) * (-691.607) (-689.177) (-692.227) [-689.959] -- 0:00:01
973000 -- [-692.640] (-690.413) (-695.988) (-691.183) * [-689.839] (-694.127) (-690.265) (-690.061) -- 0:00:01
973500 -- [-696.524] (-690.984) (-698.552) (-692.294) * (-693.645) (-693.117) (-690.217) [-690.362] -- 0:00:01
974000 -- (-691.236) (-691.485) [-694.598] (-692.530) * (-694.623) (-691.677) [-695.786] (-689.824) -- 0:00:01
974500 -- (-690.199) (-691.893) (-690.978) [-691.828] * (-689.886) (-690.722) [-690.619] (-691.376) -- 0:00:01
975000 -- (-690.052) [-690.225] (-692.002) (-692.104) * [-690.441] (-693.667) (-695.543) (-689.958) -- 0:00:01
Average standard deviation of split frequencies: 0.008332
975500 -- (-690.566) [-690.519] (-689.820) (-689.016) * [-689.240] (-690.326) (-692.939) (-692.172) -- 0:00:01
976000 -- [-692.458] (-691.982) (-695.127) (-689.562) * (-689.556) [-689.676] (-691.532) (-691.373) -- 0:00:01
976500 -- (-690.884) [-692.077] (-693.982) (-690.153) * (-692.651) (-693.285) [-690.581] (-691.006) -- 0:00:01
977000 -- [-693.043] (-692.158) (-693.067) (-689.788) * (-691.013) (-690.184) [-690.813] (-691.771) -- 0:00:01
977500 -- (-690.957) [-691.283] (-692.496) (-694.147) * (-689.740) (-691.777) (-691.507) [-692.212] -- 0:00:01
978000 -- (-691.142) [-691.082] (-689.793) (-693.497) * [-689.410] (-689.647) (-691.433) (-696.478) -- 0:00:01
978500 -- (-689.621) (-689.880) [-691.392] (-692.126) * (-690.754) (-692.335) (-691.060) [-690.622] -- 0:00:01
979000 -- (-691.587) [-691.626] (-691.712) (-692.986) * (-692.395) (-690.485) [-691.085] (-694.164) -- 0:00:01
979500 -- (-695.700) (-689.503) (-690.592) [-693.409] * (-693.140) (-691.198) [-692.516] (-697.774) -- 0:00:01
980000 -- (-690.717) (-694.739) (-694.795) [-692.541] * (-693.024) (-690.955) (-693.050) [-694.557] -- 0:00:01
Average standard deviation of split frequencies: 0.008472
980500 -- (-693.583) (-694.571) [-696.782] (-696.746) * (-689.592) (-690.519) [-691.300] (-694.826) -- 0:00:01
981000 -- (-689.902) (-691.669) [-690.901] (-690.874) * (-691.711) (-692.858) (-692.032) [-691.331] -- 0:00:01
981500 -- (-689.903) [-689.268] (-690.555) (-691.001) * (-693.028) (-690.581) [-693.704] (-692.823) -- 0:00:01
982000 -- (-690.176) [-689.798] (-691.720) (-689.765) * (-691.755) (-690.335) [-691.685] (-691.964) -- 0:00:01
982500 -- [-689.400] (-689.971) (-691.571) (-691.798) * [-691.910] (-692.551) (-691.364) (-690.749) -- 0:00:01
983000 -- (-691.150) [-689.427] (-690.424) (-689.736) * [-690.545] (-691.132) (-689.758) (-697.202) -- 0:00:01
983500 -- [-691.530] (-694.751) (-691.248) (-693.190) * [-689.542] (-690.107) (-692.286) (-696.061) -- 0:00:00
984000 -- [-694.343] (-693.089) (-692.395) (-691.747) * (-691.500) (-690.701) [-692.036] (-698.087) -- 0:00:00
984500 -- (-691.883) (-690.882) (-695.266) [-692.867] * [-689.868] (-690.380) (-690.547) (-692.898) -- 0:00:00
985000 -- (-690.998) (-692.391) (-693.199) [-690.323] * [-689.869] (-689.242) (-691.939) (-689.516) -- 0:00:00
Average standard deviation of split frequencies: 0.008516
985500 -- (-691.197) (-694.623) [-691.450] (-692.482) * (-694.820) [-690.250] (-693.085) (-691.342) -- 0:00:00
986000 -- (-694.492) (-690.057) [-691.565] (-690.951) * (-690.758) (-689.563) [-691.214] (-698.527) -- 0:00:00
986500 -- (-697.557) [-690.915] (-691.213) (-690.709) * (-691.091) [-689.213] (-692.681) (-693.050) -- 0:00:00
987000 -- [-689.500] (-692.936) (-691.285) (-692.419) * (-690.704) (-691.063) [-691.690] (-690.178) -- 0:00:00
987500 -- [-690.059] (-691.410) (-691.731) (-691.487) * [-694.985] (-690.394) (-692.715) (-693.662) -- 0:00:00
988000 -- (-690.160) [-690.196] (-691.427) (-690.652) * (-692.852) [-689.621] (-693.667) (-691.422) -- 0:00:00
988500 -- (-689.562) (-691.615) [-692.839] (-691.365) * (-697.123) (-689.169) (-690.796) [-693.000] -- 0:00:00
989000 -- (-691.379) [-690.015] (-693.748) (-695.592) * (-691.226) (-690.220) [-691.391] (-691.457) -- 0:00:00
989500 -- (-692.482) [-690.721] (-695.919) (-690.144) * (-690.575) [-690.831] (-690.837) (-690.677) -- 0:00:00
990000 -- [-692.031] (-690.070) (-690.438) (-690.470) * (-691.805) [-691.027] (-693.172) (-692.161) -- 0:00:00
Average standard deviation of split frequencies: 0.008625
990500 -- [-691.071] (-689.689) (-690.454) (-691.783) * [-691.065] (-690.147) (-691.612) (-692.116) -- 0:00:00
991000 -- (-691.754) [-690.602] (-691.329) (-693.500) * [-694.801] (-690.204) (-691.225) (-692.330) -- 0:00:00
991500 -- (-689.377) [-691.343] (-694.788) (-690.622) * (-690.920) [-689.730] (-689.383) (-693.703) -- 0:00:00
992000 -- [-690.316] (-689.827) (-692.290) (-692.137) * (-692.826) (-691.669) [-689.956] (-690.600) -- 0:00:00
992500 -- [-691.118] (-690.299) (-689.878) (-689.941) * (-693.665) (-692.412) (-692.821) [-693.189] -- 0:00:00
993000 -- (-689.788) (-690.284) (-691.923) [-692.603] * (-689.406) [-689.912] (-689.691) (-697.441) -- 0:00:00
993500 -- (-691.024) [-690.048] (-693.023) (-690.182) * (-691.094) [-690.034] (-690.073) (-691.360) -- 0:00:00
994000 -- (-691.928) [-690.410] (-690.247) (-689.709) * (-697.803) (-690.090) (-689.946) [-689.536] -- 0:00:00
994500 -- (-691.915) (-690.907) (-697.245) [-691.296] * [-693.031] (-691.657) (-692.420) (-692.977) -- 0:00:00
995000 -- (-690.774) (-690.371) [-691.862] (-691.486) * (-689.834) (-693.340) (-694.268) [-691.905] -- 0:00:00
Average standard deviation of split frequencies: 0.008845
995500 -- [-692.631] (-690.761) (-691.344) (-691.758) * (-693.210) (-692.077) (-690.130) [-689.985] -- 0:00:00
996000 -- [-691.267] (-691.690) (-692.970) (-695.735) * [-690.078] (-692.264) (-690.730) (-690.293) -- 0:00:00
996500 -- (-691.574) [-691.007] (-689.843) (-694.480) * (-690.623) (-691.061) [-690.489] (-691.363) -- 0:00:00
997000 -- (-691.960) (-691.169) [-690.374] (-689.310) * (-692.500) (-690.944) (-691.889) [-691.233] -- 0:00:00
997500 -- [-689.400] (-691.367) (-689.547) (-688.861) * (-690.990) (-695.536) (-693.755) [-689.770] -- 0:00:00
998000 -- [-691.816] (-691.892) (-690.883) (-690.583) * (-691.455) (-699.238) [-691.270] (-694.450) -- 0:00:00
998500 -- (-699.406) (-689.187) (-693.444) [-689.375] * [-691.053] (-695.798) (-691.149) (-697.398) -- 0:00:00
999000 -- (-690.806) (-691.426) (-690.472) [-693.997] * (-692.869) [-690.526] (-690.510) (-691.829) -- 0:00:00
999500 -- (-694.131) (-690.031) [-692.301] (-691.489) * (-694.174) (-689.182) [-689.621] (-689.742) -- 0:00:00
1000000 -- (-691.114) (-690.323) [-692.799] (-690.962) * (-698.787) [-690.884] (-689.276) (-691.426) -- 0:00:00
Average standard deviation of split frequencies: 0.008480
Analysis completed in 60 seconds
Analysis used 59.05 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -688.84
Likelihood of best state for "cold" chain of run 2 was -688.84
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.3 % ( 24 %) Dirichlet(Pi{all})
31.9 % ( 18 %) Slider(Pi{all})
78.7 % ( 46 %) Multiplier(Alpha{1,2})
78.0 % ( 53 %) Multiplier(Alpha{3})
23.6 % ( 24 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.6 % ( 20 %) Dirichlet(Pi{all})
31.4 % ( 30 %) Slider(Pi{all})
78.9 % ( 61 %) Multiplier(Alpha{1,2})
78.1 % ( 49 %) Multiplier(Alpha{3})
22.9 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167240 0.82 0.67
3 | 166944 165893 0.84
4 | 166710 166070 167143
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165977 0.82 0.67
3 | 167090 166624 0.84
4 | 167447 166358 166504
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -690.65
| 1 1 2 |
| 1 2 2 2 |
| 2 2 1 2 1 2 1 1 |
| * 2 * 22 * 21 1 2 2 |
| 1 1112 2 21 12 1 2 11 2|
|2 2 * 2 1 22 1 2 1 1 1 2*21 21 1|
| 1 2 2 1 2 1 * 11 1 2 |
|121 22 1 12 2 1 21 1 |
| 1 2 1 1 221 2 |
| 2 1 1 1 |
| 1 2 1 2 2 2 1 |
| * 1 1 2 1 2 |
| |
| 2 2 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -692.32
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -690.60 -694.94
2 -690.55 -693.52
--------------------------------------
TOTAL -690.58 -694.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883773 0.088044 0.387406 1.499661 0.852219 1301.81 1401.41 1.000
r(A<->C){all} 0.159753 0.018740 0.000060 0.430846 0.120872 296.98 317.77 1.000
r(A<->G){all} 0.158860 0.017650 0.000108 0.426831 0.124811 144.69 221.25 1.002
r(A<->T){all} 0.172706 0.019874 0.000115 0.461718 0.138028 173.03 231.89 1.007
r(C<->G){all} 0.166224 0.019313 0.000115 0.444009 0.129966 198.43 203.59 1.011
r(C<->T){all} 0.166672 0.019627 0.000029 0.438971 0.130942 175.47 239.26 1.000
r(G<->T){all} 0.175785 0.022011 0.000074 0.464345 0.137216 200.15 205.14 1.000
pi(A){all} 0.128102 0.000214 0.100936 0.157676 0.127499 1309.30 1366.54 1.000
pi(C){all} 0.256030 0.000357 0.218508 0.291841 0.256007 1180.12 1210.56 1.000
pi(G){all} 0.361227 0.000423 0.321904 0.402744 0.360532 1220.68 1235.73 1.001
pi(T){all} 0.254640 0.000370 0.219859 0.295383 0.254155 1193.76 1240.07 1.001
alpha{1,2} 0.420807 0.245804 0.000122 1.425032 0.239635 1001.23 1056.14 1.001
alpha{3} 0.444051 0.230367 0.000102 1.427905 0.288359 1087.94 1178.48 1.000
pinvar{all} 0.996874 0.000015 0.989712 0.999999 0.998084 1264.23 1343.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .***.*
9 -- .**.**
10 -- ...**.
11 -- .*...*
12 -- ..**..
13 -- .****.
14 -- ..*..*
15 -- .*..*.
16 -- .*.*..
17 -- ..****
18 -- ..*.*.
19 -- ....**
20 -- .*.***
21 -- ...*.*
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 491 0.163558 0.014604 0.153231 0.173884 2
8 459 0.152898 0.011777 0.144570 0.161226 2
9 457 0.152232 0.002355 0.150566 0.153897 2
10 456 0.151899 0.004711 0.148568 0.155230 2
11 438 0.145903 0.003769 0.143238 0.148568 2
12 432 0.143904 0.002827 0.141905 0.145903 2
13 427 0.142239 0.009893 0.135243 0.149234 2
14 421 0.140240 0.010835 0.132578 0.147901 2
15 419 0.139574 0.006124 0.135243 0.143904 2
16 417 0.138907 0.013662 0.129247 0.148568 2
17 406 0.135243 0.000000 0.135243 0.135243 2
18 405 0.134910 0.005182 0.131246 0.138574 2
19 404 0.134577 0.010364 0.127249 0.141905 2
20 399 0.132911 0.009893 0.125916 0.139907 2
21 391 0.130247 0.007066 0.125250 0.135243 2
22 298 0.099267 0.022612 0.083278 0.115256 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096941 0.009375 0.000015 0.289394 0.067902 1.000 2
length{all}[2] 0.100848 0.010170 0.000016 0.303901 0.069068 1.000 2
length{all}[3] 0.095221 0.009487 0.000047 0.289344 0.064463 1.000 2
length{all}[4] 0.098655 0.009389 0.000019 0.300554 0.069784 1.000 2
length{all}[5] 0.097214 0.009513 0.000042 0.283220 0.067627 1.000 2
length{all}[6] 0.095975 0.009131 0.000035 0.286404 0.066964 1.000 2
length{all}[7] 0.096906 0.010214 0.000052 0.269273 0.064154 1.000 2
length{all}[8] 0.100411 0.010087 0.001296 0.302870 0.066307 0.998 2
length{all}[9] 0.094275 0.008698 0.000183 0.279876 0.066864 1.001 2
length{all}[10] 0.093291 0.008585 0.000170 0.284348 0.062998 1.003 2
length{all}[11] 0.094491 0.008507 0.000020 0.294679 0.066970 0.998 2
length{all}[12] 0.097012 0.009369 0.000731 0.309735 0.064034 0.998 2
length{all}[13] 0.099322 0.009484 0.000196 0.291477 0.066048 0.998 2
length{all}[14] 0.100816 0.010850 0.000014 0.323242 0.073433 0.998 2
length{all}[15] 0.099447 0.008573 0.000044 0.288593 0.071853 0.998 2
length{all}[16] 0.097224 0.009855 0.000007 0.269448 0.068421 0.998 2
length{all}[17] 0.109450 0.012906 0.000100 0.310457 0.076869 1.019 2
length{all}[18] 0.107265 0.010539 0.000608 0.282952 0.075899 1.004 2
length{all}[19] 0.097016 0.009378 0.000020 0.293274 0.065902 0.999 2
length{all}[20] 0.102372 0.008928 0.000087 0.293082 0.076727 0.998 2
length{all}[21] 0.103303 0.010406 0.000095 0.308837 0.069580 1.006 2
length{all}[22] 0.097566 0.010083 0.000289 0.269766 0.068354 1.011 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008480
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.019
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 519
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 173 / 173 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 173 / 173 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102599 0.011161 0.020871 0.089366 0.051982 0.059213 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -727.696978
Iterating by ming2
Initial: fx= 727.696978
x= 0.10260 0.01116 0.02087 0.08937 0.05198 0.05921 0.30000 1.30000
1 h-m-p 0.0000 0.0001 414.5085 ++ 716.460420 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0081 38.4696 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 378.5591 ++ 708.288866 m 0.0001 44 | 2/8
4 h-m-p 0.0006 0.0098 31.6648 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 338.4953 +++ 687.173137 m 0.0002 76 | 3/8
6 h-m-p 0.0024 0.0142 22.6097 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 294.5615 ++ 683.460117 m 0.0000 108 | 4/8
8 h-m-p 0.0007 0.0233 14.5470 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 240.2517 +++ 673.069129 m 0.0002 140 | 5/8
10 h-m-p 0.0034 0.0403 8.9153 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 170.7216 ++ 670.764068 m 0.0001 172 | 6/8
12 h-m-p 0.6650 8.0000 0.0000 ++ 670.764068 m 8.0000 183 | 6/8
13 h-m-p 0.2636 8.0000 0.0000 ----Y 670.764068 0 0.0003 200
Out..
lnL = -670.764068
201 lfun, 201 eigenQcodon, 1206 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089426 0.086715 0.059987 0.045970 0.105036 0.045522 0.299912 0.761316 0.183654
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.789616
np = 9
lnL0 = -741.549457
Iterating by ming2
Initial: fx= 741.549457
x= 0.08943 0.08672 0.05999 0.04597 0.10504 0.04552 0.29991 0.76132 0.18365
1 h-m-p 0.0000 0.0003 384.0687 +++ 697.959685 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0000 210.3274 ++ 697.583864 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0000 112698.0466 ++ 688.300271 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 798506.8176 ++ 674.787005 m 0.0000 51 | 4/9
5 h-m-p 0.0009 0.0043 8.2774 -----------.. | 4/9
6 h-m-p 0.0000 0.0000 293.7796 ++ 674.525429 m 0.0000 84 | 5/9
7 h-m-p 0.0003 0.1709 2.0963 ----------.. | 5/9
8 h-m-p 0.0000 0.0000 239.6790 ++ 673.562208 m 0.0000 116 | 6/9
9 h-m-p 0.0014 0.1802 2.0255 -----------.. | 6/9
10 h-m-p 0.0000 0.0001 169.4354 ++ 670.764079 m 0.0001 149 | 7/9
11 h-m-p 0.0488 8.0000 0.0000 ++++ 670.764079 m 8.0000 163 | 7/9
12 h-m-p 0.0174 8.0000 0.0118 +++++ 670.764076 m 8.0000 180 | 7/9
13 h-m-p 0.2442 1.5968 0.3881 ++ 670.764069 m 1.5968 194 | 8/9
14 h-m-p 0.0160 8.0000 4.2172 ------------C 670.764069 0 0.0000 220 | 8/9
15 h-m-p 0.0502 8.0000 0.0000 ---C 670.764069 0 0.0002 235 | 8/9
16 h-m-p 0.0537 8.0000 0.0000 -C 670.764069 0 0.0034 249
Out..
lnL = -670.764069
250 lfun, 750 eigenQcodon, 3000 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086059 0.055355 0.030790 0.032963 0.028960 0.024978 0.212684 1.207031 0.204934 0.233915 1.414620
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.638593
np = 11
lnL0 = -713.665189
Iterating by ming2
Initial: fx= 713.665189
x= 0.08606 0.05535 0.03079 0.03296 0.02896 0.02498 0.21268 1.20703 0.20493 0.23392 1.41462
1 h-m-p 0.0000 0.0002 393.3159 ++ 689.288553 m 0.0002 16 | 1/11
2 h-m-p 0.0001 0.0005 87.4103 ++ 685.831753 m 0.0005 30 | 2/11
3 h-m-p 0.0000 0.0000 24792.6277 ++ 684.622967 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 279417.8698 ++ 683.556769 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 3484.3339 ++ 676.329321 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 31867286.6082 ++ 675.423131 m 0.0000 86 | 6/11
7 h-m-p 0.0035 0.0832 3.2150 ------------.. | 6/11
8 h-m-p 0.0000 0.0002 167.5879 +++ 670.764074 m 0.0002 125 | 7/11
9 h-m-p 0.7529 8.0000 0.0000 ++ 670.764074 m 8.0000 139 | 7/11
10 h-m-p 0.0284 8.0000 0.0025 +++++ 670.764074 m 8.0000 160 | 7/11
11 h-m-p 0.0132 6.6154 19.2975 ------------C 670.764074 0 0.0000 190 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 670.764074 m 8.0000 207 | 7/11
13 h-m-p 0.0160 8.0000 0.0485 +++++ 670.764072 m 8.0000 228 | 7/11
14 h-m-p 0.1985 8.0000 1.9537 ++Y 670.764067 0 2.5025 248 | 7/11
15 h-m-p 1.6000 8.0000 0.3019 +Y 670.764067 0 4.2174 263 | 7/11
16 h-m-p 1.6000 8.0000 0.1123 Y 670.764067 0 0.7000 281 | 7/11
17 h-m-p 1.6000 8.0000 0.0001 ++ 670.764067 m 8.0000 299 | 7/11
18 h-m-p 0.0332 8.0000 0.0199 ++++ 670.764067 m 8.0000 319 | 7/11
19 h-m-p 0.5015 8.0000 0.3170 Y 670.764067 0 1.0629 337 | 7/11
20 h-m-p 1.6000 8.0000 0.0141 ++ 670.764067 m 8.0000 355 | 7/11
21 h-m-p 0.0191 1.6422 5.8912 +++Y 670.764064 0 0.8524 376 | 7/11
22 h-m-p 1.6000 8.0000 1.1859 C 670.764063 0 1.6000 390 | 7/11
23 h-m-p 1.6000 8.0000 0.7807 +Y 670.764063 0 4.0425 405 | 7/11
24 h-m-p 1.6000 8.0000 1.4910 ++ 670.764061 m 8.0000 423 | 7/11
25 h-m-p 0.0426 0.2131 35.7601 ++ 670.764060 m 0.2131 437 | 8/11
26 h-m-p 0.1493 2.1993 51.0342 ++ 670.764058 m 2.1993 451 | 8/11
27 h-m-p -0.0000 -0.0000 49.2628
h-m-p: -0.00000000e+00 -0.00000000e+00 4.92628370e+01 670.764058
.. | 8/11
28 h-m-p 0.0160 8.0000 0.0000 Y 670.764058 0 0.0160 476 | 8/11
29 h-m-p 0.3589 8.0000 0.0000 -----C 670.764058 0 0.0001 498
Out..
lnL = -670.764058
499 lfun, 1996 eigenQcodon, 8982 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -670.761137 S = -670.760172 -0.000368
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:04
did 20 / 49 patterns 0:04
did 30 / 49 patterns 0:04
did 40 / 49 patterns 0:04
did 49 / 49 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046240 0.053221 0.037325 0.029865 0.090668 0.100421 0.000100 0.400578 1.745838
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.472570
np = 9
lnL0 = -729.856715
Iterating by ming2
Initial: fx= 729.856715
x= 0.04624 0.05322 0.03733 0.02987 0.09067 0.10042 0.00011 0.40058 1.74584
1 h-m-p 0.0000 0.0000 392.1526 ++ 729.341742 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0556 13.7102 ----------.. | 1/9
3 h-m-p 0.0000 0.0002 392.3900 +++ 701.170386 m 0.0002 47 | 2/9
4 h-m-p 0.0061 0.0798 10.4747 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 369.0857 ++ 694.984260 m 0.0000 81 | 3/9
6 h-m-p 0.0022 0.0967 6.6875 ------------.. | 3/9
7 h-m-p 0.0000 0.0001 331.4227 ++ 689.013712 m 0.0001 115 | 4/9
8 h-m-p 0.0027 0.0885 5.7211 ------------.. | 4/9
9 h-m-p 0.0000 0.0000 288.0709 ++ 685.484834 m 0.0000 149 | 5/9
10 h-m-p 0.0019 0.0827 5.2833 ------------.. | 5/9
11 h-m-p 0.0000 0.0002 234.7204 +++ 672.520592 m 0.0002 184 | 6/9
12 h-m-p 0.0121 0.1382 3.1626 -------------.. | 6/9
13 h-m-p 0.0000 0.0001 170.4848 ++ 670.764079 m 0.0001 219 | 7/9
14 h-m-p 0.0228 8.0000 0.0000 +++++ 670.764079 m 8.0000 234 | 7/9
15 h-m-p 0.1569 8.0000 0.0002 +++ 670.764079 m 8.0000 249 | 7/9
16 h-m-p 0.0160 8.0000 0.5770 +++++ 670.764075 m 8.0000 266 | 7/9
17 h-m-p 1.6000 8.0000 0.2139 ++ 670.764075 m 8.0000 280 | 7/9
18 h-m-p 0.6768 8.0000 2.5286 ++ 670.764074 m 8.0000 294 | 7/9
19 h-m-p 1.6000 8.0000 1.0632 ---------N 670.764074 0 0.0000 315 | 7/9
20 h-m-p 0.9367 8.0000 0.0000 --------Y 670.764074 0 0.0000 335
Out..
lnL = -670.764074
336 lfun, 3696 eigenQcodon, 20160 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.041787 0.088356 0.050859 0.024709 0.053707 0.087346 0.000100 0.900000 0.598820 1.079266 1.300026
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.496436
np = 11
lnL0 = -727.539047
Iterating by ming2
Initial: fx= 727.539047
x= 0.04179 0.08836 0.05086 0.02471 0.05371 0.08735 0.00011 0.90000 0.59882 1.07927 1.30003
1 h-m-p 0.0000 0.0000 384.8784 ++ 726.861206 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0023 109.0137 ++++ 703.373506 m 0.0023 32 | 2/11
3 h-m-p 0.0000 0.0002 438.1926 ++ 688.899642 m 0.0002 46 | 3/11
4 h-m-p 0.0004 0.0022 58.7691 ++ 685.776982 m 0.0022 60 | 4/11
5 h-m-p 0.0000 0.0000 2472.6033 ++ 685.133750 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0004 711.8076 ++ 671.364699 m 0.0004 88 | 6/11
7 h-m-p 0.0001 0.0003 369.3515 ++ 670.764069 m 0.0003 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 670.764069 m 8.0000 116 | 7/11
9 h-m-p 0.0238 1.2221 0.0418 +++ 670.764068 m 1.2221 135
QuantileBeta(0.15, 0.00494, 1.25488) = 7.239198e-163 2000 rounds
| 7/11
10 h-m-p 0.5573 8.0000 0.0916 ------------Y 670.764068 0 0.0000 165
QuantileBeta(0.15, 0.00494, 1.25488) = 7.239506e-163 2000 rounds
| 7/11
11 h-m-p 0.0000 0.0000 0.0001 N 670.764068 0 0.0000 183
QuantileBeta(0.15, 0.00494, 1.25488) = 7.239490e-163 2000 rounds
| 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 670.764068 m 8.0000 204
QuantileBeta(0.15, 0.00498, 1.25493) = 4.124934e-161 2000 rounds
| 7/11
13 h-m-p 0.0000 0.0001 1.8393 --------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 670.764068 m 8.0000 245
QuantileBeta(0.15, 0.00497, 1.25493) = 3.539372e-161 2000 rounds
| 7/11
15 h-m-p 0.0233 0.4052 0.0057 +++ 670.764068 m 0.4052 264
QuantileBeta(0.15, 0.00494, 1.25493) = 7.238825e-163 2000 rounds
| 7/11
16 h-m-p -0.0000 -0.0000 0.3905
h-m-p: -0.00000000e+00 -0.00000000e+00 3.90546873e-01 670.764068
..
QuantileBeta(0.15, 0.00494, 1.25493) = 7.238825e-163 2000 rounds
| 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 670.764068 m 8.0000 300
QuantileBeta(0.15, 0.00494, 1.25493) = 7.356178e-163 2000 rounds
| 7/11
18 h-m-p 0.0020 0.9866 0.5751 +++++ 670.764063 m 0.9866 321 | 8/11
19 h-m-p 0.5729 8.0000 0.2491 ++ 670.764060 m 8.0000 339 | 8/11
20 h-m-p 1.6000 8.0000 0.8359 ++ 670.764058 m 8.0000 356 | 8/11
21 h-m-p 1.6000 8.0000 1.2324 ++ 670.764058 m 8.0000 373 | 8/11
22 h-m-p 1.6000 8.0000 4.1775 ++ 670.764057 m 8.0000 387 | 8/11
23 h-m-p 0.0458 0.2288 227.6749 --------Y 670.764057 0 0.0000 409 | 8/11
24 h-m-p 1.6000 8.0000 0.0000 -Y 670.764057 0 0.1000 424 | 8/11
25 h-m-p 0.7920 8.0000 0.0000 -----------Y 670.764057 0 0.0000 452
Out..
lnL = -670.764057
453 lfun, 5436 eigenQcodon, 29898 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -670.760241 S = -670.760000 -0.000106
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:16
did 20 / 49 patterns 0:16
did 30 / 49 patterns 0:17
did 40 / 49 patterns 0:17
did 49 / 49 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=173
NC_011896_1_WP_010907939_1_846_MLBR_RS03945 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
NC_002677_1_NP_301615_1_487_ML0806 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG
**************************************************
NC_011896_1_WP_010907939_1_846_MLBR_RS03945 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
NC_002677_1_NP_301615_1_487_ML0806 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460 AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK
**************************************************
NC_011896_1_WP_010907939_1_846_MLBR_RS03945 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
NC_002677_1_NP_301615_1_487_ML0806 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460 RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA
**************************************************
NC_011896_1_WP_010907939_1_846_MLBR_RS03945 VRWSAGAYQRSVASSANRKADSR
NC_002677_1_NP_301615_1_487_ML0806 VRWSAGAYQRSVASSANRKADSR
NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115 VRWSAGAYQRSVASSANRKADSR
NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045 VRWSAGAYQRSVASSANRKADSR
NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390 VRWSAGAYQRSVASSANRKADSR
NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460 VRWSAGAYQRSVASSANRKADSR
***********************
>NC_011896_1_WP_010907939_1_846_MLBR_RS03945 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA TCGCAAGGCGGACAGTCGG >NC_002677_1_NP_301615_1_487_ML0806 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA TCGCAAGGCGGACAGTCGG >NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA TCGCAAGGCGGACAGTCGG >NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA TCGCAAGGCGGACAGTCGG >NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA TCGCAAGGCGGACAGTCGG >NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460 GTGGACCGTGTAATAGCGCTGCTTAGCAGCGGGGCGATCGTCGGCCCGTG TGACTACGCTGACGTTGTGACACTCCCACATAAGCGGGCGGTATTCTCGC GTGCTCCGGCTGCTGTGCGGGGCGCAGGACTAATTGTCGTGGTGCAAGGT GCAGTCGCGCTGGTGGTGGCTGCGGCGCTGGTGGTTCGCGGGCTCACCGG CGCCGATCAGCGCATTGTTAACGGCTTGGGCACAGCGATCTGGTTCGTTG TGGTCGGCGTTGCGGTGCTTGCTGCCGGATGTGCGTTGCTGGTCGGCAAG CGTTGGGGTCGCGGTCTGGCGGTGTTCACCCAATTGCTGCTGTTACCTGT AGCGTGGTATCTCGTTGTGGGCTCGCATCAGTCGGCCTTCGGATTTCCAA TGGGAATCGTGGCGCTGATCGCGTTGATATTGCTTTTCAGTCCACCGGCT GTGCGCTGGTCCGCAGGTGCCTATCAGCGTAGTGTGGCCAGTTCAGCTAA TCGCAAGGCGGACAGTCGG
>NC_011896_1_WP_010907939_1_846_MLBR_RS03945 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA VRWSAGAYQRSVASSANRKADSR >NC_002677_1_NP_301615_1_487_ML0806 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA VRWSAGAYQRSVASSANRKADSR >NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA VRWSAGAYQRSVASSANRKADSR >NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA VRWSAGAYQRSVASSANRKADSR >NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA VRWSAGAYQRSVASSANRKADSR >NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQG AVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGK RWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPA VRWSAGAYQRSVASSANRKADSR
#NEXUS
[ID: 0577883570]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907939_1_846_MLBR_RS03945
NC_002677_1_NP_301615_1_487_ML0806
NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115
NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045
NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390
NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907939_1_846_MLBR_RS03945,
2 NC_002677_1_NP_301615_1_487_ML0806,
3 NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115,
4 NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045,
5 NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390,
6 NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06790221,2:0.06906778,3:0.06446299,4:0.06978351,5:0.06762708,6:0.06696368);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06790221,2:0.06906778,3:0.06446299,4:0.06978351,5:0.06762708,6:0.06696368);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -690.60 -694.94
2 -690.55 -693.52
--------------------------------------
TOTAL -690.58 -694.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0806/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883773 0.088044 0.387406 1.499661 0.852219 1301.81 1401.41 1.000
r(A<->C){all} 0.159753 0.018740 0.000060 0.430846 0.120872 296.98 317.77 1.000
r(A<->G){all} 0.158860 0.017650 0.000108 0.426831 0.124811 144.69 221.25 1.002
r(A<->T){all} 0.172706 0.019874 0.000115 0.461718 0.138028 173.03 231.89 1.007
r(C<->G){all} 0.166224 0.019313 0.000115 0.444009 0.129966 198.43 203.59 1.011
r(C<->T){all} 0.166672 0.019627 0.000029 0.438971 0.130942 175.47 239.26 1.000
r(G<->T){all} 0.175785 0.022011 0.000074 0.464345 0.137216 200.15 205.14 1.000
pi(A){all} 0.128102 0.000214 0.100936 0.157676 0.127499 1309.30 1366.54 1.000
pi(C){all} 0.256030 0.000357 0.218508 0.291841 0.256007 1180.12 1210.56 1.000
pi(G){all} 0.361227 0.000423 0.321904 0.402744 0.360532 1220.68 1235.73 1.001
pi(T){all} 0.254640 0.000370 0.219859 0.295383 0.254155 1193.76 1240.07 1.001
alpha{1,2} 0.420807 0.245804 0.000122 1.425032 0.239635 1001.23 1056.14 1.001
alpha{3} 0.444051 0.230367 0.000102 1.427905 0.288359 1087.94 1178.48 1.000
pinvar{all} 0.996874 0.000015 0.989712 0.999999 0.998084 1264.23 1343.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0806/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 173
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 2 2 2 2 2 2
TTC 5 5 5 5 5 5 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 5 5 5 5 5 5
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 8 8 8 8 8 8 | CCG 3 3 3 3 3 3 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 4 4 4 4 4 4
ATC 4 4 4 4 4 4 | ACC 2 2 2 2 2 2 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 8 8 8 8 8 8 | Asp GAT 1 1 1 1 1 1 | Gly GGT 4 4 4 4 4 4
GTC 5 5 5 5 5 5 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 8 8 8 8 8 8
GTA 3 3 3 3 3 3 | GCA 3 3 3 3 3 3 | Glu GAA 0 0 0 0 0 0 | GGA 4 4 4 4 4 4
GTG 15 15 15 15 15 15 | GCG 14 14 14 14 14 14 | GAG 0 0 0 0 0 0 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907939_1_846_MLBR_RS03945
position 1: T:0.15029 C:0.23699 A:0.13873 G:0.47399
position 2: T:0.37572 C:0.26590 A:0.11561 G:0.24277
position 3: T:0.23699 C:0.26590 A:0.12717 G:0.36994
Average T:0.25434 C:0.25626 A:0.12717 G:0.36224
#2: NC_002677_1_NP_301615_1_487_ML0806
position 1: T:0.15029 C:0.23699 A:0.13873 G:0.47399
position 2: T:0.37572 C:0.26590 A:0.11561 G:0.24277
position 3: T:0.23699 C:0.26590 A:0.12717 G:0.36994
Average T:0.25434 C:0.25626 A:0.12717 G:0.36224
#3: NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115
position 1: T:0.15029 C:0.23699 A:0.13873 G:0.47399
position 2: T:0.37572 C:0.26590 A:0.11561 G:0.24277
position 3: T:0.23699 C:0.26590 A:0.12717 G:0.36994
Average T:0.25434 C:0.25626 A:0.12717 G:0.36224
#4: NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045
position 1: T:0.15029 C:0.23699 A:0.13873 G:0.47399
position 2: T:0.37572 C:0.26590 A:0.11561 G:0.24277
position 3: T:0.23699 C:0.26590 A:0.12717 G:0.36994
Average T:0.25434 C:0.25626 A:0.12717 G:0.36224
#5: NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390
position 1: T:0.15029 C:0.23699 A:0.13873 G:0.47399
position 2: T:0.37572 C:0.26590 A:0.11561 G:0.24277
position 3: T:0.23699 C:0.26590 A:0.12717 G:0.36994
Average T:0.25434 C:0.25626 A:0.12717 G:0.36224
#6: NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460
position 1: T:0.15029 C:0.23699 A:0.13873 G:0.47399
position 2: T:0.37572 C:0.26590 A:0.11561 G:0.24277
position 3: T:0.23699 C:0.26590 A:0.12717 G:0.36994
Average T:0.25434 C:0.25626 A:0.12717 G:0.36224
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 12
TTC 30 | TCC 6 | TAC 6 | TGC 0
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 24
CTC 18 | CCC 0 | CAC 0 | CGC 30
CTA 6 | CCA 18 | Gln Q CAA 12 | CGA 0
CTG 48 | CCG 18 | CAG 18 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 24
ATC 24 | ACC 12 | AAC 6 | AGC 12
ATA 12 | ACA 12 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 48 | Asp D GAT 6 | Gly G GGT 24
GTC 30 | GCC 30 | GAC 24 | GGC 48
GTA 18 | GCA 18 | Glu E GAA 0 | GGA 24
GTG 90 | GCG 84 | GAG 0 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15029 C:0.23699 A:0.13873 G:0.47399
position 2: T:0.37572 C:0.26590 A:0.11561 G:0.24277
position 3: T:0.23699 C:0.26590 A:0.12717 G:0.36994
Average T:0.25434 C:0.25626 A:0.12717 G:0.36224
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -670.764068 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299912 1.300026
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907939_1_846_MLBR_RS03945: 0.000004, NC_002677_1_NP_301615_1_487_ML0806: 0.000004, NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115: 0.000004, NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045: 0.000004, NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390: 0.000004, NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29991
omega (dN/dS) = 1.30003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 346.9 172.1 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 346.9 172.1 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 346.9 172.1 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 346.9 172.1 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 346.9 172.1 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 346.9 172.1 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -670.764069 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.212684 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907939_1_846_MLBR_RS03945: 0.000004, NC_002677_1_NP_301615_1_487_ML0806: 0.000004, NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115: 0.000004, NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045: 0.000004, NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390: 0.000004, NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.21268
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 347.5 171.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 347.5 171.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 347.5 171.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 347.5 171.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 347.5 171.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 347.5 171.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -670.764058 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 9.916349
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907939_1_846_MLBR_RS03945: 0.000004, NC_002677_1_NP_301615_1_487_ML0806: 0.000004, NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115: 0.000004, NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045: 0.000004, NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390: 0.000004, NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 9.91635
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 349.2 169.8 9.9163 0.0000 0.0000 0.0 0.0
7..2 0.000 349.2 169.8 9.9163 0.0000 0.0000 0.0 0.0
7..3 0.000 349.2 169.8 9.9163 0.0000 0.0000 0.0 0.0
7..4 0.000 349.2 169.8 9.9163 0.0000 0.0000 0.0 0.0
7..5 0.000 349.2 169.8 9.9163 0.0000 0.0000 0.0 0.0
7..6 0.000 349.2 169.8 9.9163 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907939_1_846_MLBR_RS03945)
Pr(w>1) post mean +- SE for w
1 V 1.000** 9.916
2 D 1.000** 9.916
3 R 1.000** 9.916
4 V 1.000** 9.916
5 I 1.000** 9.916
6 A 1.000** 9.916
7 L 1.000** 9.916
8 L 1.000** 9.916
9 S 1.000** 9.916
10 S 1.000** 9.916
11 G 1.000** 9.916
12 A 1.000** 9.916
13 I 1.000** 9.916
14 V 1.000** 9.916
15 G 1.000** 9.916
16 P 1.000** 9.916
17 C 1.000** 9.916
18 D 1.000** 9.916
19 Y 1.000** 9.916
20 A 1.000** 9.916
21 D 1.000** 9.916
22 V 1.000** 9.916
23 V 1.000** 9.916
24 T 1.000** 9.916
25 L 1.000** 9.916
26 P 1.000** 9.916
27 H 1.000** 9.916
28 K 1.000** 9.916
29 R 1.000** 9.916
30 A 1.000** 9.916
31 V 1.000** 9.916
32 F 1.000** 9.916
33 S 1.000** 9.916
34 R 1.000** 9.916
35 A 1.000** 9.916
36 P 1.000** 9.916
37 A 1.000** 9.916
38 A 1.000** 9.916
39 V 1.000** 9.916
40 R 1.000** 9.916
41 G 1.000** 9.916
42 A 1.000** 9.916
43 G 1.000** 9.916
44 L 1.000** 9.916
45 I 1.000** 9.916
46 V 1.000** 9.916
47 V 1.000** 9.916
48 V 1.000** 9.916
49 Q 1.000** 9.916
50 G 1.000** 9.916
51 A 1.000** 9.916
52 V 1.000** 9.916
53 A 1.000** 9.916
54 L 1.000** 9.916
55 V 1.000** 9.916
56 V 1.000** 9.916
57 A 1.000** 9.916
58 A 1.000** 9.916
59 A 1.000** 9.916
60 L 1.000** 9.916
61 V 1.000** 9.916
62 V 1.000** 9.916
63 R 1.000** 9.916
64 G 1.000** 9.916
65 L 1.000** 9.916
66 T 1.000** 9.916
67 G 1.000** 9.916
68 A 1.000** 9.916
69 D 1.000** 9.916
70 Q 1.000** 9.916
71 R 1.000** 9.916
72 I 1.000** 9.916
73 V 1.000** 9.916
74 N 1.000** 9.916
75 G 1.000** 9.916
76 L 1.000** 9.916
77 G 1.000** 9.916
78 T 1.000** 9.916
79 A 1.000** 9.916
80 I 1.000** 9.916
81 W 1.000** 9.916
82 F 1.000** 9.916
83 V 1.000** 9.916
84 V 1.000** 9.916
85 V 1.000** 9.916
86 G 1.000** 9.916
87 V 1.000** 9.916
88 A 1.000** 9.916
89 V 1.000** 9.916
90 L 1.000** 9.916
91 A 1.000** 9.916
92 A 1.000** 9.916
93 G 1.000** 9.916
94 C 1.000** 9.916
95 A 1.000** 9.916
96 L 1.000** 9.916
97 L 1.000** 9.916
98 V 1.000** 9.916
99 G 1.000** 9.916
100 K 1.000** 9.916
101 R 1.000** 9.916
102 W 1.000** 9.916
103 G 1.000** 9.916
104 R 1.000** 9.916
105 G 1.000** 9.916
106 L 1.000** 9.916
107 A 1.000** 9.916
108 V 1.000** 9.916
109 F 1.000** 9.916
110 T 1.000** 9.916
111 Q 1.000** 9.916
112 L 1.000** 9.916
113 L 1.000** 9.916
114 L 1.000** 9.916
115 L 1.000** 9.916
116 P 1.000** 9.916
117 V 1.000** 9.916
118 A 1.000** 9.916
119 W 1.000** 9.916
120 Y 1.000** 9.916
121 L 1.000** 9.916
122 V 1.000** 9.916
123 V 1.000** 9.916
124 G 1.000** 9.916
125 S 1.000** 9.916
126 H 1.000** 9.916
127 Q 1.000** 9.916
128 S 1.000** 9.916
129 A 1.000** 9.916
130 F 1.000** 9.916
131 G 1.000** 9.916
132 F 1.000** 9.916
133 P 1.000** 9.916
134 M 1.000** 9.916
135 G 1.000** 9.916
136 I 1.000** 9.916
137 V 1.000** 9.916
138 A 1.000** 9.916
139 L 1.000** 9.916
140 I 1.000** 9.916
141 A 1.000** 9.916
142 L 1.000** 9.916
143 I 1.000** 9.916
144 L 1.000** 9.916
145 L 1.000** 9.916
146 F 1.000** 9.916
147 S 1.000** 9.916
148 P 1.000** 9.916
149 P 1.000** 9.916
150 A 1.000** 9.916
151 V 1.000** 9.916
152 R 1.000** 9.916
153 W 1.000** 9.916
154 S 1.000** 9.916
155 A 1.000** 9.916
156 G 1.000** 9.916
157 A 1.000** 9.916
158 Y 1.000** 9.916
159 Q 1.000** 9.916
160 R 1.000** 9.916
161 S 1.000** 9.916
162 V 1.000** 9.916
163 A 1.000** 9.916
164 S 1.000** 9.916
165 S 1.000** 9.916
166 A 1.000** 9.916
167 N 1.000** 9.916
168 R 1.000** 9.916
169 K 1.000** 9.916
170 A 1.000** 9.916
171 D 1.000** 9.916
172 S 1.000** 9.916
173 R 1.000** 9.916
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907939_1_846_MLBR_RS03945)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -670.764074 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 14.099440 24.497917
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907939_1_846_MLBR_RS03945: 0.000004, NC_002677_1_NP_301615_1_487_ML0806: 0.000004, NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115: 0.000004, NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045: 0.000004, NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390: 0.000004, NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 14.09944 q = 24.49792
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.24337 0.28533 0.31166 0.33332 0.35320 0.37277 0.39328 0.41642 0.44568 0.49526
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 349.2 169.8 0.3650 0.0000 0.0000 0.0 0.0
7..2 0.000 349.2 169.8 0.3650 0.0000 0.0000 0.0 0.0
7..3 0.000 349.2 169.8 0.3650 0.0000 0.0000 0.0 0.0
7..4 0.000 349.2 169.8 0.3650 0.0000 0.0000 0.0 0.0
7..5 0.000 349.2 169.8 0.3650 0.0000 0.0000 0.0 0.0
7..6 0.000 349.2 169.8 0.3650 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -670.764057 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.340686 1.261531 53.847572
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907939_1_846_MLBR_RS03945: 0.000004, NC_002677_1_NP_301615_1_487_ML0806: 0.000004, NZ_LVXE01000001_1_WP_010907939_1_231_A3216_RS01115: 0.000004, NZ_LYPH01000001_1_WP_010907939_1_220_A8144_RS01045: 0.000004, NZ_CP029543_1_WP_010907939_1_864_DIJ64_RS04390: 0.000004, NZ_AP014567_1_WP_010907939_1_878_JK2ML_RS04460: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.34069 q = 1.26153
(p1 = 0.99999) w = 53.84757
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00011 0.00283 0.01268 0.03418 0.07202 0.13139 0.21859 0.34220 0.51632 0.77477 53.84757
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 349.2 169.8 53.8470 0.0000 0.0000 0.0 0.0
7..2 0.000 349.2 169.8 53.8470 0.0000 0.0000 0.0 0.0
7..3 0.000 349.2 169.8 53.8470 0.0000 0.0000 0.0 0.0
7..4 0.000 349.2 169.8 53.8470 0.0000 0.0000 0.0 0.0
7..5 0.000 349.2 169.8 53.8470 0.0000 0.0000 0.0 0.0
7..6 0.000 349.2 169.8 53.8470 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907939_1_846_MLBR_RS03945)
Pr(w>1) post mean +- SE for w
1 V 1.000** 53.847
2 D 1.000** 53.847
3 R 1.000** 53.847
4 V 1.000** 53.847
5 I 1.000** 53.847
6 A 1.000** 53.847
7 L 1.000** 53.847
8 L 1.000** 53.847
9 S 1.000** 53.847
10 S 1.000** 53.847
11 G 1.000** 53.847
12 A 1.000** 53.847
13 I 1.000** 53.847
14 V 1.000** 53.847
15 G 1.000** 53.847
16 P 1.000** 53.847
17 C 1.000** 53.847
18 D 1.000** 53.847
19 Y 1.000** 53.847
20 A 1.000** 53.847
21 D 1.000** 53.847
22 V 1.000** 53.847
23 V 1.000** 53.847
24 T 1.000** 53.847
25 L 1.000** 53.847
26 P 1.000** 53.847
27 H 1.000** 53.847
28 K 1.000** 53.847
29 R 1.000** 53.847
30 A 1.000** 53.847
31 V 1.000** 53.847
32 F 1.000** 53.847
33 S 1.000** 53.847
34 R 1.000** 53.847
35 A 1.000** 53.847
36 P 1.000** 53.847
37 A 1.000** 53.847
38 A 1.000** 53.847
39 V 1.000** 53.847
40 R 1.000** 53.847
41 G 1.000** 53.847
42 A 1.000** 53.847
43 G 1.000** 53.847
44 L 1.000** 53.847
45 I 1.000** 53.847
46 V 1.000** 53.847
47 V 1.000** 53.847
48 V 1.000** 53.847
49 Q 1.000** 53.847
50 G 1.000** 53.847
51 A 1.000** 53.847
52 V 1.000** 53.847
53 A 1.000** 53.847
54 L 1.000** 53.847
55 V 1.000** 53.847
56 V 1.000** 53.847
57 A 1.000** 53.847
58 A 1.000** 53.847
59 A 1.000** 53.847
60 L 1.000** 53.847
61 V 1.000** 53.847
62 V 1.000** 53.847
63 R 1.000** 53.847
64 G 1.000** 53.847
65 L 1.000** 53.847
66 T 1.000** 53.847
67 G 1.000** 53.847
68 A 1.000** 53.847
69 D 1.000** 53.847
70 Q 1.000** 53.847
71 R 1.000** 53.847
72 I 1.000** 53.847
73 V 1.000** 53.847
74 N 1.000** 53.847
75 G 1.000** 53.847
76 L 1.000** 53.847
77 G 1.000** 53.847
78 T 1.000** 53.847
79 A 1.000** 53.847
80 I 1.000** 53.847
81 W 1.000** 53.847
82 F 1.000** 53.847
83 V 1.000** 53.847
84 V 1.000** 53.847
85 V 1.000** 53.847
86 G 1.000** 53.847
87 V 1.000** 53.847
88 A 1.000** 53.847
89 V 1.000** 53.847
90 L 1.000** 53.847
91 A 1.000** 53.847
92 A 1.000** 53.847
93 G 1.000** 53.847
94 C 1.000** 53.847
95 A 1.000** 53.847
96 L 1.000** 53.847
97 L 1.000** 53.847
98 V 1.000** 53.847
99 G 1.000** 53.847
100 K 1.000** 53.847
101 R 1.000** 53.847
102 W 1.000** 53.847
103 G 1.000** 53.847
104 R 1.000** 53.847
105 G 1.000** 53.847
106 L 1.000** 53.847
107 A 1.000** 53.847
108 V 1.000** 53.847
109 F 1.000** 53.847
110 T 1.000** 53.847
111 Q 1.000** 53.847
112 L 1.000** 53.847
113 L 1.000** 53.847
114 L 1.000** 53.847
115 L 1.000** 53.847
116 P 1.000** 53.847
117 V 1.000** 53.847
118 A 1.000** 53.847
119 W 1.000** 53.847
120 Y 1.000** 53.847
121 L 1.000** 53.847
122 V 1.000** 53.847
123 V 1.000** 53.847
124 G 1.000** 53.847
125 S 1.000** 53.847
126 H 1.000** 53.847
127 Q 1.000** 53.847
128 S 1.000** 53.847
129 A 1.000** 53.847
130 F 1.000** 53.847
131 G 1.000** 53.847
132 F 1.000** 53.847
133 P 1.000** 53.847
134 M 1.000** 53.847
135 G 1.000** 53.847
136 I 1.000** 53.847
137 V 1.000** 53.847
138 A 1.000** 53.847
139 L 1.000** 53.847
140 I 1.000** 53.847
141 A 1.000** 53.847
142 L 1.000** 53.847
143 I 1.000** 53.847
144 L 1.000** 53.847
145 L 1.000** 53.847
146 F 1.000** 53.847
147 S 1.000** 53.847
148 P 1.000** 53.847
149 P 1.000** 53.847
150 A 1.000** 53.847
151 V 1.000** 53.847
152 R 1.000** 53.847
153 W 1.000** 53.847
154 S 1.000** 53.847
155 A 1.000** 53.847
156 G 1.000** 53.847
157 A 1.000** 53.847
158 Y 1.000** 53.847
159 Q 1.000** 53.847
160 R 1.000** 53.847
161 S 1.000** 53.847
162 V 1.000** 53.847
163 A 1.000** 53.847
164 S 1.000** 53.847
165 S 1.000** 53.847
166 A 1.000** 53.847
167 N 1.000** 53.847
168 R 1.000** 53.847
169 K 1.000** 53.847
170 A 1.000** 53.847
171 D 1.000** 53.847
172 S 1.000** 53.847
173 R 1.000** 53.847
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907939_1_846_MLBR_RS03945)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -670.764069 Model 2: PositiveSelection -670.764058 Model 0: one-ratio -670.764068 Model 7: beta -670.764074 Model 8: beta&w>1 -670.764057 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 2.199999994445534E-5 Model 8 vs 7 3.400000014153193E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
