--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:44:53 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0813/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -786.99 -790.70
2 -787.01 -790.27
--------------------------------------
TOTAL -787.00 -790.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902935 0.089619 0.375300 1.481279 0.873117 1231.75 1366.38 1.000
r(A<->C){all} 0.161411 0.020646 0.000053 0.453441 0.118866 88.29 155.71 1.000
r(A<->G){all} 0.168313 0.020815 0.000070 0.462889 0.130753 243.15 267.54 1.001
r(A<->T){all} 0.171221 0.020153 0.000133 0.446188 0.134815 245.89 260.06 1.008
r(C<->G){all} 0.170532 0.019831 0.000130 0.454825 0.136755 159.59 238.25 1.011
r(C<->T){all} 0.164816 0.018745 0.000036 0.441876 0.129772 288.52 294.51 1.002
r(G<->T){all} 0.163707 0.019142 0.000076 0.446530 0.128336 204.82 230.47 1.000
pi(A){all} 0.236539 0.000315 0.201919 0.270991 0.236609 1381.22 1441.11 1.002
pi(C){all} 0.368492 0.000400 0.331804 0.410661 0.367788 1461.13 1477.61 1.000
pi(G){all} 0.233863 0.000295 0.199498 0.267437 0.233546 1132.83 1233.42 1.000
pi(T){all} 0.161106 0.000225 0.131155 0.189134 0.160887 1333.50 1417.25 1.000
alpha{1,2} 0.418773 0.235490 0.000134 1.423934 0.243525 1333.85 1345.62 1.000
alpha{3} 0.454099 0.226179 0.000133 1.402378 0.298590 1110.85 1305.92 1.000
pinvar{all} 0.997268 0.000011 0.991167 0.999999 0.998338 1068.61 1279.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -753.341805
Model 2: PositiveSelection -753.341655
Model 0: one-ratio -753.341655
Model 7: beta -753.341778
Model 8: beta&w>1 -753.341654
Model 0 vs 1 3.000000001520675E-4
Model 2 vs 1 3.000000001520675E-4
Model 8 vs 7 2.480000000559812E-4
>C1
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C2
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C3
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C4
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C5
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C6
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=195
C1 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C2 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C3 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C4 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C5 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C6 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
**************************************************
C1 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C2 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C3 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C4 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C5 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C6 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
**************************************************
C1 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C2 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C3 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C4 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C5 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C6 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
**************************************************
C1 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C2 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C3 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C4 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C5 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C6 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
*********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 195 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 195 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5850]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5850]--->[5850]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.479 Mb, Max= 30.737 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C2 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C3 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C4 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C5 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
C6 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
**************************************************
C1 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C2 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C3 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C4 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C5 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
C6 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
**************************************************
C1 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C2 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C3 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C4 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C5 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
C6 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
**************************************************
C1 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C2 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C3 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C4 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C5 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
C6 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
*********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
C2 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
C3 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
C4 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
C5 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
C6 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
**************************************************
C1 CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
C2 CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
C3 CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
C4 CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
C5 CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
C6 CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
**************************************************
C1 GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
C2 GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
C3 GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
C4 GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
C5 GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
C6 GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
**************************************************
C1 GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
C2 GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
C3 GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
C4 GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
C5 GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
C6 GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
**************************************************
C1 GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
C2 GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
C3 GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
C4 GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
C5 GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
C6 GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
**************************************************
C1 CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
C2 CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
C3 CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
C4 CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
C5 CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
C6 CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
**************************************************
C1 GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
C2 GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
C3 GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
C4 GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
C5 GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
C6 GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
**************************************************
C1 GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
C2 GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
C3 GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
C4 GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
C5 GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
C6 GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
**************************************************
C1 ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
C2 ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
C3 ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
C4 ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
C5 ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
C6 ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
**************************************************
C1 CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
C2 CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
C3 CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
C4 CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
C5 CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
C6 CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
**************************************************
C1 TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
C2 TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
C3 TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
C4 TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
C5 TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
C6 TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
**************************************************
C1 CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
C2 CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
C3 CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
C4 CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
C5 CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
C6 CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
***********************************
>C1
ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
>C2
ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
>C3
ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
>C4
ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
>C5
ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
>C6
ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA
CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA
GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA
GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT
GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC
CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT
GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT
GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT
ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC
CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG
TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT
CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
>C1
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C2
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C3
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C4
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C5
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
>C6
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 585 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579797809
Setting output file names to "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1685030868
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0545386360
Seed = 249853589
Swapseed = 1579797809
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1309.258054 -- -24.965149
Chain 2 -- -1309.258054 -- -24.965149
Chain 3 -- -1309.257980 -- -24.965149
Chain 4 -- -1309.257980 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1309.258054 -- -24.965149
Chain 2 -- -1309.257980 -- -24.965149
Chain 3 -- -1309.258054 -- -24.965149
Chain 4 -- -1309.257854 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1309.258] (-1309.258) (-1309.258) (-1309.258) * [-1309.258] (-1309.258) (-1309.258) (-1309.258)
500 -- (-801.668) [-809.128] (-795.409) (-807.551) * (-804.893) [-797.884] (-796.761) (-820.237) -- 0:00:00
1000 -- (-810.072) (-799.433) (-792.810) [-794.160] * (-797.207) (-799.050) (-791.910) [-798.193] -- 0:00:00
1500 -- (-798.059) [-795.230] (-799.174) (-794.375) * [-808.130] (-795.843) (-797.436) (-795.153) -- 0:00:00
2000 -- (-793.981) [-794.284] (-795.667) (-797.756) * [-791.452] (-798.608) (-799.616) (-805.225) -- 0:00:00
2500 -- [-797.867] (-799.542) (-796.332) (-798.397) * (-796.762) (-793.035) (-802.043) [-793.455] -- 0:00:00
3000 -- (-796.141) (-793.240) (-791.449) [-798.810] * (-794.997) [-795.424] (-812.325) (-804.142) -- 0:00:00
3500 -- (-794.779) [-799.191] (-795.319) (-798.308) * (-798.755) (-798.599) (-797.328) [-794.980] -- 0:00:00
4000 -- (-795.888) (-795.983) [-793.485] (-799.983) * (-798.860) [-791.540] (-804.910) (-806.804) -- 0:00:00
4500 -- [-799.733] (-813.239) (-799.123) (-796.859) * (-797.878) (-802.133) [-801.154] (-801.131) -- 0:00:00
5000 -- [-798.847] (-798.426) (-801.588) (-798.885) * (-793.766) (-806.581) [-795.344] (-799.477) -- 0:00:00
Average standard deviation of split frequencies: 0.090973
5500 -- (-801.374) (-795.185) [-791.496] (-799.400) * (-798.836) [-793.200] (-792.453) (-798.217) -- 0:00:00
6000 -- (-803.712) (-808.210) (-792.398) [-792.313] * [-794.519] (-795.184) (-807.878) (-799.913) -- 0:00:00
6500 -- (-792.883) (-803.348) (-807.392) [-798.862] * [-801.798] (-798.290) (-793.468) (-807.612) -- 0:00:00
7000 -- (-797.675) (-793.329) [-797.503] (-798.459) * (-798.222) (-789.907) [-785.612] (-800.317) -- 0:00:00
7500 -- (-796.751) (-796.406) [-796.611] (-797.581) * [-794.481] (-794.838) (-790.932) (-801.203) -- 0:00:00
8000 -- (-800.365) [-798.247] (-805.352) (-797.435) * (-804.026) (-800.793) (-792.451) [-796.554] -- 0:00:00
8500 -- (-797.730) (-796.337) (-788.425) [-796.798] * (-801.846) (-796.137) (-790.615) [-797.938] -- 0:00:00
9000 -- (-801.487) (-795.767) [-786.565] (-797.744) * (-798.963) (-803.181) (-789.804) [-797.595] -- 0:00:00
9500 -- (-797.758) (-797.755) (-786.792) [-799.174] * (-803.768) (-797.922) [-787.479] (-795.101) -- 0:00:00
10000 -- [-798.075] (-800.069) (-786.470) (-796.335) * (-806.193) (-794.661) (-786.610) [-795.055] -- 0:00:00
Average standard deviation of split frequencies: 0.054717
10500 -- (-801.431) (-798.053) [-789.659] (-797.367) * (-812.394) (-793.679) [-789.240] (-797.074) -- 0:00:00
11000 -- (-797.028) (-796.997) (-787.703) [-798.231] * (-800.278) (-795.675) (-788.307) [-790.779] -- 0:00:00
11500 -- (-798.809) (-800.605) [-785.700] (-799.647) * (-800.234) (-800.649) (-786.835) [-796.745] -- 0:00:00
12000 -- (-793.988) [-796.180] (-786.362) (-798.016) * (-802.113) (-798.432) [-788.351] (-798.463) -- 0:00:00
12500 -- [-798.233] (-809.313) (-787.367) (-804.997) * [-800.761] (-797.461) (-787.631) (-794.532) -- 0:00:00
13000 -- (-796.976) (-790.176) [-786.180] (-794.997) * (-796.544) [-799.448] (-785.865) (-794.640) -- 0:00:00
13500 -- [-797.649] (-788.283) (-786.863) (-793.493) * (-796.611) [-791.158] (-792.218) (-796.303) -- 0:00:00
14000 -- (-796.322) [-787.229] (-788.063) (-795.958) * (-789.345) (-801.042) [-788.446] (-815.381) -- 0:00:00
14500 -- (-807.711) (-786.312) (-786.941) [-801.839] * (-788.610) (-795.406) (-787.849) [-795.909] -- 0:01:07
15000 -- [-797.658] (-786.862) (-789.376) (-805.393) * (-786.801) [-799.477] (-786.590) (-795.560) -- 0:01:05
Average standard deviation of split frequencies: 0.052723
15500 -- (-801.102) [-786.951] (-787.929) (-793.535) * [-788.630] (-795.514) (-792.338) (-792.831) -- 0:01:03
16000 -- (-798.301) (-788.750) (-788.365) [-794.753] * [-787.496] (-796.537) (-789.724) (-801.269) -- 0:01:01
16500 -- (-792.160) [-787.942] (-787.067) (-801.178) * (-785.802) [-800.745] (-789.903) (-792.037) -- 0:00:59
17000 -- [-802.820] (-795.439) (-791.460) (-801.598) * (-787.314) [-796.194] (-789.443) (-799.328) -- 0:00:57
17500 -- (-792.865) (-788.273) (-787.329) [-793.480] * (-789.303) (-794.496) (-786.878) [-789.720] -- 0:00:56
18000 -- (-792.092) (-789.703) [-787.961] (-794.549) * (-786.275) (-799.600) [-786.094] (-801.817) -- 0:00:54
18500 -- (-798.008) (-787.299) (-788.556) [-799.159] * (-787.895) (-799.387) (-786.341) [-794.399] -- 0:00:53
19000 -- (-792.011) (-788.368) (-789.809) [-794.665] * (-786.479) [-794.075] (-786.287) (-792.628) -- 0:00:51
19500 -- (-801.831) (-789.680) (-788.789) [-799.921] * (-788.440) (-800.589) [-786.866] (-792.676) -- 0:00:50
20000 -- (-801.380) [-787.718] (-786.800) (-796.283) * (-788.485) [-798.043] (-786.434) (-801.913) -- 0:00:49
Average standard deviation of split frequencies: 0.045620
20500 -- (-814.836) (-788.596) (-786.088) [-796.410] * (-791.497) (-792.259) [-786.676] (-797.448) -- 0:00:47
21000 -- [-790.702] (-787.905) (-786.736) (-799.976) * [-793.217] (-797.460) (-787.104) (-792.169) -- 0:00:46
21500 -- (-788.065) (-787.591) [-785.473] (-796.034) * (-796.033) (-790.896) (-786.878) [-793.218] -- 0:00:45
22000 -- [-786.831] (-791.621) (-788.010) (-800.974) * (-791.777) [-786.240] (-790.483) (-793.476) -- 0:00:44
22500 -- (-786.887) (-789.318) [-790.443] (-801.043) * (-787.541) [-785.584] (-786.951) (-794.377) -- 0:00:43
23000 -- [-786.189] (-789.842) (-786.715) (-808.633) * (-792.597) (-788.415) [-786.389] (-795.210) -- 0:00:42
23500 -- (-786.044) (-791.411) [-787.127] (-803.867) * (-790.557) [-787.425] (-785.794) (-800.881) -- 0:00:41
24000 -- (-786.848) (-786.463) (-789.035) [-798.669] * (-786.383) (-788.843) [-786.887] (-798.098) -- 0:00:40
24500 -- (-788.612) [-787.042] (-785.699) (-796.670) * [-786.210] (-792.563) (-792.219) (-803.667) -- 0:00:39
25000 -- (-787.500) (-792.188) (-786.789) [-796.394] * (-787.176) (-788.529) (-790.342) [-798.084] -- 0:00:39
Average standard deviation of split frequencies: 0.037989
25500 -- (-788.140) [-787.456] (-787.593) (-793.337) * (-788.095) (-788.844) [-788.777] (-791.825) -- 0:00:38
26000 -- (-789.760) [-787.394] (-787.651) (-802.340) * (-787.847) (-786.837) (-786.933) [-787.411] -- 0:00:37
26500 -- (-788.567) [-787.043] (-786.300) (-795.576) * [-786.373] (-788.868) (-788.854) (-788.462) -- 0:00:36
27000 -- [-785.612] (-786.521) (-785.871) (-798.763) * [-786.961] (-786.496) (-790.587) (-788.441) -- 0:00:36
27500 -- (-787.141) (-786.226) (-786.298) [-795.299] * [-787.729] (-786.577) (-787.378) (-787.475) -- 0:00:35
28000 -- (-786.382) (-790.351) (-785.922) [-798.353] * (-787.190) (-786.160) (-786.887) [-786.661] -- 0:00:34
28500 -- (-787.361) (-790.982) [-785.753] (-797.637) * [-785.806] (-786.429) (-790.001) (-786.592) -- 0:00:34
29000 -- [-786.652] (-786.684) (-786.040) (-796.439) * [-787.651] (-788.432) (-789.868) (-786.455) -- 0:00:33
29500 -- (-795.623) (-786.631) (-787.732) [-798.473] * (-787.518) (-787.195) (-792.941) [-786.729] -- 0:00:32
30000 -- (-787.175) (-786.384) [-787.608] (-795.788) * [-789.167] (-788.393) (-787.757) (-788.017) -- 0:00:32
Average standard deviation of split frequencies: 0.039198
30500 -- (-788.039) (-786.970) [-788.473] (-798.704) * (-786.736) [-787.783] (-788.559) (-788.778) -- 0:00:31
31000 -- (-787.995) (-788.773) (-796.905) [-795.301] * (-787.543) (-787.451) [-786.531] (-786.440) -- 0:00:31
31500 -- [-786.478] (-786.889) (-786.500) (-790.538) * (-797.620) (-788.202) [-787.590] (-790.266) -- 0:01:01
32000 -- (-787.521) (-787.722) (-791.243) [-795.864] * (-787.422) (-786.400) (-786.578) [-787.493] -- 0:01:00
32500 -- (-787.293) (-787.024) (-786.887) [-792.570] * (-787.536) (-790.420) [-786.976] (-786.616) -- 0:00:59
33000 -- (-788.137) (-790.814) [-788.820] (-799.965) * (-787.355) [-793.130] (-786.376) (-786.511) -- 0:00:58
33500 -- (-786.196) (-789.701) (-789.627) [-802.431] * (-787.818) (-790.055) [-787.359] (-787.355) -- 0:00:57
34000 -- (-787.920) (-790.701) [-788.819] (-799.610) * (-786.462) [-785.961] (-791.365) (-787.088) -- 0:00:56
34500 -- (-786.243) [-789.662] (-787.271) (-794.178) * (-785.782) (-785.853) [-786.145] (-786.798) -- 0:00:55
35000 -- [-786.448] (-788.058) (-786.593) (-797.930) * (-790.326) [-788.366] (-787.575) (-786.779) -- 0:00:55
Average standard deviation of split frequencies: 0.036166
35500 -- (-787.120) [-788.152] (-788.867) (-796.968) * (-788.199) [-785.690] (-786.569) (-789.427) -- 0:00:54
36000 -- (-789.003) (-791.384) (-786.865) [-801.587] * [-790.315] (-786.326) (-787.247) (-789.179) -- 0:00:53
36500 -- [-786.709] (-788.739) (-788.683) (-796.638) * [-794.112] (-787.662) (-790.876) (-786.647) -- 0:00:52
37000 -- (-791.118) (-786.082) [-787.074] (-794.156) * (-789.680) (-789.185) [-789.920] (-785.354) -- 0:00:52
37500 -- (-787.672) [-785.580] (-786.207) (-798.830) * [-789.607] (-790.291) (-787.740) (-786.553) -- 0:00:51
38000 -- [-786.896] (-786.736) (-787.752) (-795.118) * (-789.797) [-790.484] (-787.497) (-791.603) -- 0:00:50
38500 -- [-788.908] (-786.680) (-786.674) (-796.405) * (-790.445) (-787.321) (-787.759) [-786.352] -- 0:00:49
39000 -- (-788.353) [-788.392] (-787.515) (-795.883) * (-790.257) (-790.950) [-787.847] (-785.983) -- 0:00:49
39500 -- (-788.166) (-786.753) (-787.315) [-797.403] * (-788.237) (-789.242) (-788.369) [-786.124] -- 0:00:48
40000 -- (-787.983) (-787.122) [-786.064] (-800.904) * (-786.491) (-788.849) (-787.807) [-786.454] -- 0:00:48
Average standard deviation of split frequencies: 0.025014
40500 -- (-788.658) (-786.502) (-786.614) [-805.612] * [-788.322] (-787.553) (-789.073) (-787.981) -- 0:00:47
41000 -- (-787.735) (-787.214) [-785.989] (-799.966) * (-786.470) (-787.784) [-787.098] (-788.344) -- 0:00:46
41500 -- [-786.395] (-788.324) (-789.311) (-801.639) * (-792.840) [-788.866] (-787.611) (-787.809) -- 0:00:46
42000 -- (-787.711) (-788.835) (-786.450) [-796.932] * [-788.272] (-789.036) (-787.895) (-787.651) -- 0:00:45
42500 -- [-787.516] (-791.414) (-786.592) (-794.512) * [-789.518] (-788.038) (-786.376) (-789.666) -- 0:00:45
43000 -- (-788.127) (-787.782) (-786.670) [-792.701] * (-786.092) (-791.524) (-787.101) [-790.087] -- 0:00:44
43500 -- (-789.086) [-787.183] (-787.275) (-810.837) * (-786.182) (-786.766) (-789.344) [-787.494] -- 0:00:43
44000 -- (-787.207) (-786.975) [-788.207] (-786.874) * (-786.519) (-788.756) (-788.522) [-785.700] -- 0:00:43
44500 -- (-788.896) (-788.648) (-787.343) [-785.683] * (-787.236) (-786.890) (-793.231) [-785.704] -- 0:00:42
45000 -- (-787.225) (-790.264) [-787.082] (-787.606) * [-789.003] (-786.575) (-790.536) (-786.070) -- 0:00:42
Average standard deviation of split frequencies: 0.025107
45500 -- [-786.626] (-788.063) (-788.852) (-787.652) * (-787.964) [-787.713] (-786.962) (-787.704) -- 0:00:41
46000 -- (-788.091) (-788.377) (-791.261) [-787.559] * (-787.771) (-789.713) (-786.736) [-785.751] -- 0:00:41
46500 -- (-788.872) [-792.524] (-787.486) (-787.197) * (-788.481) (-788.154) (-788.141) [-785.726] -- 0:00:41
47000 -- (-785.812) (-787.324) [-787.676] (-787.293) * [-786.792] (-788.674) (-787.267) (-789.662) -- 0:00:40
47500 -- (-786.114) (-786.824) (-786.361) [-785.975] * (-787.970) (-787.739) [-787.956] (-788.438) -- 0:00:40
48000 -- (-786.351) (-785.775) [-787.395] (-787.645) * [-788.331] (-787.295) (-788.963) (-790.892) -- 0:00:39
48500 -- (-792.619) [-787.506] (-788.284) (-788.272) * (-788.648) (-789.682) (-786.331) [-788.898] -- 0:00:58
49000 -- [-791.281] (-789.596) (-787.011) (-789.860) * [-786.111] (-786.611) (-787.800) (-790.090) -- 0:00:58
49500 -- (-788.181) (-787.396) (-787.027) [-787.956] * (-786.653) (-786.410) [-788.704] (-791.178) -- 0:00:57
50000 -- [-786.613] (-788.653) (-787.871) (-787.485) * (-789.542) (-786.267) (-787.807) [-789.557] -- 0:00:57
Average standard deviation of split frequencies: 0.025798
50500 -- (-788.308) [-787.686] (-789.778) (-790.403) * (-791.393) (-786.067) (-790.835) [-792.677] -- 0:00:56
51000 -- [-785.985] (-789.628) (-787.104) (-787.071) * (-789.015) [-785.805] (-789.000) (-789.262) -- 0:00:55
51500 -- [-786.106] (-786.467) (-787.603) (-791.382) * (-786.585) [-787.154] (-791.338) (-790.435) -- 0:00:55
52000 -- (-787.708) (-785.877) (-786.954) [-785.720] * (-787.307) (-787.653) [-787.855] (-790.060) -- 0:00:54
52500 -- [-787.725] (-789.634) (-787.725) (-785.932) * (-786.597) [-785.763] (-788.410) (-786.820) -- 0:00:54
53000 -- (-787.555) (-789.940) [-787.015] (-786.415) * (-786.422) [-785.878] (-787.384) (-786.600) -- 0:00:53
53500 -- (-788.174) (-787.722) (-787.957) [-786.561] * [-786.440] (-785.661) (-789.695) (-787.171) -- 0:00:53
54000 -- [-787.489] (-786.725) (-787.919) (-786.177) * (-786.391) [-787.196] (-788.898) (-787.433) -- 0:00:52
54500 -- (-791.896) [-789.732] (-788.804) (-788.690) * (-786.058) (-786.042) [-796.798] (-787.387) -- 0:00:52
55000 -- (-787.409) (-786.244) (-785.979) [-787.800] * (-791.448) [-789.244] (-788.802) (-786.158) -- 0:00:51
Average standard deviation of split frequencies: 0.019494
55500 -- (-790.206) [-785.736] (-791.026) (-787.624) * (-789.821) (-790.063) (-792.580) [-786.529] -- 0:00:51
56000 -- [-788.318] (-785.866) (-786.975) (-788.506) * (-790.252) (-787.878) (-788.392) [-789.673] -- 0:00:50
56500 -- (-786.127) [-786.197] (-786.045) (-787.152) * [-789.088] (-787.814) (-789.741) (-789.829) -- 0:00:50
57000 -- (-790.781) (-785.913) (-786.594) [-786.984] * (-790.132) (-788.783) (-789.183) [-787.775] -- 0:00:49
57500 -- (-792.633) (-786.071) [-786.773] (-786.731) * [-788.227] (-787.415) (-786.564) (-790.237) -- 0:00:49
58000 -- (-787.515) (-786.759) (-787.796) [-787.074] * (-790.048) (-787.494) (-789.711) [-792.169] -- 0:00:48
58500 -- (-791.158) (-786.389) [-785.823] (-789.274) * [-788.153] (-787.998) (-787.492) (-791.943) -- 0:00:48
59000 -- (-788.151) (-785.898) (-787.388) [-786.830] * (-787.760) (-788.194) [-788.570] (-788.110) -- 0:00:47
59500 -- (-787.074) (-793.570) [-787.224] (-785.834) * [-790.866] (-787.683) (-787.143) (-788.010) -- 0:00:47
60000 -- (-787.297) (-786.568) [-786.279] (-787.142) * (-790.439) [-788.114] (-786.702) (-791.007) -- 0:00:47
Average standard deviation of split frequencies: 0.018563
60500 -- (-787.783) (-786.531) [-787.292] (-787.004) * (-794.890) (-786.839) [-789.153] (-788.769) -- 0:00:46
61000 -- (-787.583) (-789.489) (-788.746) [-786.716] * (-790.212) [-787.939] (-789.147) (-787.161) -- 0:00:46
61500 -- [-788.689] (-788.981) (-787.974) (-788.759) * [-788.916] (-785.764) (-787.492) (-786.764) -- 0:00:45
62000 -- [-793.834] (-788.494) (-788.103) (-787.289) * (-787.665) (-790.454) [-788.829] (-787.530) -- 0:00:45
62500 -- (-786.494) [-787.677] (-790.059) (-787.074) * (-789.756) [-786.907] (-789.756) (-787.904) -- 0:00:45
63000 -- [-788.700] (-790.083) (-794.939) (-790.621) * [-789.363] (-787.069) (-795.859) (-786.439) -- 0:00:44
63500 -- [-787.182] (-792.144) (-792.117) (-787.812) * [-785.777] (-787.240) (-790.098) (-787.124) -- 0:00:44
64000 -- (-788.480) (-786.094) [-787.155] (-787.304) * [-789.258] (-787.777) (-788.964) (-787.762) -- 0:00:43
64500 -- (-787.205) [-787.090] (-787.268) (-785.724) * (-788.641) [-786.948] (-788.964) (-788.473) -- 0:00:43
65000 -- (-788.081) (-786.279) [-786.995] (-787.336) * (-788.089) [-786.007] (-786.618) (-786.482) -- 0:00:57
Average standard deviation of split frequencies: 0.021768
65500 -- (-795.874) (-785.543) [-787.801] (-786.877) * [-786.305] (-786.281) (-786.635) (-785.986) -- 0:00:57
66000 -- (-790.210) (-786.695) (-789.092) [-786.207] * (-786.329) [-786.462] (-785.632) (-787.101) -- 0:00:56
66500 -- (-787.373) [-786.963] (-787.633) (-788.067) * (-789.422) (-786.585) [-787.124] (-787.785) -- 0:00:56
67000 -- (-791.357) (-788.033) (-786.495) [-785.914] * (-790.152) (-786.497) (-787.235) [-788.173] -- 0:00:55
67500 -- (-788.864) (-788.993) (-787.113) [-788.043] * (-789.926) [-786.200] (-786.604) (-787.295) -- 0:00:55
68000 -- (-788.549) (-786.745) [-786.654] (-787.241) * (-790.253) (-785.991) [-789.419] (-786.416) -- 0:00:54
68500 -- [-788.142] (-786.747) (-786.467) (-786.752) * (-790.085) [-785.940] (-786.905) (-786.236) -- 0:00:54
69000 -- (-788.008) [-788.380] (-787.127) (-787.329) * [-786.499] (-786.422) (-786.913) (-792.175) -- 0:00:53
69500 -- (-789.306) [-787.893] (-788.261) (-789.060) * (-788.735) (-791.262) [-786.074] (-789.002) -- 0:00:53
70000 -- (-788.687) [-787.534] (-789.563) (-789.700) * (-786.861) [-791.419] (-789.372) (-787.026) -- 0:00:53
Average standard deviation of split frequencies: 0.025730
70500 -- (-788.995) (-786.390) [-788.057] (-787.548) * (-786.842) (-786.830) (-787.139) [-786.954] -- 0:00:52
71000 -- (-789.187) (-786.134) (-790.128) [-788.249] * (-788.252) (-787.461) [-786.651] (-787.566) -- 0:00:52
71500 -- (-787.680) (-788.194) (-787.211) [-786.083] * (-787.205) (-786.445) [-786.413] (-788.735) -- 0:00:51
72000 -- [-787.615] (-785.506) (-785.884) (-786.909) * (-786.660) [-786.257] (-788.958) (-788.855) -- 0:00:51
72500 -- (-787.317) [-786.593] (-788.670) (-787.217) * (-787.804) (-788.736) (-788.726) [-791.681] -- 0:00:51
73000 -- (-785.608) [-789.952] (-790.542) (-786.129) * (-787.761) [-789.983] (-788.063) (-788.740) -- 0:00:50
73500 -- [-786.027] (-789.931) (-788.503) (-788.207) * (-789.560) (-791.033) (-787.799) [-785.876] -- 0:00:50
74000 -- [-786.768] (-793.460) (-789.188) (-787.404) * (-787.628) (-790.234) (-787.180) [-785.708] -- 0:00:50
74500 -- [-786.540] (-787.357) (-788.518) (-788.789) * [-788.712] (-791.834) (-786.887) (-785.841) -- 0:00:49
75000 -- [-791.115] (-786.660) (-788.777) (-787.620) * (-787.066) (-790.508) [-789.696] (-790.101) -- 0:00:49
Average standard deviation of split frequencies: 0.025401
75500 -- [-787.542] (-789.583) (-788.094) (-787.652) * (-789.323) (-786.594) [-786.911] (-788.332) -- 0:00:48
76000 -- (-788.647) [-787.976] (-788.466) (-793.567) * (-786.868) [-787.677] (-788.127) (-787.156) -- 0:00:48
76500 -- (-789.075) (-788.528) [-786.196] (-790.607) * (-789.088) [-787.157] (-788.553) (-788.714) -- 0:00:48
77000 -- (-787.643) [-791.010] (-787.788) (-785.948) * (-788.714) (-785.528) [-791.175] (-786.289) -- 0:00:47
77500 -- (-789.531) [-788.257] (-787.797) (-787.864) * (-786.092) (-785.579) (-790.061) [-787.069] -- 0:00:47
78000 -- (-791.719) (-786.994) (-786.864) [-785.691] * (-787.242) (-788.839) [-788.936] (-785.837) -- 0:00:47
78500 -- [-787.980] (-786.493) (-787.478) (-787.063) * (-787.581) (-787.211) (-787.653) [-785.472] -- 0:00:46
79000 -- [-786.492] (-786.923) (-786.989) (-787.190) * (-787.623) [-787.371] (-786.939) (-785.431) -- 0:00:46
79500 -- (-787.333) [-787.423] (-786.838) (-789.685) * (-791.698) (-785.632) [-790.792] (-791.571) -- 0:00:46
80000 -- [-788.203] (-788.423) (-786.911) (-787.309) * [-786.261] (-787.278) (-789.479) (-786.901) -- 0:00:46
Average standard deviation of split frequencies: 0.023960
80500 -- (-786.044) (-787.340) [-787.827] (-789.814) * [-787.009] (-788.734) (-786.984) (-786.580) -- 0:00:45
81000 -- (-788.138) (-789.640) [-787.048] (-786.901) * [-787.323] (-790.240) (-787.128) (-785.947) -- 0:00:45
81500 -- (-787.573) (-788.322) [-791.488] (-786.595) * [-786.345] (-792.881) (-787.891) (-785.947) -- 0:00:45
82000 -- (-786.731) (-789.114) (-788.123) [-787.215] * (-789.620) [-788.888] (-786.138) (-785.464) -- 0:00:55
82500 -- (-787.183) [-787.882] (-788.737) (-788.776) * (-789.907) (-790.408) (-787.584) [-785.345] -- 0:00:55
83000 -- (-786.689) (-787.020) (-788.171) [-787.169] * (-789.091) [-786.363] (-788.150) (-786.313) -- 0:00:55
83500 -- (-786.378) (-786.461) (-786.112) [-786.625] * (-788.135) [-788.828] (-786.661) (-787.892) -- 0:00:54
84000 -- (-786.022) (-785.878) (-788.798) [-788.146] * [-786.451] (-788.017) (-791.478) (-786.008) -- 0:00:54
84500 -- (-789.163) [-788.217] (-787.744) (-787.567) * (-786.699) (-786.625) (-787.471) [-786.239] -- 0:00:54
85000 -- (-789.900) [-787.361] (-787.298) (-788.688) * (-788.307) [-788.787] (-787.095) (-786.267) -- 0:00:53
Average standard deviation of split frequencies: 0.024071
85500 -- (-787.517) (-787.629) (-787.884) [-786.258] * [-790.481] (-787.274) (-785.803) (-785.754) -- 0:00:53
86000 -- (-788.686) [-789.352] (-787.737) (-788.654) * (-789.584) (-789.128) (-786.684) [-786.133] -- 0:00:53
86500 -- (-791.035) (-790.084) [-787.457] (-788.074) * [-787.919] (-790.299) (-785.802) (-786.405) -- 0:00:52
87000 -- (-788.197) (-787.976) [-787.048] (-787.892) * (-786.744) (-787.974) (-787.337) [-785.921] -- 0:00:52
87500 -- [-786.271] (-786.738) (-788.163) (-790.689) * (-787.386) (-787.789) [-785.425] (-786.805) -- 0:00:52
88000 -- (-792.950) (-789.830) [-787.082] (-790.109) * [-786.432] (-787.339) (-785.484) (-786.784) -- 0:00:51
88500 -- (-793.832) (-790.689) [-788.731] (-787.968) * [-786.124] (-788.348) (-786.786) (-786.354) -- 0:00:51
89000 -- (-788.108) [-789.100] (-786.320) (-787.492) * [-786.289] (-789.260) (-787.803) (-787.378) -- 0:00:51
89500 -- (-790.754) [-788.213] (-786.294) (-786.224) * [-786.955] (-789.789) (-789.940) (-787.478) -- 0:00:50
90000 -- [-789.769] (-792.000) (-788.859) (-788.009) * [-786.725] (-789.696) (-787.286) (-786.206) -- 0:00:50
Average standard deviation of split frequencies: 0.025771
90500 -- (-789.175) (-788.946) [-787.539] (-793.020) * [-787.060] (-790.109) (-786.706) (-786.523) -- 0:00:50
91000 -- [-787.256] (-788.348) (-787.862) (-786.924) * (-790.023) (-786.065) [-786.146] (-787.851) -- 0:00:49
91500 -- (-789.441) (-788.135) [-789.431] (-786.079) * (-787.681) (-786.697) [-788.216] (-786.942) -- 0:00:49
92000 -- (-786.978) (-790.727) [-788.446] (-785.895) * (-786.428) [-785.667] (-787.789) (-790.410) -- 0:00:49
92500 -- (-788.163) (-792.362) (-786.753) [-788.682] * [-788.026] (-785.626) (-787.234) (-789.566) -- 0:00:49
93000 -- [-786.014] (-786.006) (-788.388) (-787.688) * [-786.233] (-788.296) (-787.777) (-789.815) -- 0:00:48
93500 -- (-786.133) [-787.036] (-788.178) (-785.785) * (-786.077) [-789.966] (-786.497) (-790.874) -- 0:00:48
94000 -- (-787.535) (-789.487) (-786.826) [-785.638] * [-787.784] (-788.969) (-786.257) (-790.788) -- 0:00:48
94500 -- (-786.290) (-789.839) (-788.130) [-786.154] * [-788.650] (-788.873) (-786.410) (-787.242) -- 0:00:47
95000 -- (-787.170) (-792.398) [-789.725] (-787.463) * (-793.670) [-787.679] (-790.140) (-788.277) -- 0:00:47
Average standard deviation of split frequencies: 0.028060
95500 -- (-786.854) (-788.892) [-788.284] (-787.578) * (-786.888) [-787.858] (-786.611) (-787.346) -- 0:00:47
96000 -- [-786.616] (-788.353) (-787.535) (-789.439) * [-785.877] (-791.614) (-786.723) (-786.166) -- 0:00:47
96500 -- [-787.949] (-786.020) (-789.492) (-788.882) * (-785.649) [-789.661] (-788.495) (-786.985) -- 0:00:46
97000 -- [-790.750] (-789.766) (-788.117) (-788.749) * (-786.948) [-787.776] (-787.047) (-786.097) -- 0:00:46
97500 -- [-788.425] (-787.719) (-789.285) (-795.653) * (-789.007) [-788.234] (-787.017) (-786.156) -- 0:00:46
98000 -- (-790.760) [-786.859] (-787.771) (-790.063) * [-787.384] (-786.831) (-788.869) (-789.244) -- 0:00:46
98500 -- (-789.041) (-787.949) [-786.639] (-791.201) * (-787.845) (-789.121) (-790.962) [-786.833] -- 0:00:45
99000 -- (-789.303) (-787.939) [-785.859] (-788.671) * (-788.275) (-791.331) (-791.484) [-788.255] -- 0:00:54
99500 -- (-788.676) (-788.690) [-789.776] (-787.842) * (-785.836) (-786.453) [-785.624] (-787.277) -- 0:00:54
100000 -- (-786.753) (-795.586) (-787.339) [-786.337] * (-785.770) (-786.032) [-787.921] (-787.949) -- 0:00:54
Average standard deviation of split frequencies: 0.026926
100500 -- (-788.114) (-791.409) (-787.519) [-786.493] * [-786.164] (-790.567) (-790.006) (-788.600) -- 0:00:53
101000 -- (-788.379) (-788.885) (-786.477) [-791.147] * [-786.746] (-786.524) (-787.488) (-788.202) -- 0:00:53
101500 -- (-787.954) [-787.816] (-786.656) (-790.228) * [-786.911] (-785.588) (-786.456) (-787.702) -- 0:00:53
102000 -- (-788.303) (-786.095) (-787.787) [-788.906] * (-786.881) (-785.588) [-787.977] (-789.334) -- 0:00:52
102500 -- (-789.943) [-788.787] (-788.247) (-788.166) * (-789.965) (-785.555) [-787.659] (-789.012) -- 0:00:52
103000 -- (-788.642) (-786.314) [-788.914] (-788.277) * [-789.926] (-785.775) (-792.103) (-788.769) -- 0:00:52
103500 -- [-788.039] (-786.672) (-787.612) (-786.543) * [-787.756] (-786.716) (-790.936) (-787.878) -- 0:00:51
104000 -- [-786.343] (-789.031) (-789.652) (-789.560) * (-786.890) [-786.873] (-791.010) (-788.074) -- 0:00:51
104500 -- (-788.084) (-785.893) (-788.434) [-788.380] * (-787.434) [-788.481] (-787.715) (-786.630) -- 0:00:51
105000 -- [-788.095] (-793.479) (-788.263) (-788.225) * (-788.176) [-789.602] (-788.401) (-787.062) -- 0:00:51
Average standard deviation of split frequencies: 0.026683
105500 -- [-786.743] (-787.498) (-788.744) (-788.293) * (-786.583) (-786.640) (-787.352) [-788.144] -- 0:00:50
106000 -- [-789.793] (-787.385) (-788.002) (-788.516) * (-788.434) (-789.394) [-786.221] (-788.155) -- 0:00:50
106500 -- [-791.353] (-788.046) (-785.728) (-793.419) * [-789.548] (-793.541) (-786.708) (-789.275) -- 0:00:50
107000 -- (-792.176) [-786.967] (-786.737) (-792.862) * (-791.672) (-794.750) [-786.627] (-785.875) -- 0:00:50
107500 -- (-789.878) (-786.076) [-786.333] (-791.933) * [-788.448] (-793.849) (-791.737) (-786.307) -- 0:00:49
108000 -- (-789.792) [-786.423] (-788.520) (-789.244) * (-787.649) (-786.661) [-786.952] (-788.266) -- 0:00:49
108500 -- (-788.026) [-786.052] (-791.475) (-789.436) * (-786.327) (-787.215) (-786.373) [-788.675] -- 0:00:49
109000 -- (-786.809) [-787.013] (-796.263) (-787.647) * (-786.879) [-787.034] (-791.131) (-790.384) -- 0:00:49
109500 -- (-788.162) [-785.814] (-792.161) (-791.485) * (-789.154) (-785.903) (-791.559) [-790.869] -- 0:00:48
110000 -- [-788.290] (-789.697) (-791.537) (-786.655) * [-789.277] (-785.731) (-789.247) (-788.055) -- 0:00:48
Average standard deviation of split frequencies: 0.026167
110500 -- [-787.300] (-785.619) (-789.533) (-793.053) * (-785.995) [-790.847] (-786.980) (-786.943) -- 0:00:48
111000 -- (-788.393) [-785.668] (-786.613) (-791.031) * (-786.070) [-786.608] (-786.352) (-789.123) -- 0:00:48
111500 -- [-787.856] (-785.743) (-787.033) (-794.348) * (-788.112) [-790.206] (-786.793) (-788.462) -- 0:00:47
112000 -- [-786.517] (-785.792) (-787.450) (-791.350) * [-787.254] (-787.310) (-786.793) (-789.618) -- 0:00:47
112500 -- (-786.485) (-787.599) [-788.413] (-793.255) * [-787.400] (-787.395) (-786.354) (-787.770) -- 0:00:47
113000 -- [-790.191] (-785.987) (-785.407) (-786.398) * (-787.718) (-787.077) [-786.348] (-787.075) -- 0:00:47
113500 -- (-789.344) [-787.374] (-787.294) (-788.557) * (-789.092) (-786.901) (-790.218) [-787.237] -- 0:00:46
114000 -- [-788.768] (-787.683) (-786.779) (-786.136) * (-789.155) (-786.019) (-786.999) [-786.851] -- 0:00:46
114500 -- (-790.906) (-788.208) [-786.028] (-788.066) * (-788.221) (-792.418) (-786.985) [-786.333] -- 0:00:46
115000 -- (-787.908) [-791.586] (-786.394) (-787.390) * (-789.603) (-796.591) [-785.948] (-789.323) -- 0:00:46
Average standard deviation of split frequencies: 0.025239
115500 -- [-786.003] (-789.414) (-796.137) (-786.619) * (-787.390) (-788.232) [-785.924] (-786.886) -- 0:00:53
116000 -- (-790.640) [-786.419] (-787.409) (-787.815) * (-790.344) (-790.268) [-788.685] (-787.825) -- 0:00:53
116500 -- (-790.474) [-788.708] (-789.563) (-787.554) * [-787.813] (-787.750) (-787.159) (-786.989) -- 0:00:53
117000 -- (-787.826) [-786.722] (-788.698) (-787.539) * (-787.245) (-791.200) [-788.079] (-787.191) -- 0:00:52
117500 -- (-786.570) (-787.808) (-786.195) [-790.470] * [-786.678] (-787.003) (-789.609) (-789.332) -- 0:00:52
118000 -- (-787.298) (-790.747) [-785.913] (-791.156) * (-786.699) (-789.783) (-788.018) [-787.630] -- 0:00:52
118500 -- (-786.428) [-791.935] (-788.511) (-786.206) * (-792.201) [-787.999] (-786.791) (-789.483) -- 0:00:52
119000 -- (-789.803) [-786.326] (-789.904) (-787.186) * (-786.951) (-787.657) (-788.638) [-786.618] -- 0:00:51
119500 -- [-789.241] (-785.775) (-786.472) (-787.501) * [-786.464] (-790.044) (-789.437) (-789.290) -- 0:00:51
120000 -- (-787.257) (-788.802) (-790.374) [-788.419] * (-786.198) [-787.238] (-791.009) (-793.455) -- 0:00:51
Average standard deviation of split frequencies: 0.024026
120500 -- (-787.153) (-790.163) [-787.537] (-790.135) * (-786.037) (-790.180) [-788.128] (-792.945) -- 0:00:51
121000 -- [-788.941] (-786.467) (-787.605) (-789.901) * (-787.375) (-786.480) (-787.678) [-787.565] -- 0:00:50
121500 -- (-793.300) (-788.486) [-788.695] (-786.781) * (-786.673) (-787.674) (-788.324) [-789.068] -- 0:00:50
122000 -- [-786.001] (-786.828) (-786.150) (-787.229) * (-789.050) (-786.379) [-786.846] (-789.869) -- 0:00:50
122500 -- (-789.221) (-786.975) (-787.330) [-785.551] * [-786.158] (-785.610) (-789.388) (-789.439) -- 0:00:50
123000 -- (-787.878) (-787.577) (-786.523) [-786.891] * [-788.193] (-786.338) (-789.733) (-788.089) -- 0:00:49
123500 -- (-787.895) (-793.189) [-785.986] (-788.587) * (-788.281) (-787.322) (-786.609) [-786.329] -- 0:00:49
124000 -- [-787.320] (-787.092) (-785.932) (-787.971) * [-786.669] (-792.334) (-787.575) (-786.620) -- 0:00:49
124500 -- (-787.849) [-786.271] (-786.620) (-788.755) * (-787.466) [-789.273] (-788.567) (-787.797) -- 0:00:49
125000 -- (-786.693) (-787.560) (-785.855) [-789.157] * (-786.671) [-787.822] (-792.023) (-787.725) -- 0:00:49
Average standard deviation of split frequencies: 0.021938
125500 -- (-788.619) (-792.612) (-791.036) [-786.648] * [-786.055] (-787.197) (-790.104) (-788.654) -- 0:00:48
126000 -- [-787.107] (-794.367) (-790.073) (-785.929) * (-786.006) [-786.514] (-786.532) (-791.491) -- 0:00:48
126500 -- (-787.819) (-791.343) (-788.362) [-787.227] * (-787.428) (-791.571) [-787.707] (-787.587) -- 0:00:48
127000 -- [-789.378] (-789.949) (-788.398) (-785.759) * [-788.169] (-790.161) (-789.004) (-787.548) -- 0:00:48
127500 -- (-792.192) (-787.560) [-785.502] (-786.396) * [-786.710] (-791.269) (-786.911) (-787.896) -- 0:00:47
128000 -- [-788.702] (-787.516) (-791.069) (-787.558) * (-786.445) [-790.149] (-786.692) (-789.870) -- 0:00:47
128500 -- (-788.475) (-788.722) [-788.468] (-793.473) * (-786.598) [-787.174] (-788.593) (-789.665) -- 0:00:47
129000 -- [-788.638] (-788.036) (-788.805) (-792.131) * (-786.902) (-792.267) (-792.124) [-787.776] -- 0:00:47
129500 -- (-788.348) (-787.717) (-787.280) [-786.113] * (-789.771) (-787.947) (-787.599) [-787.730] -- 0:00:47
130000 -- [-787.164] (-786.589) (-788.434) (-786.387) * [-788.143] (-786.335) (-787.976) (-786.682) -- 0:00:46
Average standard deviation of split frequencies: 0.017858
130500 -- [-785.842] (-786.588) (-789.875) (-787.037) * [-786.991] (-786.097) (-787.048) (-789.034) -- 0:00:46
131000 -- (-786.495) (-787.834) [-789.649] (-786.887) * (-786.305) (-787.856) (-787.325) [-787.995] -- 0:00:46
131500 -- (-787.362) [-789.945] (-786.672) (-786.737) * (-789.517) [-789.099] (-786.197) (-786.665) -- 0:00:46
132000 -- (-789.819) (-787.442) [-786.986] (-788.980) * (-789.688) (-794.003) [-787.159] (-786.369) -- 0:00:52
132500 -- (-787.935) [-786.145] (-787.112) (-787.295) * [-789.845] (-793.572) (-789.398) (-786.167) -- 0:00:52
133000 -- [-790.452] (-788.833) (-787.318) (-786.822) * (-789.830) [-787.907] (-787.136) (-785.517) -- 0:00:52
133500 -- (-785.811) [-790.755] (-786.465) (-788.712) * (-787.078) [-787.853] (-790.156) (-786.854) -- 0:00:51
134000 -- (-785.640) [-788.435] (-786.255) (-788.971) * [-787.017] (-786.552) (-786.891) (-788.567) -- 0:00:51
134500 -- (-785.657) (-787.474) (-786.890) [-786.394] * (-786.306) (-788.561) [-786.722] (-788.962) -- 0:00:51
135000 -- [-787.228] (-787.898) (-787.139) (-788.287) * (-788.755) (-787.336) (-791.193) [-786.622] -- 0:00:51
Average standard deviation of split frequencies: 0.019237
135500 -- [-789.142] (-788.402) (-787.218) (-787.192) * (-787.344) [-786.168] (-788.154) (-788.875) -- 0:00:51
136000 -- (-788.296) [-788.356] (-788.366) (-789.810) * (-786.898) (-786.797) [-785.807] (-786.485) -- 0:00:50
136500 -- (-787.220) (-787.963) [-789.177] (-791.122) * (-786.548) (-788.486) (-787.320) [-787.786] -- 0:00:50
137000 -- (-787.689) [-787.818] (-787.470) (-788.394) * (-787.679) (-785.622) (-786.768) [-787.982] -- 0:00:50
137500 -- (-787.201) [-786.453] (-789.628) (-791.052) * (-787.613) (-787.909) [-786.829] (-787.801) -- 0:00:50
138000 -- [-788.128] (-788.689) (-788.730) (-787.908) * (-787.446) (-787.834) (-791.723) [-792.292] -- 0:00:49
138500 -- (-787.181) (-786.886) (-789.120) [-788.437] * [-786.069] (-786.357) (-790.891) (-792.816) -- 0:00:49
139000 -- (-788.650) (-792.829) (-788.530) [-786.350] * (-788.836) (-790.376) (-788.161) [-791.636] -- 0:00:49
139500 -- (-790.192) (-789.419) (-787.790) [-786.592] * (-788.175) (-787.712) [-785.661] (-786.407) -- 0:00:49
140000 -- [-788.346] (-786.229) (-787.399) (-788.805) * [-788.933] (-786.569) (-785.522) (-788.732) -- 0:00:49
Average standard deviation of split frequencies: 0.019102
140500 -- (-786.916) [-785.838] (-786.640) (-786.650) * (-786.464) (-786.488) (-788.348) [-785.901] -- 0:00:48
141000 -- (-786.052) (-788.379) (-785.920) [-788.978] * (-786.374) (-785.958) [-787.238] (-785.683) -- 0:00:48
141500 -- (-786.986) (-791.948) (-788.033) [-787.543] * (-788.342) (-785.967) (-789.035) [-788.764] -- 0:00:48
142000 -- (-789.563) [-791.378] (-792.606) (-790.235) * (-789.203) (-786.736) [-785.912] (-787.904) -- 0:00:48
142500 -- (-788.564) (-787.744) [-788.290] (-787.155) * (-788.281) (-788.056) (-791.068) [-786.571] -- 0:00:48
143000 -- (-787.290) [-789.184] (-789.478) (-787.526) * (-791.290) (-787.800) (-786.089) [-792.191] -- 0:00:47
143500 -- (-787.902) (-788.974) (-790.955) [-789.008] * [-788.482] (-789.031) (-787.295) (-785.791) -- 0:00:47
144000 -- (-789.062) (-787.436) (-787.827) [-787.807] * [-786.055] (-789.725) (-786.137) (-786.676) -- 0:00:47
144500 -- (-791.124) (-785.584) [-790.918] (-787.169) * [-787.945] (-792.544) (-787.587) (-786.629) -- 0:00:47
145000 -- (-785.543) [-786.931] (-791.042) (-787.450) * [-793.619] (-789.444) (-789.118) (-790.601) -- 0:00:47
Average standard deviation of split frequencies: 0.018404
145500 -- (-790.130) (-786.845) (-788.429) [-790.437] * [-789.092] (-791.354) (-786.142) (-788.823) -- 0:00:46
146000 -- (-787.717) (-787.116) [-788.081] (-792.108) * (-790.815) (-789.168) [-786.830] (-787.876) -- 0:00:46
146500 -- (-789.762) (-786.667) [-787.549] (-790.293) * [-786.258] (-787.207) (-786.108) (-786.344) -- 0:00:46
147000 -- (-787.760) (-786.270) [-786.372] (-788.895) * [-790.006] (-786.529) (-787.623) (-788.357) -- 0:00:46
147500 -- (-786.983) (-787.587) (-786.534) [-788.424] * (-790.844) (-788.650) (-787.139) [-788.218] -- 0:00:46
148000 -- (-787.200) (-788.944) (-787.619) [-786.607] * (-789.139) (-790.894) [-787.375] (-787.701) -- 0:00:46
148500 -- [-787.231] (-787.845) (-787.195) (-787.514) * [-787.627] (-792.124) (-788.451) (-788.286) -- 0:00:45
149000 -- (-790.441) (-787.979) (-790.917) [-787.836] * [-790.167] (-786.891) (-786.511) (-792.737) -- 0:00:51
149500 -- (-785.880) (-790.038) (-789.876) [-786.823] * [-789.526] (-786.173) (-787.563) (-788.336) -- 0:00:51
150000 -- [-787.348] (-788.652) (-787.393) (-788.262) * [-788.609] (-787.484) (-786.077) (-787.544) -- 0:00:51
Average standard deviation of split frequencies: 0.018773
150500 -- (-785.748) (-788.392) (-789.267) [-786.042] * (-787.913) (-787.833) [-786.208] (-787.636) -- 0:00:50
151000 -- (-785.320) (-786.026) (-787.672) [-787.051] * [-787.218] (-785.723) (-787.241) (-787.366) -- 0:00:50
151500 -- (-785.341) [-786.724] (-788.283) (-785.967) * (-790.623) (-786.308) [-786.558] (-787.989) -- 0:00:50
152000 -- (-787.709) (-787.260) (-788.853) [-786.378] * [-788.512] (-785.967) (-787.816) (-787.304) -- 0:00:50
152500 -- (-789.700) [-787.348] (-787.219) (-793.978) * [-789.102] (-789.879) (-788.977) (-786.229) -- 0:00:50
153000 -- (-788.313) (-788.559) [-787.049] (-791.286) * [-786.088] (-790.533) (-787.045) (-788.811) -- 0:00:49
153500 -- (-785.727) [-785.766] (-786.717) (-786.791) * (-787.701) [-788.679] (-788.211) (-788.313) -- 0:00:49
154000 -- (-786.630) (-789.163) (-787.029) [-788.454] * [-788.420] (-791.765) (-786.487) (-788.613) -- 0:00:49
154500 -- (-786.537) (-787.145) (-786.417) [-788.656] * (-788.481) [-790.331] (-786.977) (-787.360) -- 0:00:49
155000 -- (-790.636) (-787.039) [-786.623] (-788.462) * (-787.000) [-787.677] (-789.450) (-788.034) -- 0:00:49
Average standard deviation of split frequencies: 0.016469
155500 -- (-789.361) (-788.254) [-789.158] (-787.669) * (-786.879) (-788.465) (-785.976) [-788.365] -- 0:00:48
156000 -- (-788.236) [-788.237] (-790.609) (-787.533) * [-787.906] (-787.716) (-786.560) (-787.294) -- 0:00:48
156500 -- (-789.168) [-788.326] (-789.139) (-787.273) * (-788.308) [-786.990] (-785.894) (-787.296) -- 0:00:48
157000 -- (-792.571) (-789.934) (-788.650) [-787.144] * (-788.001) [-787.413] (-786.885) (-788.626) -- 0:00:48
157500 -- [-787.432] (-788.982) (-787.513) (-790.861) * [-790.394] (-790.392) (-786.941) (-786.793) -- 0:00:48
158000 -- (-788.659) (-786.241) [-787.829] (-791.197) * (-788.079) (-791.706) [-785.750] (-787.154) -- 0:00:47
158500 -- (-788.027) (-789.309) [-787.659] (-794.258) * (-790.040) (-790.423) (-786.367) [-787.105] -- 0:00:47
159000 -- [-788.018] (-788.629) (-787.908) (-787.228) * (-788.936) (-787.433) [-785.530] (-788.920) -- 0:00:47
159500 -- (-787.110) (-787.009) (-787.607) [-788.003] * [-785.780] (-786.968) (-786.310) (-794.339) -- 0:00:47
160000 -- (-787.040) (-788.406) [-789.150] (-786.654) * [-785.878] (-788.556) (-785.485) (-796.995) -- 0:00:47
Average standard deviation of split frequencies: 0.015844
160500 -- [-788.774] (-787.432) (-790.660) (-786.354) * (-788.256) (-786.367) [-787.389] (-790.695) -- 0:00:47
161000 -- (-786.556) [-788.432] (-788.587) (-788.291) * (-786.886) (-787.746) [-787.821] (-786.580) -- 0:00:46
161500 -- [-787.335] (-797.170) (-787.007) (-787.348) * (-787.295) (-787.704) (-786.231) [-786.408] -- 0:00:46
162000 -- (-787.086) (-789.565) [-788.574] (-788.754) * (-791.081) (-791.351) [-790.990] (-786.730) -- 0:00:46
162500 -- (-786.523) [-785.809] (-788.213) (-788.726) * [-789.418] (-796.484) (-791.369) (-788.197) -- 0:00:46
163000 -- [-787.103] (-785.756) (-789.306) (-788.886) * [-791.012] (-793.158) (-787.257) (-792.399) -- 0:00:46
163500 -- (-787.574) (-787.362) (-788.508) [-786.601] * (-786.866) [-785.643] (-787.787) (-789.314) -- 0:00:46
164000 -- (-787.140) [-788.512] (-792.222) (-789.098) * [-788.500] (-787.913) (-787.792) (-786.456) -- 0:00:45
164500 -- (-788.880) [-785.903] (-791.954) (-787.605) * [-787.876] (-788.291) (-786.556) (-787.071) -- 0:00:45
165000 -- (-788.437) [-788.284] (-788.404) (-786.056) * (-787.656) (-786.496) (-793.233) [-786.262] -- 0:00:45
Average standard deviation of split frequencies: 0.017039
165500 -- (-787.449) (-788.343) (-787.894) [-787.309] * (-787.145) [-786.711] (-792.015) (-786.778) -- 0:00:50
166000 -- (-787.997) (-786.659) [-787.519] (-790.380) * [-789.220] (-788.108) (-787.473) (-787.175) -- 0:00:50
166500 -- (-787.630) [-787.508] (-788.980) (-787.037) * [-790.330] (-788.264) (-788.251) (-787.901) -- 0:00:50
167000 -- [-786.949] (-786.980) (-788.253) (-789.016) * [-791.896] (-788.912) (-791.330) (-787.075) -- 0:00:49
167500 -- (-786.720) [-787.365] (-787.782) (-789.016) * [-787.821] (-787.099) (-787.689) (-786.966) -- 0:00:49
168000 -- (-786.551) (-787.737) [-788.472] (-789.583) * [-787.829] (-790.059) (-786.534) (-791.790) -- 0:00:49
168500 -- (-786.037) [-785.610] (-788.065) (-788.887) * (-788.642) (-790.346) (-788.885) [-787.656] -- 0:00:49
169000 -- [-786.355] (-787.127) (-789.088) (-789.072) * [-786.935] (-786.331) (-795.214) (-786.961) -- 0:00:49
169500 -- (-791.642) (-791.043) [-786.596] (-788.796) * (-786.361) (-787.903) [-786.856] (-786.287) -- 0:00:48
170000 -- [-787.717] (-789.936) (-786.343) (-792.795) * (-787.010) (-786.188) (-787.152) [-788.407] -- 0:00:48
Average standard deviation of split frequencies: 0.015468
170500 -- [-787.091] (-789.250) (-793.974) (-790.582) * (-786.035) [-786.188] (-785.717) (-790.212) -- 0:00:48
171000 -- [-786.359] (-788.128) (-786.990) (-788.792) * [-785.589] (-786.074) (-786.401) (-790.981) -- 0:00:48
171500 -- (-787.982) (-786.200) (-787.615) [-786.364] * (-785.733) (-785.649) (-786.424) [-793.646] -- 0:00:48
172000 -- [-789.655] (-789.756) (-791.342) (-786.837) * (-787.114) [-785.552] (-786.768) (-790.411) -- 0:00:48
172500 -- (-789.819) (-794.389) [-789.074] (-788.563) * (-788.354) (-789.616) [-786.555] (-788.414) -- 0:00:47
173000 -- (-788.914) [-790.444] (-789.684) (-791.321) * (-789.421) [-788.483] (-785.413) (-789.890) -- 0:00:47
173500 -- (-787.778) [-786.677] (-788.397) (-787.546) * (-788.336) (-788.628) [-785.842] (-787.371) -- 0:00:47
174000 -- (-787.979) (-793.375) (-788.398) [-787.975] * [-789.832] (-788.806) (-788.905) (-788.694) -- 0:00:47
174500 -- [-788.697] (-789.057) (-790.205) (-790.259) * (-788.758) [-790.614] (-785.997) (-788.368) -- 0:00:47
175000 -- [-789.785] (-789.920) (-786.752) (-787.168) * (-788.621) (-791.709) [-786.273] (-787.158) -- 0:00:47
Average standard deviation of split frequencies: 0.013526
175500 -- (-788.863) [-789.265] (-786.037) (-785.914) * [-786.563] (-789.027) (-786.123) (-793.224) -- 0:00:46
176000 -- (-787.728) [-790.728] (-786.223) (-787.836) * (-786.778) (-788.572) (-786.911) [-787.935] -- 0:00:46
176500 -- (-787.699) (-789.670) (-787.106) [-787.251] * (-786.819) (-789.876) (-785.869) [-792.491] -- 0:00:46
177000 -- [-785.953] (-793.033) (-787.919) (-789.238) * [-788.991] (-788.913) (-787.210) (-785.394) -- 0:00:46
177500 -- (-786.536) [-787.205] (-791.068) (-789.499) * (-787.483) (-789.610) [-786.686] (-786.985) -- 0:00:46
178000 -- (-797.264) (-787.795) [-786.507] (-787.883) * (-788.905) [-786.177] (-788.283) (-786.024) -- 0:00:46
178500 -- (-788.807) (-787.165) [-787.606] (-791.303) * [-789.915] (-786.538) (-788.469) (-787.837) -- 0:00:46
179000 -- (-788.197) (-787.892) [-788.356] (-788.430) * (-789.421) (-787.336) (-788.533) [-789.095] -- 0:00:45
179500 -- (-787.234) [-787.975] (-786.201) (-786.406) * (-789.854) (-786.505) (-789.208) [-786.608] -- 0:00:45
180000 -- (-788.531) [-786.667] (-788.300) (-786.754) * (-790.479) [-786.579] (-788.943) (-788.330) -- 0:00:45
Average standard deviation of split frequencies: 0.013870
180500 -- (-787.208) (-790.118) [-789.072] (-787.216) * (-788.418) (-788.313) (-787.405) [-785.889] -- 0:00:45
181000 -- (-787.049) (-787.897) [-787.257] (-790.928) * (-787.308) (-787.934) (-787.789) [-786.025] -- 0:00:45
181500 -- [-786.664] (-800.698) (-787.647) (-787.124) * (-790.435) [-787.385] (-789.096) (-787.390) -- 0:00:45
182000 -- (-786.991) (-790.808) (-791.845) [-787.361] * (-789.176) (-788.173) [-787.385] (-788.291) -- 0:00:44
182500 -- (-788.624) (-789.908) [-786.821] (-791.509) * (-790.447) [-787.566] (-786.824) (-790.834) -- 0:00:49
183000 -- (-789.007) (-788.078) [-786.737] (-788.963) * (-789.605) (-788.462) [-787.921] (-789.389) -- 0:00:49
183500 -- (-790.013) [-787.664] (-789.059) (-787.000) * [-785.865] (-787.031) (-790.550) (-786.418) -- 0:00:48
184000 -- [-790.055] (-787.421) (-789.034) (-788.628) * (-787.249) [-787.034] (-787.038) (-792.151) -- 0:00:48
184500 -- (-789.152) (-786.053) [-786.334] (-790.062) * (-790.129) (-786.660) (-785.866) [-790.117] -- 0:00:48
185000 -- (-789.150) [-787.289] (-787.060) (-794.145) * (-789.169) [-786.803] (-788.999) (-789.918) -- 0:00:48
Average standard deviation of split frequencies: 0.014953
185500 -- (-791.253) (-789.910) (-787.965) [-786.695] * (-787.165) (-789.495) [-787.515] (-788.105) -- 0:00:48
186000 -- (-786.749) [-786.507] (-786.005) (-785.917) * (-787.751) [-789.725] (-786.637) (-786.877) -- 0:00:48
186500 -- (-786.265) (-786.186) [-786.607] (-786.204) * (-788.134) (-789.885) (-788.555) [-787.992] -- 0:00:47
187000 -- [-785.621] (-787.222) (-786.700) (-788.276) * (-790.727) (-787.160) [-787.579] (-787.964) -- 0:00:47
187500 -- [-786.348] (-789.197) (-788.757) (-786.556) * [-786.711] (-786.119) (-788.271) (-789.871) -- 0:00:47
188000 -- (-787.980) [-790.160] (-787.536) (-791.199) * (-786.446) (-786.248) (-787.257) [-788.730] -- 0:00:47
188500 -- (-789.313) [-786.714] (-788.010) (-788.598) * (-787.095) (-790.765) (-786.769) [-788.276] -- 0:00:47
189000 -- (-787.179) (-786.880) (-787.567) [-790.353] * (-787.072) (-787.527) [-786.729] (-787.282) -- 0:00:47
189500 -- (-785.815) (-787.099) (-787.509) [-786.210] * (-786.894) (-786.295) (-786.871) [-787.101] -- 0:00:47
190000 -- [-788.869] (-789.476) (-786.469) (-789.432) * [-789.004] (-794.735) (-790.454) (-790.533) -- 0:00:46
Average standard deviation of split frequencies: 0.013969
190500 -- (-786.444) (-789.925) [-788.245] (-788.815) * (-792.751) (-789.440) [-786.847] (-787.874) -- 0:00:46
191000 -- (-789.296) [-787.197] (-785.980) (-792.306) * (-787.927) (-787.505) (-787.141) [-785.703] -- 0:00:46
191500 -- (-788.155) (-788.210) [-785.691] (-791.313) * (-788.063) [-789.351] (-786.265) (-786.026) -- 0:00:46
192000 -- (-787.754) (-785.772) (-788.080) [-787.431] * (-792.985) (-789.102) [-786.045] (-787.460) -- 0:00:46
192500 -- (-790.333) (-787.645) (-786.553) [-791.228] * [-786.656] (-789.052) (-788.216) (-791.250) -- 0:00:46
193000 -- [-788.214] (-787.568) (-789.413) (-791.267) * (-791.399) [-786.700] (-787.495) (-787.891) -- 0:00:45
193500 -- (-790.010) (-789.279) (-790.992) [-791.988] * (-788.754) (-786.235) (-788.566) [-787.525] -- 0:00:45
194000 -- (-789.771) (-786.942) (-791.654) [-786.033] * (-787.758) (-787.899) (-787.273) [-788.591] -- 0:00:45
194500 -- (-787.137) [-785.402] (-786.648) (-785.870) * (-785.881) (-791.090) (-788.036) [-787.158] -- 0:00:45
195000 -- (-786.164) [-786.858] (-787.455) (-786.127) * (-787.883) (-789.105) [-788.890] (-787.841) -- 0:00:45
Average standard deviation of split frequencies: 0.015633
195500 -- (-787.143) [-786.431] (-787.777) (-786.424) * (-787.268) [-786.313] (-786.775) (-787.768) -- 0:00:45
196000 -- [-791.308] (-787.370) (-787.809) (-788.606) * (-790.991) (-786.531) [-787.546] (-787.440) -- 0:00:45
196500 -- (-786.506) (-789.345) (-785.624) [-787.900] * (-790.544) (-785.798) (-785.583) [-787.693] -- 0:00:44
197000 -- (-788.075) [-786.114] (-785.743) (-786.995) * (-788.876) [-786.710] (-788.888) (-788.718) -- 0:00:44
197500 -- (-787.034) [-793.050] (-789.306) (-790.672) * (-787.143) [-788.541] (-789.702) (-789.769) -- 0:00:44
198000 -- (-786.616) (-790.061) [-790.929] (-785.611) * (-788.373) (-788.163) [-788.971] (-787.958) -- 0:00:44
198500 -- [-785.738] (-788.750) (-787.334) (-786.813) * (-785.783) [-787.966] (-787.197) (-788.736) -- 0:00:44
199000 -- (-787.134) (-792.113) [-786.445] (-786.310) * (-786.588) [-787.849] (-789.291) (-786.722) -- 0:00:44
199500 -- (-788.047) (-789.721) (-787.032) [-792.137] * [-786.122] (-788.178) (-791.072) (-786.551) -- 0:00:48
200000 -- (-786.059) [-787.399] (-791.208) (-786.554) * [-786.408] (-788.926) (-788.625) (-787.288) -- 0:00:48
Average standard deviation of split frequencies: 0.015332
200500 -- [-786.706] (-787.594) (-788.049) (-785.879) * [-787.012] (-792.447) (-787.255) (-787.796) -- 0:00:47
201000 -- (-789.145) [-787.182] (-785.876) (-786.398) * (-788.070) (-786.692) [-787.410] (-786.599) -- 0:00:47
201500 -- (-786.119) [-787.146] (-785.884) (-786.785) * (-787.784) [-788.437] (-787.636) (-791.587) -- 0:00:47
202000 -- (-786.982) [-787.529] (-789.196) (-787.302) * [-787.284] (-790.447) (-785.513) (-786.689) -- 0:00:47
202500 -- (-786.290) (-791.810) (-787.636) [-788.533] * (-794.682) [-786.139] (-787.358) (-785.937) -- 0:00:47
203000 -- (-789.746) (-789.347) [-785.721] (-789.049) * (-793.694) [-788.090] (-787.060) (-789.308) -- 0:00:47
203500 -- (-787.148) (-788.775) (-791.724) [-788.385] * (-793.141) (-789.200) [-788.893] (-787.796) -- 0:00:46
204000 -- (-787.078) (-786.792) (-788.786) [-787.027] * (-788.259) (-786.984) [-787.730] (-786.143) -- 0:00:46
204500 -- (-787.383) (-788.016) (-790.414) [-786.705] * (-787.094) (-786.781) (-786.619) [-786.985] -- 0:00:46
205000 -- [-785.611] (-786.791) (-786.498) (-786.843) * (-787.251) (-787.525) (-786.734) [-788.004] -- 0:00:46
Average standard deviation of split frequencies: 0.016259
205500 -- (-791.442) (-787.759) [-786.523] (-786.471) * [-786.389] (-791.296) (-788.544) (-789.212) -- 0:00:46
206000 -- (-789.058) [-788.378] (-786.788) (-788.081) * (-787.417) (-789.091) (-785.719) [-786.925] -- 0:00:46
206500 -- (-786.437) (-788.250) (-787.618) [-787.258] * [-786.075] (-787.289) (-789.411) (-785.676) -- 0:00:46
207000 -- (-786.892) (-790.660) [-788.468] (-788.637) * (-788.460) (-793.523) [-785.670] (-786.598) -- 0:00:45
207500 -- [-786.446] (-792.681) (-789.376) (-790.678) * (-787.342) (-786.457) (-789.833) [-788.366] -- 0:00:45
208000 -- [-790.080] (-786.789) (-787.326) (-790.769) * (-787.344) [-785.779] (-787.404) (-786.120) -- 0:00:45
208500 -- (-788.200) (-789.921) (-786.468) [-787.703] * [-785.881] (-790.669) (-791.363) (-787.686) -- 0:00:45
209000 -- [-796.181] (-790.111) (-788.869) (-786.591) * [-786.661] (-787.297) (-789.638) (-787.646) -- 0:00:45
209500 -- (-785.638) (-786.872) (-785.761) [-789.317] * (-790.058) (-787.661) (-789.739) [-787.209] -- 0:00:45
210000 -- [-786.423] (-790.747) (-788.931) (-790.364) * (-789.583) (-787.907) (-790.878) [-786.363] -- 0:00:45
Average standard deviation of split frequencies: 0.016410
210500 -- [-785.430] (-788.406) (-788.972) (-788.668) * (-790.053) (-787.564) (-789.897) [-787.810] -- 0:00:45
211000 -- [-786.157] (-786.655) (-787.366) (-791.775) * (-789.160) (-790.152) (-787.873) [-787.484] -- 0:00:44
211500 -- (-785.655) [-785.821] (-785.626) (-792.777) * (-789.380) (-788.176) (-786.526) [-786.273] -- 0:00:44
212000 -- (-790.247) [-787.531] (-786.229) (-793.332) * (-789.902) (-788.523) (-786.184) [-787.153] -- 0:00:44
212500 -- (-791.392) (-788.729) (-786.672) [-788.676] * (-788.381) [-789.150] (-787.789) (-789.724) -- 0:00:44
213000 -- (-789.683) [-790.831] (-789.624) (-788.395) * [-785.698] (-788.402) (-787.343) (-787.149) -- 0:00:44
213500 -- (-790.078) (-792.726) [-789.743] (-786.338) * [-785.960] (-787.234) (-787.061) (-789.028) -- 0:00:44
214000 -- (-787.961) (-792.368) (-788.877) [-786.656] * [-786.055] (-788.902) (-787.209) (-790.393) -- 0:00:44
214500 -- [-789.005] (-790.393) (-790.177) (-787.292) * [-786.848] (-787.074) (-793.553) (-795.114) -- 0:00:43
215000 -- (-785.577) [-786.417] (-789.410) (-786.247) * [-786.458] (-786.636) (-788.651) (-788.345) -- 0:00:43
Average standard deviation of split frequencies: 0.015386
215500 -- (-786.749) (-786.093) (-787.083) [-786.568] * (-788.085) (-788.971) (-786.371) [-788.054] -- 0:00:43
216000 -- [-786.371] (-787.523) (-786.686) (-787.161) * (-786.847) (-785.669) [-788.593] (-787.274) -- 0:00:47
216500 -- [-787.713] (-789.148) (-786.117) (-786.038) * [-787.307] (-786.119) (-789.102) (-788.434) -- 0:00:47
217000 -- (-787.149) (-792.785) (-786.369) [-787.101] * (-788.509) (-787.050) [-789.685] (-789.843) -- 0:00:46
217500 -- [-787.435] (-790.540) (-787.761) (-786.633) * (-785.966) [-786.777] (-788.872) (-786.643) -- 0:00:46
218000 -- (-786.665) [-787.766] (-786.891) (-786.024) * (-791.785) [-786.869] (-788.508) (-786.568) -- 0:00:46
218500 -- (-786.435) [-787.379] (-789.167) (-785.922) * (-787.554) (-790.375) (-787.684) [-786.805] -- 0:00:46
219000 -- (-794.421) [-788.711] (-789.997) (-786.293) * (-789.330) (-788.746) (-788.525) [-788.631] -- 0:00:46
219500 -- [-786.669] (-787.380) (-792.412) (-789.349) * (-789.436) (-789.141) [-788.184] (-790.095) -- 0:00:46
220000 -- (-787.068) (-788.099) (-787.855) [-789.151] * [-787.767] (-793.233) (-786.504) (-785.925) -- 0:00:46
Average standard deviation of split frequencies: 0.015741
220500 -- (-787.234) (-787.591) [-786.795] (-789.181) * [-787.261] (-792.754) (-792.620) (-788.179) -- 0:00:45
221000 -- (-786.037) [-785.946] (-788.286) (-790.681) * (-786.375) (-787.605) (-790.410) [-786.233] -- 0:00:45
221500 -- (-789.833) (-787.535) [-787.898] (-787.106) * [-787.507] (-789.139) (-790.597) (-786.550) -- 0:00:45
222000 -- (-787.190) (-787.160) (-786.360) [-787.105] * (-787.852) (-786.418) (-790.865) [-787.013] -- 0:00:45
222500 -- (-787.240) [-790.371] (-789.180) (-787.360) * (-791.229) [-788.041] (-788.743) (-788.819) -- 0:00:45
223000 -- [-791.451] (-789.206) (-788.269) (-788.170) * (-789.334) (-792.998) (-789.145) [-788.116] -- 0:00:45
223500 -- [-786.819] (-789.841) (-788.098) (-793.469) * (-789.311) (-792.209) [-787.406] (-785.931) -- 0:00:45
224000 -- [-786.434] (-791.700) (-787.241) (-791.085) * (-788.202) (-789.455) [-790.213] (-786.663) -- 0:00:45
224500 -- [-786.611] (-787.401) (-787.458) (-790.272) * [-786.541] (-788.364) (-787.219) (-791.860) -- 0:00:44
225000 -- (-787.553) [-787.623] (-787.624) (-795.262) * [-788.721] (-787.385) (-787.096) (-786.313) -- 0:00:44
Average standard deviation of split frequencies: 0.016588
225500 -- (-788.465) (-786.538) [-787.783] (-792.487) * (-788.000) [-790.774] (-789.043) (-789.380) -- 0:00:44
226000 -- (-790.634) [-788.184] (-787.926) (-790.317) * [-789.925] (-790.698) (-789.787) (-787.645) -- 0:00:44
226500 -- (-792.576) (-788.832) [-785.775] (-788.554) * [-788.485] (-788.154) (-792.298) (-786.447) -- 0:00:44
227000 -- (-791.226) (-785.733) (-789.321) [-789.311] * [-789.193] (-789.209) (-789.696) (-786.419) -- 0:00:44
227500 -- (-793.640) (-786.570) [-788.458] (-787.131) * (-789.453) (-787.850) [-787.091] (-786.367) -- 0:00:44
228000 -- (-786.914) (-787.376) [-787.455] (-786.459) * (-786.040) (-789.515) [-789.981] (-786.382) -- 0:00:44
228500 -- [-789.033] (-786.250) (-786.813) (-786.754) * (-789.023) (-792.570) (-788.052) [-787.154] -- 0:00:43
229000 -- (-791.028) [-785.831] (-786.952) (-786.103) * (-789.574) [-787.725] (-787.446) (-786.279) -- 0:00:43
229500 -- (-787.043) (-787.560) (-788.494) [-786.960] * (-788.718) (-786.797) [-787.327] (-791.755) -- 0:00:43
230000 -- (-787.346) (-788.207) [-787.052] (-789.521) * [-789.316] (-787.418) (-788.126) (-789.271) -- 0:00:43
Average standard deviation of split frequencies: 0.015765
230500 -- (-786.776) (-790.509) (-785.702) [-788.123] * (-788.728) [-788.136] (-788.849) (-789.170) -- 0:00:43
231000 -- [-786.554] (-790.290) (-786.032) (-792.148) * [-795.074] (-787.752) (-791.130) (-790.773) -- 0:00:43
231500 -- (-786.318) (-786.877) (-786.050) [-791.464] * [-788.144] (-788.367) (-787.451) (-787.223) -- 0:00:43
232000 -- (-785.867) [-786.064] (-786.326) (-791.562) * (-789.552) [-786.802] (-786.558) (-786.196) -- 0:00:43
232500 -- (-792.213) (-785.869) [-788.962] (-788.818) * (-792.599) (-786.248) [-786.635] (-786.145) -- 0:00:42
233000 -- (-789.210) [-787.423] (-787.711) (-788.499) * (-794.839) (-786.261) [-788.584] (-785.635) -- 0:00:46
233500 -- (-791.943) (-785.982) (-787.399) [-789.671] * (-787.647) (-786.730) [-788.791] (-787.716) -- 0:00:45
234000 -- (-786.226) (-786.038) [-789.401] (-787.313) * (-788.832) (-786.982) (-787.430) [-787.135] -- 0:00:45
234500 -- (-789.485) (-786.474) [-789.859] (-790.760) * (-791.917) [-787.063] (-790.292) (-786.818) -- 0:00:45
235000 -- (-790.489) [-787.565] (-788.955) (-789.591) * [-787.549] (-788.741) (-790.301) (-789.488) -- 0:00:45
Average standard deviation of split frequencies: 0.015627
235500 -- (-788.267) [-785.559] (-789.145) (-787.604) * (-789.552) (-790.097) [-787.619] (-791.699) -- 0:00:45
236000 -- (-786.749) [-785.789] (-787.492) (-788.596) * [-789.101] (-789.459) (-786.831) (-792.085) -- 0:00:45
236500 -- [-787.180] (-786.150) (-786.900) (-795.965) * (-788.660) (-788.367) [-785.974] (-789.007) -- 0:00:45
237000 -- (-789.696) [-786.916] (-786.427) (-785.610) * (-787.277) (-789.709) [-788.864] (-790.933) -- 0:00:45
237500 -- (-788.509) (-785.979) [-786.075] (-787.691) * [-788.481] (-793.118) (-786.941) (-787.465) -- 0:00:44
238000 -- (-788.346) (-788.855) [-786.393] (-785.989) * (-788.996) (-788.052) [-786.529] (-788.233) -- 0:00:44
238500 -- [-787.447] (-787.633) (-787.971) (-786.415) * (-791.236) (-785.901) (-787.706) [-786.680] -- 0:00:44
239000 -- (-786.496) (-790.118) [-789.990] (-790.169) * (-786.825) [-786.501] (-786.843) (-787.846) -- 0:00:44
239500 -- [-787.764] (-788.840) (-786.754) (-788.636) * (-786.648) [-786.445] (-786.855) (-787.458) -- 0:00:44
240000 -- (-788.608) (-787.828) (-786.834) [-786.231] * (-790.788) (-785.745) [-787.778] (-787.154) -- 0:00:44
Average standard deviation of split frequencies: 0.014863
240500 -- (-786.622) [-792.725] (-791.555) (-786.524) * [-787.650] (-786.605) (-790.645) (-786.601) -- 0:00:44
241000 -- (-787.367) [-791.427] (-787.038) (-789.276) * (-785.815) (-787.251) (-790.020) [-786.100] -- 0:00:44
241500 -- (-786.731) (-794.505) [-788.334] (-785.971) * (-785.570) (-786.868) [-787.197] (-787.253) -- 0:00:43
242000 -- [-787.690] (-791.744) (-791.255) (-788.079) * (-785.536) [-789.534] (-786.060) (-789.996) -- 0:00:43
242500 -- (-791.153) (-792.741) [-787.761] (-786.553) * [-786.336] (-788.537) (-786.253) (-793.915) -- 0:00:43
243000 -- (-790.376) (-787.430) (-786.647) [-785.606] * [-789.670] (-789.526) (-786.462) (-792.438) -- 0:00:43
243500 -- [-787.907] (-788.206) (-786.090) (-791.301) * (-790.834) (-791.938) (-786.828) [-789.972] -- 0:00:43
244000 -- (-791.139) (-788.802) [-786.325] (-793.355) * (-791.655) (-788.787) [-789.721] (-786.242) -- 0:00:43
244500 -- [-787.892] (-786.475) (-787.858) (-792.610) * [-788.598] (-787.477) (-786.415) (-786.220) -- 0:00:43
245000 -- [-789.217] (-786.538) (-786.976) (-788.713) * (-790.046) [-787.568] (-786.426) (-785.595) -- 0:00:43
Average standard deviation of split frequencies: 0.014423
245500 -- [-785.647] (-787.641) (-786.481) (-789.993) * (-786.273) [-790.311] (-788.369) (-788.305) -- 0:00:43
246000 -- (-786.288) (-787.405) (-790.060) [-790.550] * (-788.450) (-791.815) [-788.924] (-788.312) -- 0:00:42
246500 -- (-786.953) (-787.112) (-788.691) [-789.279] * (-788.850) (-793.203) [-786.730] (-789.611) -- 0:00:42
247000 -- (-791.489) [-786.179] (-794.802) (-786.777) * (-789.412) [-787.141] (-785.931) (-794.733) -- 0:00:42
247500 -- (-793.586) (-789.646) (-792.165) [-792.214] * [-788.068] (-785.679) (-786.704) (-792.813) -- 0:00:42
248000 -- [-789.398] (-788.778) (-788.288) (-789.273) * [-788.032] (-788.095) (-787.458) (-788.320) -- 0:00:42
248500 -- (-786.732) [-787.874] (-786.326) (-789.258) * (-787.381) [-786.489] (-788.448) (-794.733) -- 0:00:42
249000 -- (-785.965) (-785.689) (-786.803) [-793.112] * [-788.494] (-787.060) (-787.783) (-787.239) -- 0:00:42
249500 -- (-788.442) [-786.850] (-789.066) (-786.712) * (-786.337) (-790.565) [-786.578] (-787.669) -- 0:00:45
250000 -- (-787.430) (-786.316) [-787.868] (-786.731) * [-786.317] (-789.021) (-789.115) (-790.524) -- 0:00:45
Average standard deviation of split frequencies: 0.012328
250500 -- (-787.760) (-785.856) [-787.271] (-786.733) * (-787.444) (-788.867) (-788.267) [-789.524] -- 0:00:44
251000 -- (-786.791) [-787.495] (-788.206) (-786.736) * (-791.429) (-789.429) (-791.313) [-787.812] -- 0:00:44
251500 -- (-787.873) (-787.772) [-789.262] (-787.746) * (-790.221) [-787.533] (-791.140) (-795.998) -- 0:00:44
252000 -- (-785.916) (-789.138) [-787.299] (-787.888) * (-788.911) (-789.520) [-788.782] (-793.930) -- 0:00:44
252500 -- (-785.829) [-790.036] (-788.636) (-787.932) * (-792.655) (-790.677) [-788.789] (-789.025) -- 0:00:44
253000 -- [-785.612] (-790.187) (-788.523) (-788.427) * (-787.406) (-786.386) (-786.501) [-789.668] -- 0:00:44
253500 -- [-787.035] (-789.928) (-787.921) (-788.511) * (-792.318) [-786.822] (-786.304) (-789.150) -- 0:00:44
254000 -- [-788.376] (-787.092) (-787.058) (-788.678) * (-786.292) (-786.104) (-785.987) [-789.471] -- 0:00:44
254500 -- (-790.245) [-786.823] (-786.314) (-787.264) * (-786.128) [-785.840] (-787.534) (-787.022) -- 0:00:43
255000 -- (-788.109) (-788.469) (-788.151) [-790.346] * (-787.171) (-787.605) [-786.322] (-790.051) -- 0:00:43
Average standard deviation of split frequencies: 0.012276
255500 -- (-786.868) (-786.999) (-788.214) [-786.674] * (-789.752) (-790.012) [-790.925] (-785.938) -- 0:00:43
256000 -- (-790.232) (-787.244) [-787.493] (-788.330) * (-789.195) (-789.393) (-788.603) [-786.960] -- 0:00:43
256500 -- [-791.394] (-790.065) (-786.295) (-786.041) * (-792.556) (-790.335) [-786.695] (-787.560) -- 0:00:43
257000 -- (-791.461) (-786.742) [-788.456] (-788.487) * (-791.183) [-788.438] (-786.872) (-785.849) -- 0:00:43
257500 -- (-788.053) [-785.467] (-793.742) (-788.177) * (-786.857) (-788.491) (-793.551) [-786.666] -- 0:00:43
258000 -- (-786.136) [-787.844] (-787.464) (-786.906) * (-789.006) [-787.333] (-788.504) (-787.458) -- 0:00:43
258500 -- [-787.419] (-786.876) (-789.210) (-785.514) * (-791.931) (-786.353) (-788.249) [-791.199] -- 0:00:43
259000 -- (-787.586) (-788.332) [-786.606] (-788.019) * (-789.236) [-786.260] (-789.371) (-787.350) -- 0:00:42
259500 -- (-787.536) (-787.637) [-786.997] (-791.472) * [-787.412] (-789.131) (-788.930) (-790.011) -- 0:00:42
260000 -- [-789.577] (-791.115) (-786.446) (-786.964) * [-788.451] (-787.421) (-788.941) (-791.011) -- 0:00:42
Average standard deviation of split frequencies: 0.010957
260500 -- [-788.629] (-788.735) (-788.845) (-786.902) * (-786.649) [-788.716] (-786.326) (-786.968) -- 0:00:42
261000 -- [-785.525] (-786.766) (-787.850) (-792.453) * (-786.340) [-787.039] (-785.989) (-787.189) -- 0:00:42
261500 -- (-786.761) [-787.546] (-788.274) (-792.378) * [-788.672] (-785.762) (-785.790) (-787.652) -- 0:00:42
262000 -- (-786.185) (-786.889) [-785.763] (-789.771) * (-787.347) (-787.138) (-786.246) [-788.917] -- 0:00:42
262500 -- (-787.823) (-787.279) (-786.953) [-787.279] * (-787.893) (-785.796) (-786.696) [-787.050] -- 0:00:42
263000 -- (-785.889) [-786.969] (-790.840) (-787.102) * (-786.932) (-789.671) [-792.602] (-789.052) -- 0:00:42
263500 -- (-787.034) [-787.697] (-789.455) (-789.463) * (-786.703) (-789.249) [-789.753] (-789.272) -- 0:00:41
264000 -- (-787.607) (-789.076) (-792.524) [-790.307] * (-785.966) (-787.885) [-790.941] (-788.554) -- 0:00:41
264500 -- (-787.317) (-788.754) (-788.257) [-786.309] * [-786.358] (-787.840) (-789.328) (-787.426) -- 0:00:41
265000 -- (-791.412) [-787.616] (-786.315) (-787.509) * (-788.106) [-787.421] (-787.262) (-786.057) -- 0:00:41
Average standard deviation of split frequencies: 0.012499
265500 -- (-788.727) [-786.433] (-797.747) (-788.816) * (-787.915) (-788.066) (-789.579) [-786.214] -- 0:00:44
266000 -- (-790.270) [-785.605] (-789.965) (-792.832) * (-787.996) (-786.134) [-789.114] (-786.986) -- 0:00:44
266500 -- (-792.140) (-789.230) (-787.152) [-788.169] * (-786.719) [-786.988] (-785.895) (-787.629) -- 0:00:44
267000 -- (-788.583) (-791.698) [-786.970] (-787.746) * (-786.975) (-788.301) (-793.367) [-786.747] -- 0:00:43
267500 -- (-788.658) (-794.822) (-786.000) [-789.757] * (-787.964) (-787.274) [-792.989] (-789.782) -- 0:00:43
268000 -- (-788.462) (-791.740) (-786.330) [-789.358] * (-788.860) (-788.212) (-789.528) [-787.049] -- 0:00:43
268500 -- (-787.780) [-788.796] (-785.895) (-788.973) * (-786.988) (-789.988) (-788.310) [-787.366] -- 0:00:43
269000 -- (-785.992) (-786.165) (-789.725) [-787.583] * [-789.235] (-788.874) (-786.785) (-790.973) -- 0:00:43
269500 -- (-785.757) (-786.266) (-788.507) [-786.326] * [-791.009] (-792.301) (-790.518) (-788.434) -- 0:00:43
270000 -- [-787.719] (-788.721) (-792.596) (-786.196) * [-787.844] (-789.969) (-788.289) (-790.289) -- 0:00:43
Average standard deviation of split frequencies: 0.010962
270500 -- (-788.151) (-785.525) [-787.276] (-785.684) * [-789.882] (-789.205) (-788.094) (-789.758) -- 0:00:43
271000 -- (-787.027) (-785.460) [-791.745] (-786.643) * (-788.384) (-786.192) (-786.158) [-788.912] -- 0:00:43
271500 -- [-789.474] (-787.269) (-786.342) (-792.250) * (-790.230) [-789.106] (-789.508) (-787.188) -- 0:00:42
272000 -- [-789.126] (-787.789) (-787.317) (-789.453) * (-791.257) (-788.780) [-787.605] (-785.961) -- 0:00:42
272500 -- [-787.965] (-786.677) (-792.010) (-790.583) * (-791.114) (-788.489) (-787.120) [-786.783] -- 0:00:42
273000 -- (-787.627) (-786.419) [-786.314] (-786.847) * (-791.123) (-789.526) (-788.315) [-787.421] -- 0:00:42
273500 -- [-785.809] (-787.144) (-789.165) (-789.253) * (-788.618) [-787.638] (-786.998) (-786.933) -- 0:00:42
274000 -- (-785.742) (-787.706) [-790.186] (-786.467) * [-786.552] (-788.629) (-790.428) (-785.929) -- 0:00:42
274500 -- (-788.257) (-785.434) [-785.864] (-791.044) * [-786.318] (-787.193) (-788.084) (-791.475) -- 0:00:42
275000 -- (-786.308) [-786.421] (-786.099) (-789.489) * (-788.357) (-786.952) [-786.768] (-794.105) -- 0:00:42
Average standard deviation of split frequencies: 0.011454
275500 -- [-788.516] (-790.384) (-785.814) (-790.122) * (-787.499) (-788.928) (-785.687) [-786.570] -- 0:00:42
276000 -- (-785.926) (-786.952) (-786.945) [-787.190] * (-787.232) (-792.526) (-785.948) [-785.752] -- 0:00:41
276500 -- (-786.716) [-785.932] (-786.021) (-787.161) * (-787.095) (-789.483) [-788.072] (-785.543) -- 0:00:41
277000 -- (-792.294) (-787.608) [-785.948] (-787.100) * (-788.653) (-786.576) (-789.675) [-787.175] -- 0:00:41
277500 -- (-792.040) (-786.301) [-787.345] (-788.925) * (-787.991) (-786.576) [-791.771] (-790.739) -- 0:00:41
278000 -- (-794.702) (-787.432) (-790.110) [-787.609] * (-788.949) (-790.608) [-788.429] (-788.130) -- 0:00:41
278500 -- (-787.032) (-788.028) [-788.710] (-785.997) * [-790.240] (-789.124) (-786.653) (-789.373) -- 0:00:41
279000 -- (-787.517) (-787.653) (-786.896) [-787.077] * [-786.093] (-785.900) (-788.515) (-789.829) -- 0:00:41
279500 -- (-787.831) (-788.919) [-786.152] (-788.161) * [-785.480] (-786.955) (-788.492) (-790.359) -- 0:00:41
280000 -- [-787.733] (-791.278) (-788.023) (-786.479) * [-786.844] (-786.915) (-786.765) (-792.783) -- 0:00:41
Average standard deviation of split frequencies: 0.013122
280500 -- (-791.448) (-789.591) [-788.735] (-787.541) * (-788.986) (-786.083) [-789.385] (-790.087) -- 0:00:41
281000 -- (-790.786) (-786.894) (-788.741) [-787.274] * (-790.346) (-786.363) [-788.651] (-786.839) -- 0:00:40
281500 -- (-788.406) (-786.059) (-788.622) [-785.820] * (-787.777) (-787.902) (-787.225) [-786.861] -- 0:00:40
282000 -- (-790.142) (-787.604) [-786.399] (-787.170) * [-792.432] (-789.289) (-789.216) (-786.327) -- 0:00:40
282500 -- (-787.158) (-787.733) [-785.814] (-789.706) * (-789.178) (-787.763) (-792.428) [-786.865] -- 0:00:43
283000 -- (-788.765) (-789.134) (-787.826) [-790.519] * (-786.333) [-787.898] (-790.400) (-788.484) -- 0:00:43
283500 -- (-787.986) [-789.184] (-786.255) (-788.209) * (-786.003) (-790.575) [-787.095] (-791.191) -- 0:00:42
284000 -- (-787.547) (-786.724) [-788.033] (-788.188) * (-790.720) [-787.186] (-788.920) (-788.001) -- 0:00:42
284500 -- [-788.041] (-787.040) (-787.661) (-786.662) * (-791.422) (-785.704) (-785.439) [-785.573] -- 0:00:42
285000 -- [-786.791] (-787.575) (-788.048) (-787.720) * (-790.107) (-785.689) (-789.715) [-785.612] -- 0:00:42
Average standard deviation of split frequencies: 0.012752
285500 -- [-786.865] (-788.424) (-787.225) (-790.041) * (-788.198) [-787.526] (-787.379) (-785.897) -- 0:00:42
286000 -- (-785.945) [-787.461] (-788.221) (-789.260) * (-788.481) (-787.851) (-787.169) [-786.538] -- 0:00:42
286500 -- [-787.786] (-788.138) (-787.852) (-787.766) * (-790.051) [-788.517] (-786.459) (-786.017) -- 0:00:42
287000 -- (-787.288) [-786.380] (-788.193) (-785.901) * (-795.318) (-789.716) (-787.357) [-788.663] -- 0:00:42
287500 -- [-786.382] (-788.218) (-788.981) (-785.806) * (-790.508) (-792.905) (-787.978) [-790.729] -- 0:00:42
288000 -- (-787.575) (-785.769) [-787.310] (-791.028) * (-793.848) (-794.796) [-789.690] (-787.354) -- 0:00:42
288500 -- (-788.066) (-786.420) [-787.124] (-786.872) * (-794.057) (-790.487) [-790.254] (-787.381) -- 0:00:41
289000 -- (-786.173) (-788.182) [-786.703] (-785.974) * (-788.021) (-793.425) [-786.274] (-786.090) -- 0:00:41
289500 -- (-788.513) (-786.927) [-786.884] (-785.782) * [-787.105] (-786.571) (-787.213) (-786.220) -- 0:00:41
290000 -- (-789.373) [-787.066] (-792.913) (-787.438) * (-788.591) (-787.466) [-786.594] (-791.063) -- 0:00:41
Average standard deviation of split frequencies: 0.012593
290500 -- [-787.944] (-785.659) (-791.577) (-787.396) * (-787.082) (-787.686) (-787.522) [-786.239] -- 0:00:41
291000 -- [-787.518] (-788.101) (-789.293) (-788.692) * [-787.665] (-787.294) (-785.975) (-787.635) -- 0:00:41
291500 -- (-787.601) [-789.344] (-788.758) (-787.508) * (-788.013) (-785.864) [-786.143] (-785.815) -- 0:00:41
292000 -- [-787.096] (-787.219) (-787.185) (-788.766) * [-786.528] (-786.333) (-786.886) (-786.148) -- 0:00:41
292500 -- (-789.371) (-789.082) (-789.937) [-788.782] * [-792.596] (-786.291) (-790.952) (-788.869) -- 0:00:41
293000 -- [-786.171] (-789.589) (-786.700) (-789.407) * (-788.663) [-787.942] (-786.729) (-789.846) -- 0:00:41
293500 -- (-786.171) (-790.986) (-790.574) [-790.493] * (-790.106) [-788.023] (-788.546) (-790.361) -- 0:00:40
294000 -- (-789.983) (-791.341) [-788.442] (-791.030) * [-788.005] (-787.531) (-789.424) (-790.712) -- 0:00:40
294500 -- [-785.840] (-787.063) (-786.911) (-786.453) * (-786.119) [-786.621] (-788.348) (-787.259) -- 0:00:40
295000 -- [-786.833] (-786.545) (-786.687) (-789.118) * (-785.927) [-786.829] (-786.940) (-792.324) -- 0:00:40
Average standard deviation of split frequencies: 0.011804
295500 -- (-787.027) [-788.230] (-789.202) (-787.336) * (-785.485) [-786.847] (-787.345) (-789.367) -- 0:00:40
296000 -- (-791.867) [-787.199] (-787.938) (-789.408) * [-785.724] (-788.776) (-788.321) (-792.465) -- 0:00:40
296500 -- (-787.885) (-786.168) [-786.587] (-786.945) * (-786.922) (-787.135) (-786.471) [-788.779] -- 0:00:40
297000 -- (-786.747) [-786.281] (-786.682) (-790.369) * [-786.073] (-787.268) (-787.276) (-789.476) -- 0:00:40
297500 -- (-786.251) (-787.033) [-786.509] (-787.837) * [-786.307] (-786.524) (-791.148) (-786.297) -- 0:00:40
298000 -- (-790.946) (-786.269) (-787.616) [-786.994] * [-790.765] (-791.203) (-787.206) (-786.919) -- 0:00:40
298500 -- (-788.481) (-789.143) (-786.776) [-792.633] * (-789.619) [-787.661] (-790.540) (-788.347) -- 0:00:39
299000 -- [-787.993] (-786.601) (-789.176) (-786.847) * (-789.248) (-787.129) [-789.633] (-789.617) -- 0:00:42
299500 -- [-787.425] (-786.587) (-789.984) (-786.059) * (-789.697) (-788.469) [-787.167] (-788.587) -- 0:00:42
300000 -- (-786.824) [-787.628] (-788.535) (-787.504) * (-787.042) (-789.079) (-792.802) [-789.639] -- 0:00:42
Average standard deviation of split frequencies: 0.012635
300500 -- (-785.730) (-786.282) (-785.867) [-788.123] * (-787.385) (-786.192) [-786.629] (-788.260) -- 0:00:41
301000 -- (-786.459) (-785.544) (-785.832) [-786.151] * (-787.466) (-787.047) [-788.802] (-789.312) -- 0:00:41
301500 -- (-799.069) [-785.540] (-785.868) (-788.699) * [-787.247] (-787.404) (-792.636) (-789.831) -- 0:00:41
302000 -- (-788.576) [-789.547] (-787.446) (-785.982) * [-786.745] (-786.833) (-789.593) (-791.168) -- 0:00:41
302500 -- [-789.018] (-789.875) (-787.347) (-788.837) * (-787.671) [-787.701] (-787.232) (-787.207) -- 0:00:41
303000 -- [-786.916] (-788.890) (-787.521) (-787.946) * (-786.954) (-790.590) (-789.878) [-789.865] -- 0:00:41
303500 -- (-786.281) [-787.600] (-788.442) (-786.807) * (-788.959) (-787.904) (-786.424) [-786.196] -- 0:00:41
304000 -- [-788.682] (-793.574) (-790.808) (-788.495) * [-787.635] (-786.231) (-789.739) (-790.931) -- 0:00:41
304500 -- (-788.968) [-785.619] (-786.332) (-790.446) * (-786.935) (-788.389) [-786.965] (-789.838) -- 0:00:41
305000 -- (-787.529) (-785.876) [-785.948] (-790.993) * (-785.907) (-786.989) [-786.053] (-790.233) -- 0:00:41
Average standard deviation of split frequencies: 0.013321
305500 -- [-788.188] (-790.673) (-790.918) (-790.252) * (-786.127) (-791.774) [-788.504] (-790.624) -- 0:00:40
306000 -- (-789.024) [-786.553] (-790.408) (-786.393) * (-786.738) (-786.591) [-788.192] (-786.709) -- 0:00:40
306500 -- [-788.120] (-787.610) (-788.072) (-787.399) * (-785.803) (-786.591) [-788.196] (-789.921) -- 0:00:40
307000 -- [-790.207] (-788.728) (-788.620) (-788.136) * (-787.044) [-785.792] (-788.883) (-789.894) -- 0:00:40
307500 -- (-786.167) [-788.200] (-788.914) (-787.925) * [-789.079] (-787.293) (-786.426) (-787.078) -- 0:00:40
308000 -- (-787.853) (-789.189) (-786.541) [-785.940] * (-786.376) [-785.771] (-786.396) (-787.350) -- 0:00:40
308500 -- (-786.214) [-789.358] (-786.548) (-788.270) * (-787.382) [-788.047] (-787.991) (-788.029) -- 0:00:40
309000 -- (-786.771) (-787.651) [-787.527] (-787.021) * (-785.323) (-786.696) (-788.237) [-787.347] -- 0:00:40
309500 -- [-787.270] (-786.514) (-787.077) (-786.986) * (-786.750) (-794.981) (-788.933) [-788.496] -- 0:00:40
310000 -- (-790.191) [-786.296] (-787.846) (-786.327) * (-785.502) (-791.166) [-791.229] (-786.217) -- 0:00:40
Average standard deviation of split frequencies: 0.013210
310500 -- (-787.639) (-790.761) (-787.169) [-788.013] * (-786.692) (-788.817) (-787.022) [-786.154] -- 0:00:39
311000 -- (-788.710) [-786.657] (-789.857) (-786.844) * (-786.993) (-787.967) (-788.406) [-787.907] -- 0:00:39
311500 -- [-792.151] (-786.285) (-786.069) (-785.996) * (-790.961) [-787.735] (-789.390) (-787.411) -- 0:00:39
312000 -- (-786.505) (-789.143) (-786.556) [-787.298] * (-787.919) (-787.052) (-788.234) [-787.367] -- 0:00:39
312500 -- (-791.540) (-790.797) (-786.600) [-786.619] * (-787.538) [-787.019] (-786.990) (-789.950) -- 0:00:39
313000 -- (-790.749) (-787.892) (-788.076) [-785.475] * (-788.358) (-787.554) (-789.485) [-787.202] -- 0:00:39
313500 -- (-786.618) (-788.404) (-788.637) [-788.006] * (-787.994) (-786.374) [-785.626] (-787.689) -- 0:00:39
314000 -- [-787.653] (-793.133) (-790.087) (-788.202) * (-785.342) [-790.141] (-786.437) (-789.308) -- 0:00:39
314500 -- (-786.344) (-791.892) [-787.207] (-788.893) * [-786.740] (-789.961) (-793.232) (-788.764) -- 0:00:39
315000 -- [-791.004] (-791.601) (-789.995) (-790.688) * (-789.976) [-790.168] (-790.793) (-787.799) -- 0:00:39
Average standard deviation of split frequencies: 0.013426
315500 -- (-787.744) (-787.199) [-785.653] (-788.778) * (-787.449) (-786.405) [-788.995] (-787.608) -- 0:00:41
316000 -- (-789.391) [-789.204] (-790.844) (-787.288) * (-787.718) (-790.551) [-786.361] (-787.042) -- 0:00:41
316500 -- (-785.804) (-788.065) (-789.871) [-787.269] * [-786.964] (-789.684) (-785.626) (-787.219) -- 0:00:41
317000 -- (-788.288) (-786.059) (-790.216) [-787.885] * [-785.656] (-793.354) (-787.564) (-786.941) -- 0:00:40
317500 -- [-791.493] (-786.065) (-789.586) (-790.038) * (-790.511) (-788.183) [-786.157] (-790.266) -- 0:00:40
318000 -- [-789.178] (-788.200) (-790.098) (-792.302) * (-789.533) [-787.268] (-789.928) (-786.421) -- 0:00:40
318500 -- (-788.879) (-786.762) (-787.234) [-787.369] * (-791.302) (-787.714) [-785.493] (-786.825) -- 0:00:40
319000 -- [-790.103] (-786.129) (-788.986) (-788.493) * (-789.028) [-789.581] (-786.882) (-789.317) -- 0:00:40
319500 -- (-786.278) (-787.698) (-787.021) [-786.973] * (-788.601) (-787.182) [-788.532] (-785.619) -- 0:00:40
320000 -- (-788.708) [-786.497] (-786.722) (-786.634) * (-790.688) (-787.735) [-788.550] (-785.757) -- 0:00:40
Average standard deviation of split frequencies: 0.012366
320500 -- (-790.047) [-786.505] (-786.966) (-786.724) * (-787.260) [-788.695] (-789.735) (-786.611) -- 0:00:40
321000 -- (-792.093) (-787.846) (-788.543) [-787.157] * [-786.156] (-788.676) (-788.240) (-789.375) -- 0:00:40
321500 -- (-790.652) [-787.456] (-787.630) (-787.601) * [-786.524] (-787.655) (-786.747) (-785.862) -- 0:00:40
322000 -- [-785.794] (-787.147) (-791.346) (-785.647) * (-787.474) (-788.726) [-787.647] (-787.303) -- 0:00:40
322500 -- (-786.585) (-786.521) (-787.161) [-786.982] * (-790.133) (-791.678) [-790.696] (-791.648) -- 0:00:39
323000 -- [-786.797] (-789.381) (-786.662) (-787.133) * (-792.845) (-787.536) [-786.641] (-790.009) -- 0:00:39
323500 -- [-785.506] (-790.111) (-787.189) (-789.835) * (-788.075) (-788.901) (-789.423) [-790.328] -- 0:00:39
324000 -- (-788.017) [-788.235] (-787.239) (-788.410) * (-788.279) (-787.845) [-787.522] (-787.217) -- 0:00:39
324500 -- (-786.829) [-789.678] (-787.145) (-788.600) * (-786.631) (-787.328) (-787.881) [-788.599] -- 0:00:39
325000 -- [-788.268] (-787.145) (-786.778) (-788.650) * (-785.706) (-789.431) [-789.707] (-788.452) -- 0:00:39
Average standard deviation of split frequencies: 0.012419
325500 -- (-787.724) [-791.279] (-785.935) (-788.356) * (-789.207) (-795.225) [-787.993] (-788.247) -- 0:00:39
326000 -- [-788.632] (-790.004) (-785.868) (-788.636) * [-789.085] (-788.589) (-788.548) (-787.287) -- 0:00:39
326500 -- (-788.563) (-785.594) [-786.196] (-788.656) * [-786.266] (-789.400) (-787.420) (-789.046) -- 0:00:39
327000 -- (-793.747) (-788.246) (-793.254) [-788.073] * [-786.930] (-787.067) (-787.876) (-787.369) -- 0:00:39
327500 -- (-787.496) (-787.113) (-790.074) [-786.152] * (-786.535) [-789.882] (-787.026) (-786.907) -- 0:00:39
328000 -- (-785.479) (-789.373) (-788.639) [-786.810] * (-789.498) [-789.705] (-788.714) (-787.199) -- 0:00:38
328500 -- (-785.837) (-788.061) [-786.952] (-787.508) * (-786.888) [-787.554] (-788.582) (-790.600) -- 0:00:38
329000 -- (-785.840) [-788.388] (-786.199) (-787.029) * (-787.929) (-786.038) [-788.141] (-788.680) -- 0:00:38
329500 -- (-787.507) (-788.373) (-787.279) [-787.707] * (-790.859) [-789.907] (-786.615) (-786.442) -- 0:00:38
330000 -- (-786.291) [-786.834] (-789.218) (-786.060) * (-787.529) (-787.172) (-788.045) [-786.350] -- 0:00:38
Average standard deviation of split frequencies: 0.011405
330500 -- (-788.718) [-787.191] (-788.598) (-787.670) * (-786.617) [-787.126] (-791.166) (-787.096) -- 0:00:38
331000 -- [-786.625] (-786.570) (-787.634) (-789.014) * (-789.183) (-788.401) [-788.588] (-789.971) -- 0:00:38
331500 -- [-786.562] (-790.760) (-786.383) (-790.247) * (-786.431) (-788.186) (-787.785) [-787.648] -- 0:00:38
332000 -- (-788.088) [-787.529] (-788.663) (-788.046) * (-787.025) (-788.276) [-788.537] (-788.318) -- 0:00:38
332500 -- (-788.420) (-786.439) [-785.705] (-786.957) * (-789.661) (-789.134) [-789.958] (-788.248) -- 0:00:40
333000 -- (-788.132) (-789.539) [-785.645] (-787.477) * [-787.702] (-790.336) (-788.041) (-785.842) -- 0:00:40
333500 -- (-789.891) (-788.160) (-785.688) [-787.746] * [-787.646] (-787.332) (-788.826) (-786.866) -- 0:00:39
334000 -- [-787.257] (-794.560) (-786.178) (-788.976) * (-788.227) (-786.769) (-791.106) [-789.819] -- 0:00:39
334500 -- (-785.798) [-788.677] (-787.031) (-786.214) * [-787.576] (-789.670) (-787.147) (-787.012) -- 0:00:39
335000 -- (-789.843) (-787.021) [-790.716] (-786.692) * [-786.551] (-789.450) (-786.584) (-786.997) -- 0:00:39
Average standard deviation of split frequencies: 0.012462
335500 -- (-787.317) [-786.253] (-789.798) (-788.672) * [-785.672] (-791.301) (-788.160) (-786.258) -- 0:00:39
336000 -- (-787.420) [-788.644] (-788.328) (-787.436) * [-785.898] (-797.266) (-787.907) (-787.313) -- 0:00:39
336500 -- [-786.804] (-787.823) (-790.537) (-787.917) * (-785.794) (-791.277) [-790.289] (-786.138) -- 0:00:39
337000 -- (-790.148) (-786.449) (-786.624) [-788.106] * (-785.752) (-789.284) [-790.573] (-786.614) -- 0:00:39
337500 -- (-787.605) (-786.632) (-787.447) [-786.225] * [-785.524] (-789.985) (-787.036) (-793.939) -- 0:00:39
338000 -- (-791.645) [-785.529] (-788.109) (-785.848) * (-785.923) (-786.572) [-786.503] (-786.608) -- 0:00:39
338500 -- (-787.236) (-787.381) [-786.894] (-787.787) * (-786.561) [-787.316] (-785.893) (-786.199) -- 0:00:39
339000 -- (-786.565) [-785.846] (-789.443) (-787.914) * [-787.651] (-793.122) (-789.381) (-792.181) -- 0:00:38
339500 -- (-791.687) (-785.785) (-789.742) [-786.228] * (-789.543) [-785.788] (-790.126) (-789.342) -- 0:00:38
340000 -- [-789.506] (-785.771) (-788.266) (-787.493) * (-787.781) (-786.736) (-790.012) [-785.784] -- 0:00:38
Average standard deviation of split frequencies: 0.012454
340500 -- (-786.129) (-786.335) [-790.088] (-788.694) * (-790.970) [-790.508] (-787.619) (-787.432) -- 0:00:38
341000 -- (-788.231) (-786.721) (-786.366) [-788.860] * (-795.509) (-788.512) [-786.154] (-787.965) -- 0:00:38
341500 -- (-787.974) (-786.498) [-786.624] (-790.245) * (-790.189) (-787.316) (-789.178) [-786.546] -- 0:00:38
342000 -- (-788.436) (-787.149) (-793.172) [-789.664] * (-787.487) (-790.323) [-787.500] (-787.171) -- 0:00:38
342500 -- (-788.304) (-788.753) [-785.865] (-790.549) * (-785.718) (-787.265) [-789.584] (-798.050) -- 0:00:38
343000 -- [-786.085] (-785.544) (-788.889) (-788.472) * [-786.468] (-787.893) (-788.869) (-792.151) -- 0:00:38
343500 -- (-786.611) [-787.686] (-786.847) (-789.968) * [-786.548] (-790.776) (-790.235) (-789.796) -- 0:00:38
344000 -- (-790.834) [-786.696] (-786.635) (-790.592) * (-787.101) (-787.711) [-787.356] (-787.946) -- 0:00:38
344500 -- (-787.045) (-787.280) [-787.310] (-789.226) * [-787.863] (-787.615) (-789.602) (-787.733) -- 0:00:38
345000 -- [-789.795] (-786.338) (-787.116) (-788.629) * (-787.992) [-788.004] (-787.671) (-789.491) -- 0:00:37
Average standard deviation of split frequencies: 0.012413
345500 -- (-790.215) (-788.584) (-786.614) [-795.731] * (-789.760) (-786.982) (-786.601) [-789.048] -- 0:00:37
346000 -- (-788.128) (-786.674) [-788.225] (-799.772) * (-786.779) (-787.537) (-786.480) [-786.984] -- 0:00:37
346500 -- (-786.911) [-785.561] (-787.874) (-787.135) * (-786.424) (-787.054) [-787.113] (-786.992) -- 0:00:37
347000 -- (-787.678) (-787.676) [-788.075] (-792.114) * (-788.106) (-787.527) (-792.182) [-786.094] -- 0:00:37
347500 -- (-786.494) (-787.278) [-786.581] (-787.358) * [-787.676] (-787.612) (-787.719) (-785.956) -- 0:00:37
348000 -- [-788.471] (-785.688) (-787.504) (-786.742) * (-787.914) [-788.705] (-787.901) (-786.345) -- 0:00:37
348500 -- (-787.802) [-787.385] (-788.573) (-786.549) * (-793.412) [-787.914] (-788.214) (-789.518) -- 0:00:37
349000 -- [-786.456] (-792.136) (-789.605) (-787.055) * (-787.838) [-786.835] (-785.756) (-790.061) -- 0:00:39
349500 -- (-785.738) [-787.510] (-792.261) (-786.116) * [-787.991] (-786.823) (-786.830) (-792.664) -- 0:00:39
350000 -- [-786.107] (-786.514) (-791.357) (-787.050) * (-789.241) (-786.071) (-786.276) [-789.060] -- 0:00:39
Average standard deviation of split frequencies: 0.011466
350500 -- [-786.244] (-786.827) (-787.917) (-788.208) * (-791.207) (-786.307) [-785.965] (-788.775) -- 0:00:38
351000 -- (-788.321) [-787.287] (-785.966) (-786.738) * [-790.660] (-790.174) (-788.901) (-786.387) -- 0:00:38
351500 -- (-789.896) (-787.067) (-785.905) [-787.056] * [-785.659] (-790.271) (-788.270) (-787.905) -- 0:00:38
352000 -- (-790.781) (-787.636) [-789.760] (-789.039) * (-789.104) [-789.304] (-787.818) (-788.376) -- 0:00:38
352500 -- (-786.820) (-795.587) [-787.515] (-786.960) * (-786.227) (-790.804) (-788.729) [-790.658] -- 0:00:38
353000 -- [-787.309] (-785.839) (-786.164) (-792.009) * (-786.993) (-789.244) (-788.896) [-786.345] -- 0:00:38
353500 -- [-785.875] (-788.557) (-786.607) (-789.714) * (-786.199) (-788.977) (-786.875) [-787.589] -- 0:00:38
354000 -- (-787.448) [-785.730] (-786.641) (-786.409) * (-785.945) (-790.482) (-791.549) [-787.601] -- 0:00:38
354500 -- [-785.645] (-786.620) (-787.762) (-788.579) * (-790.535) (-787.897) (-788.748) [-787.742] -- 0:00:38
355000 -- [-785.914] (-791.246) (-788.640) (-787.952) * (-789.274) [-788.988] (-789.912) (-791.196) -- 0:00:38
Average standard deviation of split frequencies: 0.011669
355500 -- (-788.476) (-792.637) [-787.486] (-789.063) * (-788.951) [-789.181] (-786.706) (-792.317) -- 0:00:38
356000 -- [-786.375] (-787.188) (-790.902) (-789.752) * (-785.623) (-787.495) [-787.933] (-791.432) -- 0:00:37
356500 -- (-785.891) (-787.137) (-789.317) [-789.219] * (-788.422) (-787.761) [-787.881] (-785.788) -- 0:00:37
357000 -- (-786.878) (-787.705) (-788.678) [-786.679] * (-791.598) (-788.317) (-790.050) [-786.401] -- 0:00:37
357500 -- (-787.826) [-789.953] (-789.836) (-787.405) * [-786.736] (-788.799) (-790.420) (-786.053) -- 0:00:37
358000 -- (-787.130) (-786.909) (-789.746) [-789.278] * (-787.028) (-789.385) [-789.878] (-786.820) -- 0:00:37
358500 -- [-787.820] (-787.278) (-788.615) (-787.177) * (-787.105) (-788.995) (-790.469) [-787.946] -- 0:00:37
359000 -- (-790.378) [-787.917] (-795.088) (-790.002) * [-787.353] (-788.052) (-793.834) (-790.946) -- 0:00:37
359500 -- (-788.454) (-788.383) [-790.731] (-787.266) * (-788.603) (-786.055) [-787.860] (-788.594) -- 0:00:37
360000 -- (-786.908) (-790.124) [-786.892] (-793.285) * (-790.760) (-787.032) [-790.697] (-787.912) -- 0:00:37
Average standard deviation of split frequencies: 0.011028
360500 -- (-785.967) (-786.650) (-789.812) [-788.883] * (-785.925) (-787.240) (-789.394) [-786.664] -- 0:00:37
361000 -- [-787.275] (-786.548) (-790.238) (-787.280) * (-786.298) (-787.211) [-789.299] (-789.925) -- 0:00:37
361500 -- [-786.555] (-785.478) (-790.581) (-785.806) * [-788.503] (-788.457) (-788.045) (-790.672) -- 0:00:37
362000 -- (-786.889) (-785.717) (-787.881) [-787.198] * (-788.370) [-787.547] (-786.225) (-789.329) -- 0:00:37
362500 -- (-787.126) [-786.214] (-786.675) (-789.278) * [-785.818] (-788.438) (-786.296) (-786.524) -- 0:00:36
363000 -- (-787.197) (-785.933) [-789.084] (-789.165) * (-786.904) (-792.907) [-787.099] (-786.728) -- 0:00:36
363500 -- (-789.244) [-785.825] (-787.161) (-790.112) * (-787.076) [-787.918] (-791.614) (-786.283) -- 0:00:36
364000 -- (-786.808) (-791.910) (-786.988) [-790.600] * (-786.344) (-788.046) (-788.969) [-789.558] -- 0:00:36
364500 -- (-787.541) (-786.403) (-787.619) [-788.634] * (-788.141) (-789.234) (-786.586) [-790.450] -- 0:00:36
365000 -- (-791.911) [-790.993] (-788.968) (-786.953) * [-787.447] (-788.670) (-787.295) (-790.709) -- 0:00:36
Average standard deviation of split frequencies: 0.010733
365500 -- (-790.586) (-786.685) [-786.488] (-787.001) * (-786.968) (-790.750) (-786.909) [-789.660] -- 0:00:38
366000 -- (-793.248) (-786.557) (-786.037) [-787.866] * (-787.860) [-786.042] (-789.059) (-786.891) -- 0:00:38
366500 -- (-794.513) [-787.996] (-789.434) (-787.333) * (-787.683) (-786.774) (-786.189) [-785.870] -- 0:00:38
367000 -- (-786.297) (-787.202) [-788.467] (-788.256) * (-793.274) (-786.599) (-791.085) [-786.345] -- 0:00:37
367500 -- [-785.717] (-787.008) (-786.540) (-789.594) * (-789.420) (-788.538) (-787.263) [-787.416] -- 0:00:37
368000 -- (-785.705) (-787.999) [-788.293] (-788.194) * (-788.404) [-790.185] (-793.421) (-787.115) -- 0:00:37
368500 -- (-788.628) (-786.486) [-787.416] (-790.971) * (-788.309) [-786.196] (-792.022) (-787.105) -- 0:00:37
369000 -- (-786.699) (-786.568) (-788.595) [-789.383] * [-788.265] (-787.604) (-789.347) (-790.233) -- 0:00:37
369500 -- [-786.006] (-786.977) (-786.964) (-787.910) * (-786.162) (-788.849) [-786.316] (-787.646) -- 0:00:37
370000 -- [-788.388] (-787.572) (-788.126) (-792.686) * (-785.694) (-786.791) (-787.173) [-787.825] -- 0:00:37
Average standard deviation of split frequencies: 0.009651
370500 -- (-789.115) (-787.177) (-789.770) [-789.950] * (-789.406) (-786.803) [-786.697] (-789.749) -- 0:00:37
371000 -- (-786.839) (-787.103) (-788.865) [-787.485] * (-788.820) (-786.596) [-786.591] (-793.225) -- 0:00:37
371500 -- (-785.901) (-791.259) [-788.849] (-785.847) * (-787.733) (-790.185) [-789.927] (-791.349) -- 0:00:37
372000 -- (-787.470) (-786.134) (-792.810) [-785.916] * (-787.596) (-788.685) (-786.298) [-787.345] -- 0:00:37
372500 -- (-788.575) (-792.708) [-785.905] (-787.523) * (-787.920) [-788.075] (-786.773) (-786.966) -- 0:00:37
373000 -- (-787.598) [-788.660] (-788.338) (-791.532) * (-789.636) (-787.677) (-786.565) [-791.162] -- 0:00:36
373500 -- (-787.397) (-789.109) [-785.792] (-788.005) * (-789.948) [-787.369] (-787.806) (-789.390) -- 0:00:36
374000 -- (-787.788) (-788.255) (-790.938) [-787.294] * (-789.892) [-787.052] (-787.092) (-793.521) -- 0:00:36
374500 -- (-787.248) (-789.984) (-788.394) [-787.441] * (-786.440) (-788.284) [-791.579] (-790.448) -- 0:00:36
375000 -- (-787.189) (-790.704) [-789.637] (-790.174) * [-786.316] (-789.166) (-785.796) (-787.742) -- 0:00:36
Average standard deviation of split frequencies: 0.010399
375500 -- (-787.403) (-788.534) [-786.183] (-789.830) * (-786.224) (-791.226) [-786.927] (-788.872) -- 0:00:36
376000 -- (-786.770) (-786.152) (-787.802) [-787.962] * (-792.048) (-788.026) [-787.175] (-789.652) -- 0:00:36
376500 -- (-788.810) [-786.044] (-793.724) (-786.758) * [-788.227] (-792.038) (-787.971) (-793.038) -- 0:00:36
377000 -- (-789.183) [-787.417] (-791.489) (-787.173) * [-787.252] (-790.153) (-787.081) (-797.176) -- 0:00:36
377500 -- (-789.381) [-786.862] (-789.320) (-789.537) * (-788.327) (-787.618) (-788.494) [-789.143] -- 0:00:36
378000 -- [-788.370] (-787.999) (-787.620) (-787.020) * [-787.911] (-789.390) (-786.773) (-787.837) -- 0:00:36
378500 -- (-789.013) [-787.755] (-790.576) (-787.582) * (-787.448) (-787.568) (-796.281) [-789.100] -- 0:00:36
379000 -- (-786.200) [-786.966] (-789.691) (-787.980) * [-785.936] (-791.313) (-788.077) (-785.989) -- 0:00:36
379500 -- (-787.694) (-786.966) (-787.763) [-789.437] * [-785.919] (-787.324) (-787.173) (-786.522) -- 0:00:35
380000 -- (-786.312) [-788.224] (-787.256) (-786.084) * (-786.330) [-787.025] (-791.946) (-785.554) -- 0:00:35
Average standard deviation of split frequencies: 0.010139
380500 -- (-786.965) (-787.140) [-787.714] (-785.893) * (-786.848) (-788.146) [-785.934] (-786.748) -- 0:00:35
381000 -- (-786.880) (-787.987) (-787.197) [-786.129] * (-787.610) (-792.501) (-790.425) [-788.009] -- 0:00:35
381500 -- (-788.075) (-787.982) [-787.354] (-788.005) * [-791.840] (-786.352) (-787.417) (-787.794) -- 0:00:35
382000 -- [-790.158] (-786.902) (-787.075) (-787.583) * (-788.972) (-785.815) (-787.764) [-785.951] -- 0:00:35
382500 -- [-787.699] (-786.995) (-788.634) (-787.641) * (-786.833) (-787.905) (-788.374) [-786.839] -- 0:00:37
383000 -- (-787.884) (-791.751) (-786.462) [-787.207] * (-785.486) (-787.162) (-786.842) [-786.103] -- 0:00:37
383500 -- [-788.478] (-788.403) (-786.145) (-787.051) * (-787.110) (-789.714) [-787.629] (-789.039) -- 0:00:36
384000 -- [-786.857] (-787.758) (-787.253) (-789.486) * (-790.714) (-791.713) [-788.264] (-788.261) -- 0:00:36
384500 -- (-786.494) (-788.555) [-787.472] (-787.480) * (-788.213) (-788.602) (-788.361) [-788.632] -- 0:00:36
385000 -- (-788.508) [-786.388] (-787.271) (-786.806) * (-786.281) (-786.859) [-787.145] (-786.758) -- 0:00:36
Average standard deviation of split frequencies: 0.010075
385500 -- (-789.144) (-788.598) [-786.192] (-789.827) * (-788.480) (-787.492) (-787.628) [-787.571] -- 0:00:36
386000 -- (-786.581) [-787.110] (-787.425) (-790.738) * [-787.137] (-786.661) (-787.033) (-786.643) -- 0:00:36
386500 -- [-787.748] (-787.654) (-786.269) (-786.181) * (-789.982) (-786.454) (-787.263) [-792.002] -- 0:00:36
387000 -- (-788.469) (-789.266) [-785.696] (-788.333) * (-787.122) [-787.140] (-788.233) (-793.325) -- 0:00:36
387500 -- [-786.956] (-785.938) (-790.855) (-792.249) * (-787.032) [-786.318] (-786.045) (-786.745) -- 0:00:36
388000 -- (-787.914) (-786.984) (-787.074) [-788.405] * (-787.943) (-788.761) (-786.313) [-786.491] -- 0:00:36
388500 -- [-793.996] (-787.505) (-794.146) (-789.237) * (-786.277) (-788.863) (-788.740) [-786.854] -- 0:00:36
389000 -- (-788.755) [-786.631] (-789.838) (-787.795) * (-787.521) (-788.154) [-786.802] (-787.057) -- 0:00:36
389500 -- (-788.963) (-788.653) [-786.133] (-788.734) * (-786.677) (-786.271) [-785.966] (-786.544) -- 0:00:36
390000 -- (-788.359) (-790.503) (-788.564) [-785.508] * (-788.773) [-786.819] (-786.885) (-792.670) -- 0:00:35
Average standard deviation of split frequencies: 0.010030
390500 -- (-788.206) (-786.507) (-787.321) [-786.333] * (-787.905) [-786.260] (-789.068) (-787.374) -- 0:00:35
391000 -- (-787.189) (-787.565) (-787.406) [-787.964] * [-787.731] (-785.884) (-787.904) (-787.250) -- 0:00:35
391500 -- [-786.052] (-787.438) (-786.163) (-787.402) * (-786.247) (-786.760) [-788.839] (-787.170) -- 0:00:35
392000 -- (-785.982) [-786.472] (-786.298) (-788.137) * [-785.417] (-789.742) (-788.195) (-787.708) -- 0:00:35
392500 -- (-787.893) (-786.798) (-786.834) [-788.505] * [-786.175] (-789.266) (-786.695) (-786.098) -- 0:00:35
393000 -- [-787.148] (-786.436) (-787.094) (-788.066) * (-786.242) (-790.739) [-787.505] (-787.195) -- 0:00:35
393500 -- [-787.007] (-788.607) (-793.902) (-787.300) * (-791.170) [-787.720] (-787.780) (-787.834) -- 0:00:35
394000 -- (-788.451) [-786.876] (-790.750) (-786.447) * (-790.885) (-787.609) [-789.010] (-786.850) -- 0:00:35
394500 -- (-786.724) (-787.455) (-786.585) [-787.053] * (-788.085) [-789.437] (-791.487) (-786.975) -- 0:00:35
395000 -- (-786.231) [-786.745] (-787.898) (-786.282) * (-787.656) (-789.922) [-788.236] (-788.688) -- 0:00:35
Average standard deviation of split frequencies: 0.010044
395500 -- [-786.575] (-788.619) (-788.389) (-786.451) * (-798.576) (-791.076) [-788.894] (-790.962) -- 0:00:35
396000 -- (-787.183) (-789.101) [-787.640] (-787.841) * (-792.572) (-787.048) (-788.793) [-788.523] -- 0:00:35
396500 -- [-786.065] (-787.634) (-787.267) (-786.942) * (-787.805) [-787.252] (-788.390) (-787.280) -- 0:00:35
397000 -- (-787.700) (-786.319) [-785.695] (-788.029) * (-791.170) (-789.723) [-788.556] (-786.733) -- 0:00:34
397500 -- [-786.586] (-786.518) (-790.048) (-788.195) * (-786.172) (-786.724) (-788.891) [-787.580] -- 0:00:34
398000 -- [-785.823] (-787.254) (-790.030) (-788.103) * (-787.435) (-786.487) [-790.079] (-799.420) -- 0:00:34
398500 -- [-786.440] (-787.120) (-787.199) (-788.003) * (-786.752) [-787.711] (-789.256) (-787.831) -- 0:00:34
399000 -- (-786.988) [-785.993] (-789.810) (-786.588) * [-786.031] (-793.869) (-788.640) (-787.485) -- 0:00:36
399500 -- (-786.998) (-787.937) (-789.825) [-788.417] * (-786.352) (-794.733) (-786.989) [-788.927] -- 0:00:36
400000 -- [-786.882] (-788.239) (-788.305) (-788.683) * [-787.406] (-791.746) (-791.297) (-788.418) -- 0:00:36
Average standard deviation of split frequencies: 0.010515
400500 -- (-787.269) [-785.602] (-788.405) (-789.009) * (-787.561) (-790.525) [-787.152] (-790.810) -- 0:00:35
401000 -- (-786.546) (-786.425) [-789.567] (-789.561) * [-787.278] (-791.622) (-788.061) (-786.552) -- 0:00:35
401500 -- (-787.166) [-785.360] (-791.866) (-787.427) * (-789.623) [-787.765] (-788.542) (-788.370) -- 0:00:35
402000 -- (-787.892) (-788.863) (-789.420) [-786.670] * (-788.435) (-786.040) [-786.450] (-788.202) -- 0:00:35
402500 -- (-788.079) (-793.579) (-788.389) [-790.455] * [-788.081] (-790.485) (-785.991) (-788.605) -- 0:00:35
403000 -- (-786.831) (-791.299) (-787.258) [-786.942] * (-787.153) (-788.094) [-787.274] (-790.195) -- 0:00:35
403500 -- (-788.040) (-788.232) (-786.022) [-789.513] * (-787.457) (-788.511) [-786.573] (-788.646) -- 0:00:35
404000 -- (-787.802) [-787.629] (-788.052) (-792.244) * [-787.385] (-790.768) (-786.827) (-787.466) -- 0:00:35
404500 -- (-786.432) (-785.449) (-789.159) [-787.136] * [-786.243] (-788.041) (-786.728) (-787.512) -- 0:00:35
405000 -- (-788.169) (-785.881) (-788.358) [-786.636] * (-786.119) (-785.541) [-786.432] (-789.583) -- 0:00:35
Average standard deviation of split frequencies: 0.009767
405500 -- (-790.211) (-785.922) [-787.975] (-788.481) * [-788.048] (-786.384) (-787.332) (-789.672) -- 0:00:35
406000 -- (-788.018) (-787.489) (-788.622) [-791.601] * (-785.758) (-788.620) (-787.023) [-790.154] -- 0:00:35
406500 -- [-787.088] (-792.807) (-788.292) (-793.716) * (-787.397) (-786.583) (-785.913) [-790.332] -- 0:00:35
407000 -- (-788.419) [-789.089] (-787.492) (-789.118) * (-788.108) [-786.433] (-785.806) (-790.326) -- 0:00:34
407500 -- (-789.940) (-788.365) [-787.272] (-792.170) * [-789.273] (-787.415) (-787.901) (-788.528) -- 0:00:34
408000 -- [-787.825] (-790.712) (-786.601) (-790.980) * (-792.926) [-787.356] (-788.310) (-791.716) -- 0:00:34
408500 -- (-788.308) (-789.974) (-788.579) [-786.914] * [-789.963] (-787.153) (-790.901) (-788.438) -- 0:00:34
409000 -- (-788.077) (-787.226) [-789.335] (-789.758) * (-787.810) [-788.226] (-788.192) (-788.131) -- 0:00:34
409500 -- (-786.819) [-787.950] (-791.933) (-787.663) * (-786.643) [-787.502] (-788.168) (-787.045) -- 0:00:34
410000 -- (-787.968) [-792.414] (-790.293) (-787.982) * (-788.489) [-787.349] (-786.565) (-787.194) -- 0:00:34
Average standard deviation of split frequencies: 0.009588
410500 -- (-786.117) [-788.305] (-790.493) (-793.504) * [-787.800] (-788.057) (-788.066) (-786.381) -- 0:00:34
411000 -- (-788.079) [-787.505] (-788.835) (-789.412) * (-787.332) (-789.404) (-786.523) [-786.464] -- 0:00:34
411500 -- (-787.027) [-786.597] (-787.315) (-796.041) * (-787.943) (-790.185) [-786.521] (-792.557) -- 0:00:34
412000 -- [-788.325] (-787.264) (-788.751) (-788.950) * (-788.326) [-786.502] (-786.419) (-787.488) -- 0:00:34
412500 -- (-786.735) (-786.744) [-787.097] (-788.613) * (-787.916) (-788.401) [-788.372] (-788.034) -- 0:00:34
413000 -- (-787.224) (-787.091) (-793.975) [-786.970] * (-787.087) (-787.533) [-790.417] (-787.465) -- 0:00:34
413500 -- (-787.419) [-788.420] (-787.188) (-788.702) * (-787.842) (-789.329) (-790.825) [-787.423] -- 0:00:34
414000 -- (-789.014) (-787.502) [-787.628] (-786.019) * (-788.381) (-791.716) [-786.702] (-786.925) -- 0:00:33
414500 -- (-786.212) (-788.204) (-789.415) [-787.491] * (-790.580) (-792.249) (-787.654) [-785.855] -- 0:00:33
415000 -- (-789.743) (-786.446) [-787.011] (-788.388) * [-788.568] (-786.347) (-785.743) (-787.068) -- 0:00:33
Average standard deviation of split frequencies: 0.009774
415500 -- (-788.695) (-787.740) [-790.125] (-791.150) * (-789.002) (-787.890) [-785.613] (-787.051) -- 0:00:35
416000 -- (-789.279) (-787.469) (-790.731) [-789.525] * (-786.221) [-785.786] (-797.367) (-786.647) -- 0:00:35
416500 -- (-788.315) (-789.691) [-787.896] (-795.753) * (-789.480) (-787.671) (-786.446) [-785.985] -- 0:00:35
417000 -- (-786.443) (-788.203) [-789.116] (-787.065) * (-789.840) (-787.949) (-787.607) [-788.490] -- 0:00:34
417500 -- [-786.283] (-786.946) (-788.830) (-788.719) * (-788.677) (-789.754) [-786.517] (-787.480) -- 0:00:34
418000 -- [-786.023] (-785.412) (-789.890) (-788.957) * (-788.185) [-790.868] (-788.856) (-794.105) -- 0:00:34
418500 -- (-791.788) [-789.196] (-787.792) (-787.168) * (-790.485) (-790.848) [-786.826] (-792.135) -- 0:00:34
419000 -- [-788.616] (-786.370) (-794.928) (-788.031) * (-786.613) (-787.253) [-786.294] (-788.238) -- 0:00:34
419500 -- (-786.829) [-785.783] (-786.280) (-788.474) * [-787.090] (-789.449) (-786.144) (-790.395) -- 0:00:34
420000 -- [-785.834] (-786.626) (-789.369) (-787.793) * (-786.725) [-786.042] (-786.272) (-787.434) -- 0:00:34
Average standard deviation of split frequencies: 0.009875
420500 -- (-792.543) [-786.737] (-791.678) (-787.213) * (-790.078) (-786.045) (-789.687) [-786.530] -- 0:00:34
421000 -- (-786.636) (-787.425) [-788.103] (-786.546) * (-790.112) [-786.998] (-792.305) (-788.124) -- 0:00:34
421500 -- (-788.167) (-791.854) [-787.344] (-786.559) * [-790.212] (-787.651) (-794.598) (-786.999) -- 0:00:34
422000 -- [-789.069] (-787.765) (-787.768) (-786.066) * (-786.574) (-789.983) (-786.371) [-796.513] -- 0:00:34
422500 -- (-787.582) [-785.978] (-790.716) (-786.076) * (-787.021) (-790.058) [-788.360] (-791.790) -- 0:00:34
423000 -- [-788.930] (-788.640) (-788.274) (-787.847) * (-786.502) [-785.768] (-788.233) (-787.022) -- 0:00:34
423500 -- (-787.875) [-787.814] (-795.550) (-785.898) * (-785.769) (-785.637) [-788.192] (-787.131) -- 0:00:34
424000 -- [-788.760] (-787.601) (-786.295) (-791.917) * (-786.330) (-786.523) [-786.086] (-786.502) -- 0:00:33
424500 -- [-790.863] (-786.161) (-789.020) (-790.388) * (-785.736) (-786.088) [-788.045] (-789.075) -- 0:00:33
425000 -- [-786.411] (-795.016) (-787.671) (-787.936) * (-787.046) [-785.992] (-788.054) (-788.906) -- 0:00:33
Average standard deviation of split frequencies: 0.009683
425500 -- (-786.250) (-785.933) (-789.895) [-787.137] * [-787.754] (-788.649) (-787.446) (-790.481) -- 0:00:33
426000 -- (-790.782) (-792.137) [-787.368] (-787.236) * (-786.621) [-786.219] (-789.599) (-789.558) -- 0:00:33
426500 -- [-787.224] (-792.575) (-787.175) (-788.959) * [-788.865] (-786.452) (-791.410) (-787.031) -- 0:00:33
427000 -- (-792.307) (-789.169) (-786.792) [-788.219] * (-789.272) (-788.111) (-792.872) [-788.902] -- 0:00:33
427500 -- (-790.491) (-789.403) [-788.714] (-787.132) * (-786.925) (-785.548) [-788.737] (-785.779) -- 0:00:33
428000 -- (-789.099) (-788.985) [-790.392] (-790.895) * (-788.287) [-785.624] (-787.643) (-786.584) -- 0:00:33
428500 -- [-786.935] (-787.268) (-789.300) (-790.391) * (-788.883) (-785.935) (-789.246) [-786.749] -- 0:00:33
429000 -- [-786.382] (-786.583) (-788.393) (-787.526) * (-788.852) (-788.241) (-790.741) [-786.028] -- 0:00:33
429500 -- (-788.263) [-787.857] (-791.214) (-788.867) * [-786.485] (-786.413) (-788.467) (-787.657) -- 0:00:33
430000 -- [-786.910] (-785.749) (-785.351) (-789.423) * (-788.227) (-790.691) (-786.645) [-790.717] -- 0:00:33
Average standard deviation of split frequencies: 0.010057
430500 -- (-789.693) (-787.004) [-787.125] (-787.201) * [-787.077] (-789.656) (-788.526) (-786.807) -- 0:00:33
431000 -- [-791.226] (-787.459) (-788.205) (-786.803) * [-789.242] (-786.671) (-787.724) (-791.831) -- 0:00:33
431500 -- (-790.257) (-787.469) (-786.037) [-785.670] * (-786.261) [-787.012] (-791.192) (-787.703) -- 0:00:32
432000 -- (-785.938) (-789.733) [-787.778] (-788.678) * (-785.785) (-786.901) (-787.528) [-788.365] -- 0:00:32
432500 -- (-786.174) (-787.046) (-787.680) [-787.564] * [-786.054] (-787.893) (-786.411) (-786.075) -- 0:00:34
433000 -- (-787.065) [-789.347] (-789.051) (-787.460) * (-787.371) (-790.269) [-786.756] (-788.251) -- 0:00:34
433500 -- [-786.465] (-787.948) (-785.994) (-786.449) * [-786.974] (-787.606) (-785.581) (-789.182) -- 0:00:33
434000 -- (-787.587) [-786.725] (-787.876) (-786.285) * (-786.975) [-787.318] (-786.978) (-789.195) -- 0:00:33
434500 -- [-789.170] (-787.984) (-787.907) (-785.809) * (-789.002) (-788.676) (-792.859) [-786.448] -- 0:00:33
435000 -- (-786.394) [-786.918] (-790.985) (-786.548) * (-789.513) (-785.955) (-796.365) [-786.861] -- 0:00:33
Average standard deviation of split frequencies: 0.010609
435500 -- (-790.669) (-789.772) [-789.032] (-786.239) * (-791.404) (-786.898) [-787.207] (-788.998) -- 0:00:33
436000 -- (-793.772) (-786.815) [-786.780] (-786.162) * (-787.241) [-787.979] (-787.551) (-788.930) -- 0:00:33
436500 -- (-789.730) (-788.199) (-788.165) [-786.097] * (-786.562) [-789.341] (-786.493) (-787.350) -- 0:00:33
437000 -- (-787.186) (-787.983) [-786.275] (-786.787) * (-787.906) (-788.340) [-787.193] (-789.479) -- 0:00:33
437500 -- (-786.984) [-786.821] (-787.156) (-786.972) * (-788.296) [-788.697] (-788.564) (-788.192) -- 0:00:33
438000 -- (-789.722) (-789.322) [-786.125] (-788.406) * (-788.029) (-787.287) [-785.646] (-788.813) -- 0:00:33
438500 -- (-787.778) (-793.292) [-786.041] (-787.810) * [-789.276] (-787.570) (-785.593) (-787.328) -- 0:00:33
439000 -- (-790.099) (-787.381) (-787.659) [-785.994] * (-787.198) (-786.601) [-786.759] (-791.721) -- 0:00:33
439500 -- (-789.362) [-788.660] (-787.881) (-786.665) * (-786.937) (-789.884) (-787.340) [-785.971] -- 0:00:33
440000 -- [-788.319] (-787.770) (-787.881) (-788.567) * (-789.061) (-788.333) [-788.670] (-789.768) -- 0:00:33
Average standard deviation of split frequencies: 0.010056
440500 -- [-786.367] (-786.874) (-789.377) (-787.233) * (-787.274) (-786.936) (-789.770) [-787.879] -- 0:00:33
441000 -- (-786.851) [-789.413] (-791.869) (-787.588) * (-789.194) (-788.416) (-796.766) [-786.077] -- 0:00:32
441500 -- (-788.034) (-787.820) (-785.683) [-786.797] * (-787.230) (-786.435) (-786.687) [-789.093] -- 0:00:32
442000 -- (-787.547) (-787.617) [-791.134] (-786.192) * (-791.430) (-786.341) (-793.987) [-788.110] -- 0:00:32
442500 -- [-790.672] (-788.272) (-789.017) (-786.862) * (-788.276) (-786.443) (-788.484) [-788.679] -- 0:00:32
443000 -- [-788.586] (-786.335) (-790.004) (-786.776) * [-786.079] (-788.526) (-788.074) (-787.354) -- 0:00:32
443500 -- (-790.556) (-787.929) [-787.361] (-786.481) * (-789.122) (-788.796) [-787.556] (-786.945) -- 0:00:32
444000 -- [-787.678] (-789.964) (-787.397) (-789.351) * [-788.114] (-790.256) (-787.880) (-788.404) -- 0:00:32
444500 -- (-793.039) (-789.621) (-790.557) [-789.117] * (-787.740) (-786.828) [-788.211] (-788.429) -- 0:00:32
445000 -- (-790.890) (-790.399) [-790.856] (-787.465) * (-787.142) [-786.680] (-787.023) (-786.990) -- 0:00:32
Average standard deviation of split frequencies: 0.011191
445500 -- (-789.786) (-790.863) (-786.619) [-787.769] * (-789.094) (-794.431) [-789.330] (-788.217) -- 0:00:32
446000 -- (-786.596) (-791.401) (-787.304) [-785.598] * (-786.107) (-787.232) [-790.519] (-788.733) -- 0:00:32
446500 -- (-787.669) [-788.143] (-788.952) (-786.976) * [-786.756] (-786.653) (-790.465) (-786.079) -- 0:00:32
447000 -- (-786.588) [-788.294] (-788.106) (-787.822) * (-789.997) (-789.884) [-791.067] (-790.063) -- 0:00:32
447500 -- [-792.743] (-789.081) (-785.563) (-792.645) * (-791.861) (-787.895) (-788.045) [-787.574] -- 0:00:32
448000 -- (-787.317) (-789.878) (-790.227) [-789.073] * (-788.942) [-790.556] (-787.250) (-790.081) -- 0:00:32
448500 -- (-786.812) (-787.766) (-786.194) [-788.251] * (-787.716) (-795.500) [-786.110] (-789.687) -- 0:00:31
449000 -- [-786.615] (-788.657) (-786.944) (-789.133) * (-787.610) (-787.559) [-786.110] (-789.374) -- 0:00:33
449500 -- (-786.783) [-788.862] (-787.517) (-788.600) * (-794.557) (-787.293) (-787.550) [-791.263] -- 0:00:33
450000 -- (-786.545) (-788.866) (-786.329) [-787.457] * (-787.268) [-787.847] (-785.473) (-790.071) -- 0:00:33
Average standard deviation of split frequencies: 0.009937
450500 -- (-786.445) (-791.341) (-788.220) [-787.331] * [-787.321] (-786.799) (-788.961) (-791.080) -- 0:00:32
451000 -- (-785.814) (-790.855) (-788.061) [-787.290] * (-787.573) [-785.985] (-785.864) (-786.275) -- 0:00:32
451500 -- [-786.038] (-789.310) (-787.632) (-787.267) * (-788.189) (-787.923) (-786.442) [-786.415] -- 0:00:32
452000 -- (-786.262) (-790.518) [-787.511] (-788.835) * (-793.897) [-787.673] (-786.003) (-786.478) -- 0:00:32
452500 -- (-789.197) [-789.815] (-787.467) (-787.372) * (-792.580) (-790.144) [-786.117] (-786.849) -- 0:00:32
453000 -- (-785.927) (-792.787) [-787.967] (-788.057) * (-789.469) (-788.792) (-787.599) [-786.693] -- 0:00:32
453500 -- (-791.392) (-790.556) [-788.907] (-788.770) * (-787.869) (-789.467) [-793.220] (-792.815) -- 0:00:32
454000 -- [-785.930] (-788.002) (-788.596) (-790.708) * [-788.437] (-787.751) (-788.167) (-787.797) -- 0:00:32
454500 -- [-787.573] (-790.066) (-787.773) (-791.825) * (-788.037) [-788.159] (-787.836) (-787.829) -- 0:00:32
455000 -- (-787.475) (-790.256) (-788.530) [-787.286] * (-790.142) (-786.357) (-790.753) [-786.251] -- 0:00:32
Average standard deviation of split frequencies: 0.009239
455500 -- (-786.004) [-787.471] (-788.910) (-787.686) * [-788.038] (-787.478) (-786.288) (-791.889) -- 0:00:32
456000 -- (-787.135) (-787.256) [-789.603] (-790.514) * (-790.596) (-788.282) [-790.238] (-790.076) -- 0:00:32
456500 -- (-789.384) (-786.203) (-790.937) [-788.132] * (-787.034) (-788.380) [-787.857] (-787.901) -- 0:00:32
457000 -- (-786.823) [-787.400] (-787.168) (-792.490) * (-786.138) (-788.044) [-786.507] (-787.788) -- 0:00:32
457500 -- (-788.202) (-789.668) [-787.539] (-791.317) * (-788.559) [-788.954] (-786.469) (-786.849) -- 0:00:32
458000 -- (-785.714) [-788.051] (-787.438) (-785.665) * [-788.500] (-786.138) (-787.153) (-787.476) -- 0:00:31
458500 -- (-787.120) [-787.012] (-786.826) (-788.940) * (-787.963) [-786.724] (-788.120) (-787.594) -- 0:00:31
459000 -- (-788.135) [-787.659] (-786.768) (-789.154) * [-787.945] (-789.461) (-787.215) (-787.738) -- 0:00:31
459500 -- (-788.432) (-788.850) [-789.654] (-789.142) * [-789.512] (-787.823) (-789.789) (-786.609) -- 0:00:31
460000 -- [-785.609] (-786.929) (-787.074) (-788.988) * (-789.564) (-789.432) [-790.076] (-787.200) -- 0:00:31
Average standard deviation of split frequencies: 0.009274
460500 -- [-786.623] (-786.724) (-787.345) (-786.372) * (-790.478) [-787.792] (-793.495) (-789.232) -- 0:00:31
461000 -- [-785.896] (-791.760) (-786.877) (-787.722) * (-788.668) (-786.789) (-792.998) [-787.365] -- 0:00:31
461500 -- (-788.096) [-788.016] (-788.055) (-787.062) * (-793.636) (-789.176) (-791.718) [-786.809] -- 0:00:31
462000 -- (-788.940) (-786.204) (-789.795) [-785.765] * [-788.946] (-789.474) (-791.554) (-787.024) -- 0:00:31
462500 -- (-791.067) (-787.338) [-787.884] (-787.644) * (-788.174) (-787.102) [-788.273] (-787.152) -- 0:00:31
463000 -- (-789.497) (-786.203) (-786.996) [-786.985] * [-787.696] (-785.634) (-786.522) (-788.322) -- 0:00:31
463500 -- (-789.469) (-786.946) (-787.821) [-787.660] * [-788.790] (-786.000) (-788.535) (-787.953) -- 0:00:31
464000 -- (-787.279) [-786.037] (-794.706) (-786.406) * (-788.363) (-785.926) [-785.401] (-788.617) -- 0:00:31
464500 -- [-792.106] (-789.405) (-789.705) (-790.631) * (-787.722) (-786.400) (-785.832) [-788.411] -- 0:00:31
465000 -- [-786.415] (-789.115) (-786.393) (-789.030) * (-790.448) [-790.394] (-787.913) (-788.716) -- 0:00:31
Average standard deviation of split frequencies: 0.009759
465500 -- [-785.836] (-787.935) (-786.665) (-790.078) * (-788.484) (-788.550) [-786.219] (-788.087) -- 0:00:32
466000 -- [-785.853] (-786.998) (-786.693) (-790.410) * (-788.918) (-787.686) [-787.212] (-789.338) -- 0:00:32
466500 -- [-787.100] (-785.734) (-787.611) (-789.355) * (-794.805) (-787.389) [-787.007] (-789.195) -- 0:00:32
467000 -- (-787.165) [-792.100] (-787.420) (-785.554) * (-788.159) (-787.181) [-785.966] (-788.271) -- 0:00:31
467500 -- (-790.057) (-792.556) (-796.780) [-786.330] * (-790.135) (-788.746) [-787.174] (-786.457) -- 0:00:31
468000 -- (-795.959) (-787.456) [-788.262] (-788.573) * (-787.948) [-788.828] (-787.194) (-789.435) -- 0:00:31
468500 -- (-795.326) (-786.774) [-788.788] (-787.095) * (-789.980) (-788.393) [-787.286] (-787.927) -- 0:00:31
469000 -- (-787.809) (-787.897) (-786.841) [-787.606] * (-789.047) (-787.631) [-785.883] (-786.243) -- 0:00:31
469500 -- (-787.762) (-788.190) [-785.919] (-787.154) * (-790.187) [-788.792] (-791.014) (-786.285) -- 0:00:31
470000 -- (-789.880) (-791.445) (-786.074) [-786.012] * (-787.392) [-787.864] (-786.942) (-788.453) -- 0:00:31
Average standard deviation of split frequencies: 0.009571
470500 -- (-786.658) (-790.537) [-788.338] (-788.340) * (-786.616) [-787.190] (-788.196) (-793.358) -- 0:00:31
471000 -- (-785.749) [-785.986] (-787.018) (-787.895) * (-786.991) (-786.611) [-790.826] (-787.307) -- 0:00:31
471500 -- [-786.033] (-786.623) (-786.833) (-788.376) * (-789.127) (-789.543) (-789.500) [-786.298] -- 0:00:31
472000 -- (-786.753) (-787.439) [-789.136] (-788.820) * (-788.684) (-790.326) [-785.990] (-786.171) -- 0:00:31
472500 -- (-786.753) (-787.135) (-793.269) [-786.920] * (-787.566) (-787.659) [-786.677] (-788.784) -- 0:00:31
473000 -- [-787.578] (-791.320) (-787.952) (-787.283) * [-787.731] (-787.860) (-786.617) (-787.015) -- 0:00:31
473500 -- (-789.004) (-786.247) (-786.534) [-788.247] * (-786.163) (-789.397) [-789.118] (-789.269) -- 0:00:31
474000 -- [-788.978] (-786.209) (-786.077) (-791.869) * (-786.584) (-787.790) [-786.825] (-788.656) -- 0:00:31
474500 -- (-787.224) [-786.564] (-787.010) (-788.851) * [-787.358] (-790.084) (-788.401) (-787.881) -- 0:00:31
475000 -- (-788.687) (-786.602) [-787.250] (-790.769) * (-788.709) (-788.390) (-790.627) [-787.423] -- 0:00:30
Average standard deviation of split frequencies: 0.009146
475500 -- (-791.111) (-788.480) [-787.862] (-788.432) * [-790.745] (-790.073) (-788.480) (-786.862) -- 0:00:30
476000 -- (-787.534) [-787.983] (-790.910) (-791.258) * (-785.517) [-789.024] (-791.861) (-789.319) -- 0:00:30
476500 -- (-785.827) (-787.825) [-788.721] (-788.130) * (-788.429) [-785.983] (-786.613) (-786.670) -- 0:00:30
477000 -- (-789.400) [-789.068] (-787.142) (-788.369) * (-790.115) (-785.595) (-788.533) [-787.167] -- 0:00:30
477500 -- [-790.918] (-786.784) (-791.337) (-787.166) * [-789.159] (-785.479) (-787.978) (-790.730) -- 0:00:30
478000 -- (-788.761) [-787.446] (-789.847) (-785.855) * [-786.463] (-786.117) (-786.460) (-801.027) -- 0:00:30
478500 -- (-793.079) [-787.500] (-787.336) (-789.796) * (-786.626) (-790.958) (-790.443) [-787.977] -- 0:00:30
479000 -- (-786.797) [-787.785] (-787.586) (-789.874) * (-785.554) (-786.869) (-787.435) [-788.890] -- 0:00:30
479500 -- (-789.769) [-787.636] (-787.156) (-787.357) * (-787.340) (-786.304) (-787.962) [-785.923] -- 0:00:30
480000 -- (-787.798) (-789.920) (-786.837) [-787.538] * (-786.092) (-788.785) [-787.299] (-787.348) -- 0:00:30
Average standard deviation of split frequencies: 0.009153
480500 -- [-788.071] (-790.335) (-787.752) (-794.777) * (-785.991) (-791.200) (-788.896) [-791.497] -- 0:00:30
481000 -- (-787.603) (-789.182) [-787.076] (-787.771) * (-787.915) (-790.799) (-787.350) [-788.295] -- 0:00:30
481500 -- (-787.723) (-791.955) (-789.191) [-789.813] * (-786.865) (-787.995) [-791.680] (-790.090) -- 0:00:30
482000 -- (-787.563) [-786.382] (-790.840) (-788.560) * [-787.017] (-787.588) (-786.711) (-788.221) -- 0:00:31
482500 -- (-786.797) (-788.125) [-791.148] (-786.639) * (-787.346) (-786.544) [-787.378] (-786.433) -- 0:00:31
483000 -- (-788.037) (-786.728) [-788.470] (-786.973) * (-786.437) [-790.435] (-786.470) (-790.806) -- 0:00:31
483500 -- (-786.400) (-789.461) (-787.350) [-786.138] * (-788.928) (-791.259) [-787.329] (-789.272) -- 0:00:30
484000 -- (-788.205) (-789.461) (-787.842) [-795.062] * (-788.443) (-789.671) (-789.369) [-785.648] -- 0:00:30
484500 -- (-795.896) (-786.986) [-785.813] (-787.623) * (-792.653) (-786.092) [-790.128] (-785.968) -- 0:00:30
485000 -- (-792.941) (-789.427) (-787.633) [-786.236] * (-791.766) [-786.476] (-786.139) (-786.806) -- 0:00:30
Average standard deviation of split frequencies: 0.009247
485500 -- (-793.114) (-795.151) [-791.753] (-788.827) * [-791.170] (-786.348) (-786.834) (-787.667) -- 0:00:30
486000 -- (-787.300) (-786.185) (-787.424) [-786.929] * (-790.506) (-787.683) [-786.747] (-788.010) -- 0:00:30
486500 -- (-789.383) (-787.360) (-787.646) [-787.005] * [-789.121] (-789.904) (-785.916) (-788.057) -- 0:00:30
487000 -- (-789.362) (-787.737) [-786.841] (-786.332) * (-793.223) (-787.354) (-790.039) [-787.183] -- 0:00:30
487500 -- (-787.149) (-786.862) [-786.414] (-785.920) * (-790.565) (-786.657) (-790.039) [-787.738] -- 0:00:30
488000 -- (-789.103) [-786.335] (-787.329) (-785.679) * [-789.815] (-786.241) (-786.581) (-789.354) -- 0:00:30
488500 -- (-788.344) (-796.381) (-788.387) [-788.155] * [-789.334] (-786.697) (-791.981) (-790.174) -- 0:00:30
489000 -- (-788.210) [-790.680] (-785.733) (-790.073) * [-787.825] (-787.726) (-787.403) (-786.282) -- 0:00:30
489500 -- (-787.602) [-791.209] (-786.171) (-786.756) * (-787.499) (-788.248) [-787.455] (-787.474) -- 0:00:30
490000 -- (-786.915) (-787.572) (-790.553) [-787.307] * (-785.419) [-785.532] (-786.552) (-786.965) -- 0:00:30
Average standard deviation of split frequencies: 0.009287
490500 -- (-786.465) (-786.742) [-786.605] (-787.562) * (-786.481) [-787.854] (-788.399) (-786.429) -- 0:00:30
491000 -- (-786.208) [-787.723] (-787.436) (-789.472) * (-789.521) (-786.782) [-787.900] (-787.612) -- 0:00:30
491500 -- (-785.711) (-790.940) (-786.215) [-788.224] * [-786.691] (-786.464) (-790.597) (-786.362) -- 0:00:30
492000 -- (-791.874) (-789.049) [-786.239] (-786.669) * (-787.196) (-787.859) [-786.095] (-790.061) -- 0:00:29
492500 -- (-785.995) (-787.459) [-787.442] (-788.453) * [-786.682] (-786.767) (-788.247) (-787.813) -- 0:00:29
493000 -- (-786.186) [-786.247] (-790.568) (-788.046) * [-788.357] (-787.749) (-786.611) (-789.723) -- 0:00:29
493500 -- (-790.100) (-789.092) [-786.197] (-787.312) * (-788.610) (-791.114) (-786.027) [-789.551] -- 0:00:29
494000 -- (-786.418) (-786.815) [-786.968] (-787.180) * (-786.753) [-788.116] (-788.502) (-789.121) -- 0:00:29
494500 -- (-786.798) [-789.066] (-786.235) (-786.620) * (-786.044) (-787.685) [-786.534] (-787.718) -- 0:00:29
495000 -- (-787.913) (-789.810) (-786.982) [-789.687] * (-788.547) [-787.295] (-791.012) (-786.165) -- 0:00:29
Average standard deviation of split frequencies: 0.009623
495500 -- (-786.917) [-786.915] (-786.001) (-788.373) * (-785.833) (-786.346) (-792.496) [-786.923] -- 0:00:29
496000 -- (-787.856) (-791.374) (-790.100) [-786.582] * (-786.935) (-786.943) (-787.877) [-786.298] -- 0:00:29
496500 -- (-789.408) (-794.140) (-787.039) [-786.603] * (-789.121) (-787.936) (-787.536) [-788.656] -- 0:00:29
497000 -- (-786.627) (-787.405) (-788.736) [-786.570] * (-788.009) (-787.269) (-789.634) [-787.908] -- 0:00:29
497500 -- (-791.708) [-788.154] (-787.344) (-785.973) * (-787.916) (-785.733) [-789.252] (-786.111) -- 0:00:29
498000 -- (-786.750) [-787.031] (-786.728) (-789.078) * (-794.496) (-785.588) [-788.617] (-790.489) -- 0:00:29
498500 -- (-788.631) (-786.514) [-791.303] (-785.888) * [-788.856] (-792.653) (-788.089) (-786.093) -- 0:00:29
499000 -- (-786.566) (-785.725) (-790.254) [-786.224] * [-785.935] (-786.783) (-787.347) (-786.353) -- 0:00:30
499500 -- (-789.137) (-786.387) [-789.368] (-786.105) * (-785.962) [-786.375] (-787.139) (-791.270) -- 0:00:30
500000 -- (-786.218) [-786.470] (-786.953) (-787.005) * (-788.927) (-787.665) [-785.738] (-785.891) -- 0:00:30
Average standard deviation of split frequencies: 0.009592
500500 -- (-786.798) (-787.467) (-790.731) [-786.162] * [-790.992] (-787.068) (-786.067) (-787.242) -- 0:00:29
501000 -- (-787.727) (-788.178) (-787.487) [-786.819] * (-787.640) (-788.909) (-785.755) [-789.566] -- 0:00:29
501500 -- (-789.292) (-786.979) [-789.490] (-787.098) * [-786.642] (-787.833) (-785.577) (-787.804) -- 0:00:29
502000 -- (-789.360) (-789.738) (-790.755) [-787.261] * (-787.016) (-790.116) [-787.449] (-787.426) -- 0:00:29
502500 -- (-787.711) [-787.206] (-785.971) (-787.660) * (-788.694) (-787.640) (-787.585) [-787.517] -- 0:00:29
503000 -- (-786.200) (-787.513) (-788.797) [-789.280] * (-789.037) (-789.437) [-790.340] (-786.189) -- 0:00:29
503500 -- (-788.107) (-788.650) [-790.441] (-790.726) * (-789.527) [-786.256] (-786.882) (-789.180) -- 0:00:29
504000 -- (-789.056) (-788.952) (-790.963) [-787.487] * (-790.633) [-787.819] (-787.737) (-787.646) -- 0:00:29
504500 -- (-786.315) (-787.666) (-786.265) [-787.345] * (-789.620) [-787.363] (-791.466) (-787.808) -- 0:00:29
505000 -- (-787.129) (-790.790) [-787.054] (-786.513) * (-787.357) (-787.311) [-790.366] (-787.310) -- 0:00:29
Average standard deviation of split frequencies: 0.008768
505500 -- (-787.878) (-787.764) [-789.297] (-786.151) * [-785.753] (-786.847) (-788.089) (-787.614) -- 0:00:29
506000 -- (-793.199) [-787.407] (-790.852) (-791.122) * [-788.696] (-787.008) (-789.309) (-787.791) -- 0:00:29
506500 -- (-794.061) [-787.589] (-788.980) (-788.676) * (-788.484) [-786.102] (-787.679) (-787.113) -- 0:00:29
507000 -- (-788.637) (-787.558) (-787.734) [-787.956] * [-790.129] (-789.011) (-786.693) (-790.368) -- 0:00:29
507500 -- (-790.123) (-786.681) [-788.190] (-786.422) * [-788.465] (-789.084) (-786.811) (-790.150) -- 0:00:29
508000 -- [-790.102] (-790.350) (-789.136) (-787.897) * (-787.559) [-789.541] (-786.518) (-789.148) -- 0:00:29
508500 -- (-787.542) [-792.462] (-793.234) (-786.031) * (-786.571) (-787.332) (-786.464) [-786.860] -- 0:00:28
509000 -- (-787.372) [-787.276] (-788.922) (-787.834) * (-787.677) (-787.031) [-790.122] (-787.913) -- 0:00:28
509500 -- [-789.040] (-790.231) (-791.861) (-788.392) * (-788.109) [-786.399] (-787.400) (-789.888) -- 0:00:28
510000 -- (-790.050) [-790.212] (-788.465) (-787.836) * (-789.096) (-788.171) [-786.348] (-789.659) -- 0:00:28
Average standard deviation of split frequencies: 0.009404
510500 -- [-788.528] (-788.001) (-788.656) (-788.411) * (-789.676) (-789.345) [-785.911] (-787.525) -- 0:00:28
511000 -- [-787.521] (-788.036) (-787.788) (-788.008) * (-789.043) (-792.651) (-787.101) [-786.715] -- 0:00:28
511500 -- (-789.288) (-788.735) (-788.891) [-786.551] * (-786.488) (-787.414) (-786.657) [-785.422] -- 0:00:28
512000 -- (-788.381) [-787.323] (-788.890) (-789.591) * (-786.727) [-787.915] (-786.987) (-787.449) -- 0:00:28
512500 -- (-788.286) [-788.907] (-789.640) (-786.035) * (-792.588) (-787.647) [-785.963] (-787.632) -- 0:00:28
513000 -- (-795.387) (-788.998) [-790.009] (-788.539) * [-788.381] (-788.184) (-787.968) (-790.830) -- 0:00:28
513500 -- (-792.117) (-787.410) [-786.468] (-791.135) * (-785.984) (-787.027) [-786.643] (-786.566) -- 0:00:28
514000 -- [-789.122] (-787.211) (-787.589) (-788.717) * (-786.843) [-787.808] (-787.071) (-787.135) -- 0:00:28
514500 -- (-787.190) (-785.895) (-789.686) [-788.560] * (-787.836) (-788.210) [-788.466] (-785.801) -- 0:00:28
515000 -- (-788.216) [-786.102] (-785.852) (-786.500) * [-786.666] (-785.691) (-788.032) (-786.282) -- 0:00:28
Average standard deviation of split frequencies: 0.009501
515500 -- [-787.187] (-788.361) (-786.366) (-786.551) * (-788.567) (-787.729) (-788.435) [-788.287] -- 0:00:29
516000 -- (-786.126) [-787.257] (-790.032) (-786.543) * (-787.557) (-787.578) (-790.040) [-789.797] -- 0:00:29
516500 -- (-786.698) (-788.110) [-786.857] (-787.827) * (-788.737) [-787.357] (-787.219) (-794.046) -- 0:00:29
517000 -- (-787.603) (-793.037) (-787.153) [-788.742] * [-789.476] (-787.613) (-787.011) (-786.832) -- 0:00:28
517500 -- (-787.624) (-790.266) (-786.212) [-787.683] * (-788.698) (-788.295) (-787.344) [-786.197] -- 0:00:28
518000 -- (-787.489) (-787.096) [-787.810] (-786.125) * (-790.038) (-788.731) (-789.201) [-787.968] -- 0:00:28
518500 -- (-787.740) [-789.098] (-786.804) (-786.483) * (-790.601) [-786.833] (-788.214) (-787.017) -- 0:00:28
519000 -- (-787.628) (-788.568) [-787.554] (-790.979) * [-791.815] (-788.155) (-787.201) (-788.714) -- 0:00:28
519500 -- [-787.610] (-788.529) (-787.014) (-788.861) * [-787.618] (-786.428) (-787.105) (-787.388) -- 0:00:28
520000 -- (-787.394) (-788.187) [-788.967] (-790.489) * (-790.404) [-788.359] (-788.078) (-786.269) -- 0:00:28
Average standard deviation of split frequencies: 0.008545
520500 -- (-787.595) (-788.329) [-787.554] (-791.771) * (-789.862) (-786.467) (-789.629) [-789.363] -- 0:00:28
521000 -- (-787.010) (-788.203) [-787.118] (-785.558) * (-786.583) [-785.746] (-788.638) (-788.898) -- 0:00:28
521500 -- (-787.867) (-787.680) (-787.550) [-787.056] * (-786.143) (-785.842) [-788.718] (-787.075) -- 0:00:28
522000 -- (-786.678) (-786.116) (-786.432) [-786.552] * (-787.275) [-788.046] (-788.837) (-788.923) -- 0:00:28
522500 -- (-787.447) (-788.018) [-792.439] (-787.168) * (-788.078) (-786.604) [-787.717] (-786.149) -- 0:00:28
523000 -- (-789.798) (-788.663) (-789.208) [-788.972] * [-786.820] (-787.000) (-787.309) (-786.136) -- 0:00:28
523500 -- [-787.705] (-787.791) (-786.169) (-786.451) * (-788.813) [-789.210] (-786.141) (-787.889) -- 0:00:28
524000 -- (-787.624) (-787.737) (-786.312) [-785.484] * (-789.767) [-790.813] (-790.301) (-787.721) -- 0:00:28
524500 -- (-788.802) (-788.363) (-786.617) [-792.074] * (-787.774) (-791.578) (-786.346) [-790.106] -- 0:00:28
525000 -- [-788.587] (-787.822) (-788.346) (-786.003) * (-789.281) (-787.974) [-787.235] (-786.628) -- 0:00:28
Average standard deviation of split frequencies: 0.008906
525500 -- (-790.680) (-786.970) (-788.614) [-785.983] * [-791.901] (-792.199) (-787.099) (-789.988) -- 0:00:27
526000 -- (-786.516) [-786.829] (-789.527) (-787.601) * (-789.196) [-785.869] (-786.936) (-786.345) -- 0:00:27
526500 -- [-786.790] (-791.048) (-789.189) (-788.240) * [-792.745] (-787.672) (-788.482) (-791.018) -- 0:00:27
527000 -- (-786.406) [-787.412] (-785.760) (-797.305) * (-792.855) (-789.463) [-787.983] (-789.896) -- 0:00:27
527500 -- (-787.534) [-788.316] (-786.012) (-789.922) * (-788.711) (-790.281) [-792.110] (-788.410) -- 0:00:27
528000 -- [-785.585] (-789.883) (-786.929) (-787.741) * (-788.590) (-788.517) [-786.623] (-787.868) -- 0:00:27
528500 -- (-794.218) (-788.494) (-788.419) [-785.706] * (-788.220) (-787.312) [-785.807] (-789.249) -- 0:00:27
529000 -- (-786.601) (-788.953) (-789.783) [-785.730] * (-786.892) (-789.217) (-787.856) [-786.430] -- 0:00:27
529500 -- (-787.455) [-786.747] (-786.738) (-785.708) * [-785.792] (-788.492) (-789.129) (-786.658) -- 0:00:27
530000 -- [-785.851] (-787.282) (-788.007) (-789.978) * (-785.580) [-787.231] (-787.484) (-787.010) -- 0:00:27
Average standard deviation of split frequencies: 0.009475
530500 -- [-788.805] (-785.536) (-787.755) (-786.592) * (-791.423) (-787.967) [-787.581] (-785.655) -- 0:00:27
531000 -- (-785.683) (-785.622) [-786.028] (-787.939) * [-788.482] (-786.632) (-788.642) (-786.216) -- 0:00:27
531500 -- (-787.986) (-788.867) (-788.089) [-786.131] * (-786.297) (-787.937) (-791.690) [-786.899] -- 0:00:27
532000 -- (-785.981) (-786.216) (-788.699) [-787.621] * (-787.101) (-789.114) (-790.647) [-789.644] -- 0:00:28
532500 -- [-786.330] (-787.777) (-791.271) (-790.285) * (-786.306) [-787.877] (-788.243) (-788.196) -- 0:00:28
533000 -- (-788.333) (-785.921) [-789.177] (-789.520) * (-786.560) (-786.101) [-793.757] (-789.333) -- 0:00:28
533500 -- (-787.240) (-785.832) (-787.900) [-790.307] * [-787.210] (-786.162) (-790.909) (-791.189) -- 0:00:27
534000 -- (-785.494) [-786.086] (-787.927) (-786.508) * (-787.720) (-785.460) [-789.519] (-791.474) -- 0:00:27
534500 -- (-787.278) (-785.731) (-790.571) [-787.627] * (-787.772) [-785.422] (-787.757) (-787.676) -- 0:00:27
535000 -- [-788.681] (-785.731) (-787.837) (-789.128) * (-793.429) (-789.007) (-788.011) [-787.684] -- 0:00:27
Average standard deviation of split frequencies: 0.009029
535500 -- (-788.028) [-787.175] (-786.377) (-785.731) * (-787.007) (-786.455) [-785.912] (-785.829) -- 0:00:27
536000 -- (-789.736) [-785.669] (-790.398) (-785.936) * [-785.637] (-787.820) (-785.911) (-790.440) -- 0:00:27
536500 -- (-789.612) (-789.142) [-787.598] (-792.266) * (-788.379) (-787.529) [-790.243] (-788.412) -- 0:00:27
537000 -- (-788.107) [-790.836] (-787.640) (-789.310) * [-787.713] (-793.587) (-785.762) (-787.077) -- 0:00:27
537500 -- (-786.448) [-788.814] (-786.925) (-787.591) * [-788.737] (-793.244) (-785.744) (-788.001) -- 0:00:27
538000 -- (-786.865) (-787.536) [-787.196] (-785.808) * (-790.518) (-787.833) [-786.590] (-788.696) -- 0:00:27
538500 -- (-786.217) [-794.455] (-787.438) (-789.792) * (-786.610) [-787.600] (-788.514) (-786.682) -- 0:00:27
539000 -- (-786.557) (-785.334) (-786.156) [-792.956] * [-787.764] (-785.648) (-788.956) (-786.604) -- 0:00:27
539500 -- (-787.427) (-787.781) [-786.685] (-787.569) * [-789.597] (-788.956) (-791.623) (-786.452) -- 0:00:27
540000 -- (-789.283) (-786.673) [-787.425] (-789.115) * [-785.819] (-788.036) (-788.466) (-786.853) -- 0:00:27
Average standard deviation of split frequencies: 0.008719
540500 -- (-790.069) (-789.475) [-785.970] (-787.990) * (-787.860) (-787.984) [-787.888] (-788.923) -- 0:00:27
541000 -- (-787.132) [-787.423] (-787.913) (-791.261) * [-788.686] (-786.175) (-788.180) (-788.568) -- 0:00:27
541500 -- [-787.712] (-785.569) (-787.542) (-789.062) * (-789.571) [-786.272] (-789.252) (-789.729) -- 0:00:27
542000 -- (-786.224) (-788.612) (-786.890) [-790.031] * (-790.166) [-788.408] (-786.269) (-786.989) -- 0:00:27
542500 -- (-786.523) (-789.703) [-786.431] (-788.648) * (-793.885) (-792.819) (-788.304) [-787.167] -- 0:00:26
543000 -- (-787.845) (-788.702) (-787.589) [-792.031] * (-792.621) (-790.037) [-793.410] (-787.257) -- 0:00:26
543500 -- (-786.568) [-786.284] (-786.470) (-786.009) * (-790.560) (-788.349) [-785.904] (-789.628) -- 0:00:26
544000 -- (-788.236) (-790.599) [-786.587] (-785.809) * [-790.519] (-786.325) (-786.557) (-787.416) -- 0:00:26
544500 -- (-787.975) (-788.830) (-785.871) [-790.364] * (-787.120) (-786.165) [-790.681] (-787.856) -- 0:00:26
545000 -- (-786.977) [-787.298] (-790.068) (-790.295) * (-787.476) [-787.186] (-787.950) (-789.606) -- 0:00:26
Average standard deviation of split frequencies: 0.008806
545500 -- (-785.526) (-786.553) (-790.057) [-786.017] * (-788.840) (-790.137) (-786.882) [-785.652] -- 0:00:26
546000 -- [-788.205] (-787.689) (-788.684) (-787.689) * [-788.801] (-787.693) (-788.387) (-787.736) -- 0:00:26
546500 -- (-786.605) (-787.031) (-786.756) [-787.235] * (-786.421) [-787.539] (-789.313) (-787.940) -- 0:00:26
547000 -- (-786.284) (-788.114) (-788.597) [-785.776] * (-789.449) (-788.944) (-790.755) [-786.695] -- 0:00:26
547500 -- (-787.948) (-788.113) [-789.982] (-789.842) * (-789.449) [-788.096] (-786.919) (-786.352) -- 0:00:26
548000 -- [-789.419] (-789.776) (-788.761) (-785.293) * (-788.124) (-790.443) (-789.086) [-785.991] -- 0:00:26
548500 -- (-786.618) (-788.423) [-787.676] (-788.449) * (-786.783) (-788.303) [-788.130] (-786.162) -- 0:00:26
549000 -- (-785.934) (-788.585) [-787.972] (-786.388) * [-787.054] (-786.368) (-786.530) (-787.168) -- 0:00:27
549500 -- (-787.198) (-787.678) (-785.903) [-787.580] * (-786.362) (-787.174) (-786.279) [-787.598] -- 0:00:27
550000 -- [-789.478] (-791.112) (-788.957) (-788.190) * (-788.894) [-785.813] (-785.914) (-786.936) -- 0:00:27
Average standard deviation of split frequencies: 0.008389
550500 -- (-787.457) (-791.445) (-788.540) [-787.746] * (-791.633) [-789.817] (-785.788) (-788.419) -- 0:00:26
551000 -- (-787.481) [-786.533] (-787.413) (-791.725) * (-789.637) (-790.875) (-785.888) [-787.951] -- 0:00:26
551500 -- (-786.862) (-787.562) (-786.950) [-785.917] * (-788.793) (-787.886) (-786.256) [-786.778] -- 0:00:26
552000 -- (-786.312) [-791.321] (-786.968) (-786.857) * (-786.653) (-787.844) (-789.114) [-787.399] -- 0:00:26
552500 -- (-788.287) [-787.957] (-785.415) (-786.855) * [-787.785] (-788.296) (-787.640) (-787.792) -- 0:00:26
553000 -- (-789.862) [-787.508] (-785.873) (-786.594) * (-786.867) [-787.501] (-787.655) (-787.614) -- 0:00:26
553500 -- (-792.084) [-787.036] (-785.619) (-786.230) * (-791.428) (-788.210) [-790.276] (-787.224) -- 0:00:26
554000 -- (-786.307) [-786.107] (-787.749) (-788.292) * [-793.117] (-786.697) (-791.815) (-788.520) -- 0:00:26
554500 -- (-786.385) (-787.059) (-786.790) [-790.739] * [-787.868] (-786.266) (-787.737) (-788.774) -- 0:00:26
555000 -- [-787.807] (-791.357) (-787.972) (-792.416) * [-786.538] (-786.254) (-785.961) (-789.609) -- 0:00:26
Average standard deviation of split frequencies: 0.008139
555500 -- (-787.627) (-787.686) (-786.281) [-785.669] * [-786.521] (-786.288) (-787.001) (-789.430) -- 0:00:26
556000 -- (-788.882) (-788.154) (-788.014) [-787.795] * (-789.785) (-788.478) (-787.629) [-787.289] -- 0:00:26
556500 -- (-786.833) [-788.343] (-788.221) (-791.742) * (-786.729) (-789.290) [-787.554] (-787.685) -- 0:00:26
557000 -- (-790.500) (-789.269) (-789.082) [-786.639] * (-788.719) (-787.472) [-786.428] (-787.591) -- 0:00:26
557500 -- (-787.730) (-786.471) (-790.192) [-786.814] * (-786.550) (-788.911) [-787.448] (-788.995) -- 0:00:26
558000 -- [-788.572] (-789.253) (-789.328) (-791.057) * [-785.972] (-790.020) (-788.553) (-788.253) -- 0:00:26
558500 -- (-786.595) [-792.089] (-788.496) (-794.762) * [-787.128] (-787.593) (-788.007) (-789.826) -- 0:00:26
559000 -- (-786.797) (-787.702) (-786.799) [-788.844] * (-788.543) [-787.275] (-787.298) (-792.074) -- 0:00:26
559500 -- (-788.269) [-791.837] (-786.550) (-787.216) * [-787.344] (-785.712) (-786.740) (-788.884) -- 0:00:25
560000 -- (-789.495) (-786.348) (-787.143) [-787.477] * (-786.467) (-786.165) (-793.219) [-788.118] -- 0:00:25
Average standard deviation of split frequencies: 0.008352
560500 -- [-786.947] (-790.012) (-787.064) (-792.149) * (-787.613) (-786.864) [-786.639] (-788.088) -- 0:00:25
561000 -- (-787.351) (-790.430) [-786.659] (-787.783) * (-789.745) (-787.397) (-787.452) [-787.379] -- 0:00:25
561500 -- (-788.521) (-786.521) [-790.001] (-787.081) * [-785.934] (-788.052) (-787.937) (-788.057) -- 0:00:25
562000 -- (-792.079) (-789.555) [-787.071] (-786.098) * [-786.438] (-789.851) (-788.454) (-786.748) -- 0:00:25
562500 -- (-789.496) [-786.746] (-787.628) (-790.377) * (-786.529) (-788.300) [-790.605] (-787.164) -- 0:00:25
563000 -- [-787.199] (-788.324) (-787.850) (-787.446) * [-786.804] (-787.607) (-786.177) (-788.288) -- 0:00:25
563500 -- (-787.390) [-788.541] (-787.191) (-787.772) * (-786.346) (-785.556) (-789.353) [-786.767] -- 0:00:25
564000 -- (-787.588) (-791.720) (-786.666) [-789.352] * (-787.348) (-785.884) (-786.569) [-785.445] -- 0:00:25
564500 -- (-788.311) (-789.472) (-789.828) [-787.045] * (-788.914) [-786.583] (-787.504) (-787.334) -- 0:00:25
565000 -- (-787.514) [-789.325] (-787.529) (-787.872) * (-787.747) [-786.539] (-786.818) (-788.034) -- 0:00:25
Average standard deviation of split frequencies: 0.008828
565500 -- (-786.828) (-791.768) [-787.549] (-788.600) * (-789.098) (-789.049) (-786.279) [-790.870] -- 0:00:26
566000 -- (-788.247) (-794.565) (-786.521) [-789.078] * [-786.004] (-788.519) (-786.361) (-786.968) -- 0:00:26
566500 -- (-786.466) [-787.260] (-787.943) (-791.561) * [-786.371] (-788.696) (-789.164) (-787.507) -- 0:00:26
567000 -- [-786.095] (-786.251) (-788.140) (-791.027) * [-790.614] (-785.699) (-789.668) (-787.347) -- 0:00:25
567500 -- (-788.428) [-785.937] (-787.667) (-794.298) * (-787.788) (-787.669) [-787.409] (-789.367) -- 0:00:25
568000 -- (-786.723) [-789.056] (-788.408) (-787.033) * (-791.797) (-786.171) (-789.510) [-790.166] -- 0:00:25
568500 -- [-786.561] (-787.568) (-790.582) (-788.743) * (-787.250) [-786.882] (-792.624) (-787.385) -- 0:00:25
569000 -- [-786.463] (-786.596) (-787.366) (-786.852) * [-789.806] (-787.360) (-794.575) (-786.031) -- 0:00:25
569500 -- (-786.347) (-788.871) (-789.639) [-788.551] * (-790.583) (-786.166) (-789.012) [-786.578] -- 0:00:25
570000 -- [-785.758] (-790.436) (-788.427) (-788.804) * (-791.540) [-785.627] (-785.931) (-786.296) -- 0:00:25
Average standard deviation of split frequencies: 0.009087
570500 -- (-785.722) (-786.409) [-787.498] (-786.482) * (-787.479) (-786.565) (-787.063) [-786.727] -- 0:00:25
571000 -- (-790.246) (-785.919) (-789.642) [-788.773] * [-787.041] (-790.245) (-786.625) (-786.420) -- 0:00:25
571500 -- (-789.987) [-788.260] (-787.550) (-794.821) * (-787.668) (-788.005) [-786.820] (-787.586) -- 0:00:25
572000 -- (-787.158) (-793.062) (-788.043) [-788.731] * (-790.943) [-788.969] (-786.315) (-791.695) -- 0:00:25
572500 -- (-785.687) (-788.775) (-789.155) [-788.493] * [-791.021] (-789.313) (-788.335) (-786.605) -- 0:00:25
573000 -- (-786.780) [-791.177] (-790.612) (-792.125) * (-788.198) [-785.783] (-789.683) (-789.224) -- 0:00:25
573500 -- [-785.699] (-786.464) (-789.776) (-786.590) * (-790.858) (-785.592) (-788.019) [-787.452] -- 0:00:25
574000 -- [-786.618] (-785.699) (-793.075) (-788.491) * (-786.941) (-786.722) [-789.128] (-789.562) -- 0:00:25
574500 -- (-787.354) (-785.869) (-791.749) [-788.567] * (-787.878) [-788.504] (-786.629) (-792.217) -- 0:00:25
575000 -- (-788.132) (-787.305) [-786.880] (-786.213) * [-787.380] (-790.784) (-788.505) (-790.087) -- 0:00:25
Average standard deviation of split frequencies: 0.009330
575500 -- (-785.863) [-786.971] (-789.185) (-787.248) * (-787.960) (-789.493) (-786.578) [-787.593] -- 0:00:25
576000 -- (-785.781) [-787.007] (-787.952) (-786.677) * (-786.478) (-787.027) (-786.832) [-786.599] -- 0:00:25
576500 -- (-787.094) [-787.868] (-791.454) (-787.491) * (-786.503) [-788.422] (-788.799) (-786.895) -- 0:00:24
577000 -- (-787.158) [-790.564] (-793.958) (-787.615) * (-789.234) [-792.612] (-789.194) (-788.330) -- 0:00:24
577500 -- [-786.404] (-790.350) (-788.207) (-787.070) * (-790.003) [-788.392] (-790.686) (-786.458) -- 0:00:24
578000 -- (-786.046) [-788.341] (-791.019) (-789.645) * [-786.833] (-788.718) (-787.209) (-790.119) -- 0:00:24
578500 -- (-787.407) (-789.243) (-789.359) [-791.082] * (-790.569) (-786.961) (-787.281) [-786.765] -- 0:00:24
579000 -- (-787.276) [-785.939] (-788.187) (-790.416) * (-787.504) (-790.050) [-787.797] (-786.182) -- 0:00:24
579500 -- (-787.531) (-786.063) [-789.346] (-788.237) * [-789.284] (-788.111) (-789.649) (-785.766) -- 0:00:24
580000 -- (-786.179) [-787.304] (-785.751) (-795.632) * (-788.775) [-787.165] (-787.197) (-789.520) -- 0:00:24
Average standard deviation of split frequencies: 0.009634
580500 -- (-786.394) (-787.830) (-785.489) [-789.512] * (-786.415) [-787.269] (-789.141) (-789.515) -- 0:00:24
581000 -- (-785.592) (-793.912) [-787.058] (-787.115) * (-786.845) (-790.248) [-792.870] (-788.713) -- 0:00:24
581500 -- [-785.884] (-785.983) (-789.364) (-786.478) * (-788.242) (-788.544) (-788.980) [-787.540] -- 0:00:24
582000 -- (-786.467) (-787.909) (-789.539) [-787.854] * (-789.352) (-787.633) [-788.426] (-785.497) -- 0:00:25
582500 -- (-786.727) (-788.981) (-789.652) [-786.913] * (-789.586) [-789.161] (-785.758) (-785.552) -- 0:00:25
583000 -- (-785.397) (-786.379) (-790.857) [-786.868] * (-790.350) (-790.949) (-787.168) [-788.984] -- 0:00:25
583500 -- (-787.034) (-789.219) [-788.055] (-789.142) * [-786.551] (-788.473) (-790.549) (-787.362) -- 0:00:24
584000 -- [-786.358] (-786.101) (-789.364) (-787.878) * (-791.405) (-788.557) [-790.022] (-786.669) -- 0:00:24
584500 -- (-786.337) [-787.436] (-788.246) (-786.792) * [-788.879] (-787.917) (-790.169) (-787.225) -- 0:00:24
585000 -- [-786.096] (-787.351) (-797.062) (-788.899) * [-787.561] (-786.071) (-788.966) (-787.436) -- 0:00:24
Average standard deviation of split frequencies: 0.009546
585500 -- (-786.904) (-789.873) (-786.577) [-789.746] * (-786.916) (-787.603) [-788.860] (-786.887) -- 0:00:24
586000 -- (-786.791) [-786.312] (-789.733) (-787.660) * (-786.445) (-789.119) [-789.447] (-789.141) -- 0:00:24
586500 -- (-786.546) [-787.323] (-787.598) (-785.861) * [-785.970] (-787.577) (-788.877) (-788.426) -- 0:00:24
587000 -- (-786.914) (-788.556) [-786.735] (-786.279) * [-789.459] (-786.709) (-789.050) (-789.473) -- 0:00:24
587500 -- [-787.127] (-788.408) (-786.364) (-788.853) * (-788.905) (-792.641) [-789.878] (-788.350) -- 0:00:24
588000 -- [-787.092] (-789.347) (-788.204) (-785.540) * (-786.879) (-789.471) (-790.040) [-787.264] -- 0:00:24
588500 -- [-787.802] (-789.664) (-786.882) (-788.372) * (-793.580) (-793.070) (-787.066) [-787.329] -- 0:00:24
589000 -- (-786.844) (-787.671) [-786.766] (-787.869) * [-785.688] (-790.437) (-789.980) (-785.985) -- 0:00:24
589500 -- [-786.679] (-789.569) (-788.350) (-787.290) * [-787.934] (-787.161) (-786.573) (-786.109) -- 0:00:24
590000 -- (-788.710) (-787.228) [-785.950] (-785.675) * [-789.910] (-790.860) (-788.929) (-791.773) -- 0:00:24
Average standard deviation of split frequencies: 0.009205
590500 -- (-788.271) (-787.947) (-785.972) [-785.477] * [-788.454] (-787.943) (-787.476) (-786.301) -- 0:00:24
591000 -- (-787.919) (-792.057) (-790.206) [-788.350] * (-787.012) (-787.741) [-790.683] (-787.172) -- 0:00:24
591500 -- (-786.803) (-793.013) [-788.646] (-793.066) * (-787.841) (-787.938) [-788.835] (-787.710) -- 0:00:24
592000 -- (-786.813) (-789.018) [-787.485] (-790.091) * (-787.161) [-788.528] (-786.933) (-789.904) -- 0:00:24
592500 -- [-787.215] (-789.291) (-787.769) (-785.945) * [-787.862] (-791.146) (-785.766) (-790.482) -- 0:00:24
593000 -- (-786.707) [-791.766] (-789.111) (-787.849) * (-792.301) (-790.453) [-790.229] (-790.593) -- 0:00:24
593500 -- (-787.756) (-791.914) [-787.239] (-786.641) * [-785.620] (-791.453) (-789.199) (-792.193) -- 0:00:23
594000 -- (-786.921) (-787.982) (-786.867) [-789.021] * [-794.080] (-790.460) (-788.077) (-793.875) -- 0:00:23
594500 -- (-786.961) [-787.507] (-785.901) (-788.385) * [-790.277] (-786.312) (-787.887) (-790.469) -- 0:00:23
595000 -- (-789.058) (-788.263) (-786.872) [-789.054] * (-788.217) (-786.105) (-788.848) [-788.371] -- 0:00:23
Average standard deviation of split frequencies: 0.008700
595500 -- (-786.775) (-788.568) (-787.219) [-786.786] * [-786.015] (-787.056) (-787.721) (-785.980) -- 0:00:23
596000 -- (-785.964) [-789.908] (-788.895) (-787.767) * [-788.016] (-788.202) (-787.235) (-786.932) -- 0:00:23
596500 -- [-786.611] (-787.482) (-786.397) (-788.808) * [-786.454] (-792.235) (-789.240) (-792.383) -- 0:00:23
597000 -- (-796.165) (-787.909) (-788.571) [-790.488] * [-785.578] (-791.499) (-790.461) (-789.694) -- 0:00:23
597500 -- (-790.085) (-789.297) (-787.575) [-789.571] * (-785.816) (-788.342) (-787.495) [-786.789] -- 0:00:23
598000 -- [-789.383] (-789.780) (-789.071) (-786.053) * (-791.683) [-789.251] (-788.188) (-786.565) -- 0:00:23
598500 -- (-786.770) (-786.658) [-787.700] (-791.143) * (-789.236) (-787.833) [-788.937] (-786.678) -- 0:00:24
599000 -- [-787.049] (-787.963) (-788.596) (-786.335) * (-786.765) (-789.970) [-788.548] (-789.259) -- 0:00:24
599500 -- (-786.502) [-788.022] (-787.516) (-787.011) * [-786.118] (-787.385) (-789.281) (-788.657) -- 0:00:24
600000 -- (-788.032) (-789.592) (-786.994) [-789.043] * [-786.000] (-786.975) (-790.287) (-789.374) -- 0:00:24
Average standard deviation of split frequencies: 0.008842
600500 -- (-791.021) [-787.553] (-788.291) (-789.771) * (-787.156) (-786.120) (-788.877) [-786.590] -- 0:00:23
601000 -- (-795.599) [-786.738] (-789.399) (-789.359) * (-786.245) [-785.767] (-786.547) (-791.601) -- 0:00:23
601500 -- (-786.981) [-790.526] (-791.476) (-791.264) * [-785.615] (-787.376) (-788.601) (-787.994) -- 0:00:23
602000 -- [-786.590] (-786.346) (-790.879) (-788.827) * (-786.964) (-787.576) [-788.118] (-788.513) -- 0:00:23
602500 -- (-787.279) (-788.658) (-786.316) [-790.181] * (-786.537) (-793.378) (-787.391) [-788.539] -- 0:00:23
603000 -- (-787.204) (-785.999) [-786.223] (-787.620) * (-786.492) [-786.969] (-786.888) (-789.575) -- 0:00:23
603500 -- (-789.690) [-786.012] (-786.398) (-788.230) * (-787.123) (-786.752) (-785.819) [-788.870] -- 0:00:23
604000 -- (-788.316) (-786.592) [-785.778] (-794.145) * (-788.577) (-787.676) (-788.117) [-787.521] -- 0:00:23
604500 -- [-787.628] (-788.645) (-787.717) (-789.690) * (-790.709) (-791.045) [-788.442] (-786.687) -- 0:00:23
605000 -- (-789.851) (-788.550) (-787.329) [-788.347] * [-787.249] (-790.499) (-790.473) (-787.020) -- 0:00:23
Average standard deviation of split frequencies: 0.008142
605500 -- (-787.726) (-788.064) [-786.586] (-786.407) * (-792.098) (-796.951) [-790.575] (-789.908) -- 0:00:23
606000 -- (-788.418) [-788.488] (-786.251) (-793.350) * (-788.660) (-786.421) [-790.286] (-787.645) -- 0:00:23
606500 -- [-785.898] (-788.090) (-785.925) (-788.284) * [-789.809] (-790.615) (-787.160) (-786.903) -- 0:00:23
607000 -- (-786.660) [-787.734] (-785.696) (-787.528) * (-788.449) [-787.890] (-788.884) (-788.275) -- 0:00:23
607500 -- [-787.491] (-786.668) (-789.548) (-788.003) * (-786.699) (-787.943) [-787.739] (-789.152) -- 0:00:23
608000 -- (-788.518) (-786.919) (-792.481) [-789.857] * (-786.657) [-786.842] (-788.213) (-787.261) -- 0:00:23
608500 -- (-787.321) [-787.418] (-786.356) (-789.156) * (-786.213) (-786.635) (-792.165) [-788.925] -- 0:00:23
609000 -- (-786.117) (-786.730) (-787.287) [-786.664] * (-788.152) [-786.976] (-790.039) (-786.725) -- 0:00:23
609500 -- (-790.655) [-787.138] (-788.424) (-787.136) * (-788.889) [-786.753] (-787.252) (-788.084) -- 0:00:23
610000 -- (-787.142) (-787.761) (-789.636) [-792.059] * (-787.385) (-789.051) (-786.407) [-787.539] -- 0:00:23
Average standard deviation of split frequencies: 0.008347
610500 -- (-787.235) [-788.094] (-788.314) (-789.106) * (-787.401) [-786.280] (-788.060) (-788.198) -- 0:00:22
611000 -- (-786.802) (-787.547) (-788.183) [-786.133] * (-787.977) (-789.022) (-786.916) [-787.932] -- 0:00:22
611500 -- (-786.101) (-788.186) [-786.926] (-787.149) * (-795.212) (-788.048) [-786.644] (-787.497) -- 0:00:22
612000 -- (-788.345) (-788.369) (-793.419) [-787.760] * (-788.394) (-791.921) [-788.999] (-787.098) -- 0:00:22
612500 -- (-789.316) (-787.132) (-788.574) [-786.825] * (-789.489) (-786.925) [-787.480] (-786.283) -- 0:00:22
613000 -- (-788.316) (-790.016) (-791.875) [-789.439] * (-789.333) [-790.032] (-788.604) (-789.818) -- 0:00:22
613500 -- (-788.639) (-786.634) [-786.385] (-793.929) * [-786.837] (-786.156) (-788.791) (-794.287) -- 0:00:22
614000 -- [-790.519] (-787.248) (-788.803) (-787.293) * (-786.526) [-786.892] (-796.854) (-790.012) -- 0:00:22
614500 -- [-789.776] (-788.634) (-790.621) (-792.900) * (-787.296) (-786.761) [-786.899] (-787.709) -- 0:00:22
615000 -- (-786.337) [-787.738] (-786.542) (-790.857) * (-787.682) (-788.485) (-787.132) [-788.592] -- 0:00:22
Average standard deviation of split frequencies: 0.008466
615500 -- [-787.037] (-789.475) (-788.470) (-791.997) * (-787.988) (-788.357) [-787.482] (-787.786) -- 0:00:23
616000 -- (-785.769) (-790.821) (-786.696) [-788.583] * (-795.939) (-787.765) (-791.663) [-787.677] -- 0:00:23
616500 -- (-786.829) [-786.511] (-788.581) (-788.343) * (-793.862) (-793.538) (-788.399) [-788.239] -- 0:00:23
617000 -- (-787.052) (-789.687) (-789.081) [-788.273] * (-788.023) [-786.324] (-788.772) (-786.977) -- 0:00:22
617500 -- (-787.513) (-790.551) [-785.880] (-787.143) * (-786.287) (-786.880) (-787.713) [-786.829] -- 0:00:22
618000 -- (-785.675) (-788.501) [-786.344] (-789.979) * (-788.520) (-785.697) [-788.436] (-788.201) -- 0:00:22
618500 -- (-786.947) (-789.975) [-786.053] (-794.219) * (-790.436) [-788.294] (-788.436) (-786.017) -- 0:00:22
619000 -- (-788.180) (-788.568) [-786.521] (-790.685) * [-786.636] (-786.386) (-786.388) (-786.668) -- 0:00:22
619500 -- (-790.614) [-791.466] (-786.006) (-788.933) * (-786.795) (-787.992) (-787.597) [-786.788] -- 0:00:22
620000 -- (-786.855) (-786.279) [-789.125] (-788.923) * [-790.156] (-788.292) (-787.446) (-788.886) -- 0:00:22
Average standard deviation of split frequencies: 0.008101
620500 -- (-788.444) (-788.851) [-786.419] (-788.044) * (-789.100) (-786.244) [-786.810] (-787.150) -- 0:00:22
621000 -- (-790.406) (-787.555) [-789.746] (-787.106) * (-786.752) (-786.916) (-788.464) [-787.187] -- 0:00:22
621500 -- (-786.282) (-787.596) [-789.283] (-786.534) * [-788.704] (-787.964) (-787.012) (-787.095) -- 0:00:22
622000 -- [-785.411] (-786.743) (-792.957) (-786.939) * (-789.295) [-786.529] (-786.585) (-789.861) -- 0:00:22
622500 -- (-787.218) [-786.038] (-786.423) (-789.539) * (-786.435) (-797.313) [-788.890] (-788.644) -- 0:00:22
623000 -- [-785.603] (-789.842) (-791.405) (-787.494) * (-786.031) [-786.233] (-786.620) (-789.384) -- 0:00:22
623500 -- (-788.158) [-788.868] (-789.440) (-787.881) * (-788.524) [-790.015] (-788.032) (-790.541) -- 0:00:22
624000 -- (-789.311) (-788.436) [-789.129] (-788.035) * (-788.398) [-787.812] (-789.833) (-787.347) -- 0:00:22
624500 -- (-788.172) [-786.107] (-787.431) (-789.368) * [-786.929] (-790.122) (-789.393) (-788.015) -- 0:00:22
625000 -- [-790.694] (-785.836) (-787.135) (-786.853) * (-789.047) [-787.131] (-791.737) (-786.535) -- 0:00:22
Average standard deviation of split frequencies: 0.007932
625500 -- (-787.205) [-786.951] (-787.471) (-785.702) * [-788.277] (-787.163) (-789.050) (-788.157) -- 0:00:22
626000 -- (-789.023) (-785.685) (-788.087) [-786.390] * (-793.932) (-789.582) [-788.010] (-786.323) -- 0:00:22
626500 -- (-788.266) [-786.741] (-796.682) (-786.352) * [-788.869] (-791.069) (-788.134) (-786.919) -- 0:00:22
627000 -- (-789.490) [-785.914] (-789.825) (-787.286) * [-787.520] (-789.721) (-788.401) (-788.485) -- 0:00:22
627500 -- (-789.092) (-787.937) (-787.679) [-789.379] * (-790.834) (-789.401) (-788.211) [-786.773] -- 0:00:21
628000 -- (-786.748) (-791.759) [-788.570] (-787.200) * (-785.945) (-790.015) (-787.930) [-788.290] -- 0:00:21
628500 -- (-787.213) (-788.303) [-787.296] (-786.806) * (-789.010) (-790.223) [-786.338] (-786.619) -- 0:00:21
629000 -- [-789.169] (-789.804) (-789.769) (-787.239) * (-787.753) (-789.647) [-785.587] (-786.381) -- 0:00:21
629500 -- (-787.056) (-791.940) (-789.629) [-786.141] * [-789.534] (-789.494) (-788.756) (-791.363) -- 0:00:21
630000 -- (-788.034) [-786.103] (-787.148) (-788.487) * (-786.963) (-787.116) [-787.408] (-789.819) -- 0:00:21
Average standard deviation of split frequencies: 0.007375
630500 -- (-788.213) (-789.162) (-791.353) [-787.684] * (-792.999) (-788.085) [-787.789] (-786.685) -- 0:00:21
631000 -- [-792.110] (-786.431) (-787.756) (-786.800) * (-787.762) [-786.785] (-792.050) (-785.984) -- 0:00:21
631500 -- (-789.996) (-787.530) (-786.059) [-786.860] * (-786.644) (-785.999) [-790.830] (-787.082) -- 0:00:21
632000 -- (-787.909) (-787.158) (-787.243) [-787.155] * (-786.252) [-787.726] (-787.993) (-787.074) -- 0:00:22
632500 -- [-786.712] (-788.924) (-790.077) (-788.783) * (-788.473) (-785.927) [-787.014] (-788.883) -- 0:00:22
633000 -- (-787.708) (-787.353) [-786.991] (-789.284) * (-788.288) [-788.619] (-788.881) (-786.840) -- 0:00:22
633500 -- (-787.445) [-788.368] (-786.680) (-787.871) * [-788.716] (-787.649) (-787.010) (-789.350) -- 0:00:21
634000 -- (-786.165) (-787.871) (-785.883) [-790.195] * (-788.102) (-788.381) (-787.169) [-789.506] -- 0:00:21
634500 -- (-788.839) (-787.615) [-787.953] (-786.454) * (-786.445) [-786.578] (-788.144) (-787.030) -- 0:00:21
635000 -- (-787.972) (-788.265) [-789.887] (-788.229) * [-785.778] (-788.251) (-790.225) (-786.072) -- 0:00:21
Average standard deviation of split frequencies: 0.007659
635500 -- (-787.889) (-787.915) (-787.430) [-788.168] * (-789.218) (-789.280) (-790.213) [-786.440] -- 0:00:21
636000 -- (-787.384) [-786.909] (-785.662) (-786.992) * [-786.975] (-786.341) (-788.338) (-789.590) -- 0:00:21
636500 -- (-789.504) [-786.092] (-785.893) (-787.663) * (-790.358) (-790.445) (-787.123) [-787.350] -- 0:00:21
637000 -- (-788.279) [-789.747] (-786.144) (-787.501) * (-797.166) [-786.160] (-789.983) (-789.562) -- 0:00:21
637500 -- (-787.680) (-788.485) [-786.191] (-786.938) * (-790.563) [-787.527] (-793.463) (-788.738) -- 0:00:21
638000 -- [-788.728] (-791.518) (-785.471) (-787.463) * [-787.145] (-791.765) (-788.932) (-789.414) -- 0:00:21
638500 -- [-787.934] (-786.131) (-785.924) (-793.898) * (-789.650) (-787.488) [-788.937] (-792.375) -- 0:00:21
639000 -- (-785.802) (-786.131) (-787.643) [-786.097] * (-787.222) (-788.341) (-786.629) [-790.605] -- 0:00:21
639500 -- (-790.272) (-787.379) [-786.510] (-787.260) * [-786.202] (-788.265) (-786.543) (-788.500) -- 0:00:21
640000 -- (-787.826) [-787.110] (-792.929) (-788.741) * (-789.713) (-791.822) (-787.999) [-791.088] -- 0:00:21
Average standard deviation of split frequencies: 0.007260
640500 -- [-789.025] (-786.796) (-786.902) (-788.053) * (-789.834) (-788.457) [-794.042] (-794.837) -- 0:00:21
641000 -- (-786.993) [-787.142] (-790.812) (-790.890) * (-789.129) (-787.444) [-793.749] (-792.386) -- 0:00:21
641500 -- (-788.660) (-789.131) (-789.788) [-786.204] * [-785.936] (-786.682) (-788.818) (-792.078) -- 0:00:21
642000 -- (-786.371) [-787.171] (-786.937) (-788.277) * (-787.741) [-788.882] (-787.812) (-789.768) -- 0:00:21
642500 -- (-786.226) (-786.573) (-787.710) [-787.102] * (-792.720) (-787.191) [-787.498] (-790.481) -- 0:00:21
643000 -- (-786.024) (-787.113) (-787.346) [-788.350] * (-791.344) (-792.163) (-789.320) [-789.691] -- 0:00:21
643500 -- (-786.189) (-789.702) (-787.689) [-786.410] * (-788.608) [-786.365] (-789.327) (-788.350) -- 0:00:21
644000 -- (-788.716) (-791.551) [-787.319] (-788.112) * [-788.698] (-787.733) (-788.429) (-788.182) -- 0:00:21
644500 -- [-786.016] (-791.630) (-788.036) (-792.318) * (-787.456) (-788.483) (-791.274) [-789.675] -- 0:00:20
645000 -- (-786.906) (-789.604) (-787.572) [-788.949] * (-788.994) [-788.676] (-788.753) (-788.679) -- 0:00:20
Average standard deviation of split frequencies: 0.006957
645500 -- [-785.904] (-788.583) (-786.700) (-789.324) * (-788.058) (-791.202) (-788.048) [-786.941] -- 0:00:20
646000 -- (-787.693) (-790.189) (-790.724) [-790.007] * (-794.059) (-791.355) [-788.682] (-786.832) -- 0:00:20
646500 -- [-786.663] (-786.091) (-790.431) (-788.302) * (-791.578) [-788.536] (-787.588) (-788.316) -- 0:00:20
647000 -- (-787.149) (-786.894) [-789.601] (-788.241) * (-787.570) (-787.557) [-788.622] (-786.721) -- 0:00:20
647500 -- (-789.439) (-785.900) (-788.722) [-787.825] * (-786.610) [-787.238] (-786.475) (-786.514) -- 0:00:20
648000 -- (-787.279) [-787.452] (-789.805) (-792.675) * (-786.147) (-787.096) [-788.584] (-789.463) -- 0:00:20
648500 -- (-787.992) [-786.019] (-787.137) (-789.040) * [-785.681] (-789.699) (-791.059) (-788.127) -- 0:00:21
649000 -- (-790.542) [-787.945] (-786.981) (-789.058) * (-788.497) [-787.048] (-790.195) (-789.218) -- 0:00:21
649500 -- (-787.936) (-785.903) [-787.118] (-790.365) * (-789.729) [-786.871] (-788.337) (-786.864) -- 0:00:21
650000 -- (-787.414) [-786.026] (-785.466) (-790.396) * [-786.608] (-788.904) (-786.809) (-786.656) -- 0:00:21
Average standard deviation of split frequencies: 0.007342
650500 -- [-791.367] (-790.917) (-787.272) (-786.044) * (-787.897) (-788.963) [-786.395] (-787.207) -- 0:00:20
651000 -- (-786.402) (-788.730) [-788.433] (-789.266) * (-786.599) [-786.869] (-786.936) (-788.334) -- 0:00:20
651500 -- [-787.968] (-786.847) (-785.675) (-789.806) * [-788.260] (-786.529) (-788.762) (-788.273) -- 0:00:20
652000 -- (-788.423) (-787.722) (-786.135) [-787.930] * (-786.146) (-787.407) (-787.848) [-789.466] -- 0:00:20
652500 -- (-788.339) [-786.502] (-788.222) (-787.759) * [-787.130] (-792.599) (-789.663) (-788.910) -- 0:00:20
653000 -- (-786.072) (-788.322) [-787.393] (-788.182) * (-787.613) (-789.049) (-787.439) [-789.985] -- 0:00:20
653500 -- [-787.740] (-786.063) (-790.041) (-788.600) * [-787.295] (-789.167) (-787.454) (-789.453) -- 0:00:20
654000 -- (-788.688) (-787.002) [-787.728] (-788.017) * (-787.772) (-787.779) [-786.830] (-790.128) -- 0:00:20
654500 -- (-787.462) [-786.421] (-788.460) (-790.823) * (-789.033) [-788.327] (-789.046) (-786.939) -- 0:00:20
655000 -- (-788.841) (-786.703) (-791.257) [-788.745] * (-786.858) (-790.939) [-786.492] (-789.193) -- 0:00:20
Average standard deviation of split frequencies: 0.006467
655500 -- (-786.703) [-788.390] (-787.821) (-786.560) * (-787.133) (-788.617) (-787.051) [-794.891] -- 0:00:20
656000 -- (-789.166) (-786.365) [-786.050] (-787.583) * (-786.332) [-790.776] (-786.439) (-794.749) -- 0:00:20
656500 -- [-787.546] (-789.071) (-786.851) (-789.746) * (-790.652) (-793.916) (-791.479) [-788.914] -- 0:00:20
657000 -- [-787.579] (-788.303) (-789.137) (-789.686) * (-789.722) (-789.916) (-786.879) [-786.925] -- 0:00:20
657500 -- (-790.203) (-787.572) [-790.272] (-787.341) * (-786.274) (-789.598) (-791.994) [-787.117] -- 0:00:20
658000 -- (-789.450) [-791.666] (-788.182) (-788.017) * [-786.755] (-787.491) (-792.257) (-790.693) -- 0:00:20
658500 -- [-787.363] (-788.342) (-786.363) (-787.814) * [-786.679] (-786.378) (-789.286) (-787.317) -- 0:00:20
659000 -- (-786.899) (-791.897) [-785.904] (-787.508) * (-792.662) [-786.355] (-787.392) (-788.167) -- 0:00:20
659500 -- [-789.379] (-789.972) (-786.265) (-785.925) * (-788.705) [-788.503] (-785.592) (-788.915) -- 0:00:20
660000 -- [-786.034] (-789.822) (-789.219) (-786.886) * (-790.844) [-787.545] (-787.700) (-788.504) -- 0:00:20
Average standard deviation of split frequencies: 0.006231
660500 -- (-786.323) (-790.722) [-786.158] (-787.409) * (-787.609) (-786.994) [-788.670] (-786.411) -- 0:00:20
661000 -- (-787.291) (-787.248) (-785.846) [-787.347] * [-790.049] (-787.498) (-786.705) (-787.051) -- 0:00:20
661500 -- (-791.504) (-788.465) [-786.773] (-787.718) * (-788.479) (-787.562) [-789.049] (-788.789) -- 0:00:19
662000 -- (-788.328) (-785.557) (-788.432) [-789.390] * (-790.739) (-786.639) (-789.156) [-785.861] -- 0:00:19
662500 -- [-789.701] (-785.489) (-789.272) (-789.735) * (-786.440) (-786.283) [-786.503] (-785.752) -- 0:00:19
663000 -- (-787.120) (-790.441) (-788.841) [-790.929] * (-786.204) (-790.095) [-788.379] (-785.624) -- 0:00:19
663500 -- (-787.267) [-787.398] (-786.428) (-786.332) * [-785.595] (-789.419) (-786.993) (-789.957) -- 0:00:19
664000 -- (-788.145) (-786.309) (-788.075) [-789.516] * (-786.057) (-786.990) (-785.923) [-788.198] -- 0:00:19
664500 -- [-788.271] (-786.485) (-789.199) (-790.845) * (-785.515) (-786.262) [-786.067] (-789.913) -- 0:00:19
665000 -- [-786.734] (-785.898) (-789.602) (-786.040) * (-786.030) (-789.835) (-786.619) [-790.915] -- 0:00:20
Average standard deviation of split frequencies: 0.005757
665500 -- (-787.425) (-787.017) (-787.384) [-789.715] * (-787.275) (-786.092) (-788.056) [-789.260] -- 0:00:20
666000 -- [-786.917] (-787.534) (-790.456) (-790.204) * (-788.580) (-787.243) [-791.178] (-791.100) -- 0:00:20
666500 -- (-789.380) (-787.350) [-786.830] (-788.771) * (-788.027) (-790.541) [-788.157] (-790.379) -- 0:00:20
667000 -- (-786.664) (-790.396) [-787.111] (-788.674) * (-788.754) [-788.929] (-789.577) (-786.989) -- 0:00:19
667500 -- (-787.852) (-789.833) [-785.989] (-785.819) * [-786.553] (-787.694) (-796.089) (-790.404) -- 0:00:19
668000 -- (-790.838) [-786.714] (-788.326) (-786.267) * (-790.535) (-789.951) [-788.112] (-788.106) -- 0:00:19
668500 -- (-790.176) [-786.661] (-787.776) (-787.710) * (-789.094) (-787.174) [-788.695] (-791.307) -- 0:00:19
669000 -- (-789.365) (-789.877) (-787.211) [-787.564] * (-792.236) (-789.817) [-788.829] (-787.524) -- 0:00:19
669500 -- (-794.987) (-788.418) (-789.191) [-786.114] * (-787.279) [-786.791] (-786.771) (-793.570) -- 0:00:19
670000 -- (-792.144) [-787.431] (-788.175) (-787.123) * (-786.458) (-788.097) [-786.247] (-788.826) -- 0:00:19
Average standard deviation of split frequencies: 0.005623
670500 -- [-787.563] (-787.851) (-787.630) (-787.147) * [-786.787] (-789.560) (-788.493) (-786.821) -- 0:00:19
671000 -- (-786.798) (-785.808) [-790.148] (-786.353) * [-789.827] (-787.304) (-786.554) (-789.517) -- 0:00:19
671500 -- (-788.130) (-789.104) [-788.684] (-786.254) * (-788.363) (-789.505) [-786.127] (-787.743) -- 0:00:19
672000 -- (-786.012) (-785.822) (-785.645) [-786.774] * (-788.546) (-787.448) [-788.216] (-786.526) -- 0:00:19
672500 -- (-785.808) (-788.954) [-785.673] (-789.833) * [-787.643] (-786.973) (-786.776) (-788.321) -- 0:00:19
673000 -- (-785.552) [-789.687] (-787.828) (-790.307) * (-786.491) (-786.603) [-787.291] (-789.041) -- 0:00:19
673500 -- (-786.795) [-789.185] (-788.053) (-787.114) * (-787.561) (-787.402) (-786.533) [-787.907] -- 0:00:19
674000 -- (-786.455) (-788.052) (-788.971) [-787.891] * (-786.627) (-787.578) [-787.397] (-787.017) -- 0:00:19
674500 -- (-787.154) [-789.345] (-790.974) (-791.504) * (-787.154) (-789.719) [-786.357] (-790.832) -- 0:00:19
675000 -- (-790.306) (-795.488) [-792.026] (-786.648) * (-787.433) (-785.862) (-788.399) [-788.643] -- 0:00:19
Average standard deviation of split frequencies: 0.005718
675500 -- [-786.732] (-795.003) (-793.766) (-792.225) * (-787.702) [-787.081] (-788.749) (-787.630) -- 0:00:19
676000 -- (-787.015) (-793.322) (-795.274) [-787.960] * (-786.787) [-787.125] (-788.882) (-787.307) -- 0:00:19
676500 -- (-788.307) (-789.508) [-787.358] (-787.626) * (-788.388) (-787.336) (-790.264) [-788.461] -- 0:00:19
677000 -- (-792.284) (-785.765) (-791.185) [-787.545] * (-790.411) (-787.294) [-786.873] (-791.099) -- 0:00:19
677500 -- (-791.856) (-785.764) (-788.432) [-787.641] * (-789.207) (-793.109) [-787.880] (-786.204) -- 0:00:19
678000 -- [-790.313] (-787.006) (-789.307) (-791.111) * (-786.969) (-790.844) (-785.674) [-788.551] -- 0:00:18
678500 -- [-791.978] (-786.862) (-786.867) (-787.396) * (-786.428) (-791.697) [-786.099] (-787.217) -- 0:00:18
679000 -- (-788.936) [-788.315] (-786.747) (-785.864) * (-792.349) (-791.774) (-786.797) [-786.260] -- 0:00:18
679500 -- (-787.516) [-789.014] (-788.280) (-789.034) * (-795.458) [-788.155] (-786.046) (-788.062) -- 0:00:18
680000 -- [-786.792] (-786.441) (-787.191) (-785.939) * (-787.055) (-790.452) (-791.292) [-788.079] -- 0:00:18
Average standard deviation of split frequencies: 0.005310
680500 -- (-787.362) (-787.076) [-788.611] (-788.930) * (-790.347) [-789.050] (-789.638) (-786.336) -- 0:00:18
681000 -- [-787.641] (-786.907) (-788.237) (-787.834) * [-789.213] (-787.363) (-787.880) (-788.291) -- 0:00:18
681500 -- (-787.804) (-791.843) [-787.413] (-786.432) * (-788.403) (-786.736) [-785.612] (-792.205) -- 0:00:19
682000 -- (-788.407) (-788.425) [-786.784] (-787.333) * (-786.505) (-788.880) [-785.980] (-789.740) -- 0:00:19
682500 -- (-788.443) (-787.281) [-787.395] (-790.346) * (-792.982) (-786.112) [-785.828] (-789.375) -- 0:00:19
683000 -- (-786.703) (-787.312) (-787.998) [-789.986] * (-785.901) (-789.391) (-790.999) [-785.899] -- 0:00:19
683500 -- (-787.650) (-786.825) (-788.609) [-786.703] * (-786.267) (-787.702) (-785.815) [-785.758] -- 0:00:18
684000 -- (-789.914) [-785.692] (-786.693) (-786.703) * (-787.203) (-786.768) (-787.025) [-791.846] -- 0:00:18
684500 -- (-789.011) (-791.308) (-789.148) [-786.580] * (-791.310) (-787.043) [-786.121] (-791.465) -- 0:00:18
685000 -- [-786.769] (-788.648) (-786.806) (-787.581) * (-787.607) (-790.502) (-788.806) [-785.902] -- 0:00:18
Average standard deviation of split frequencies: 0.005452
685500 -- (-788.177) (-788.167) [-786.760] (-787.506) * (-787.030) (-793.891) (-790.167) [-786.406] -- 0:00:18
686000 -- (-787.826) (-787.647) (-786.619) [-792.296] * (-788.343) (-788.943) (-787.925) [-787.454] -- 0:00:18
686500 -- (-790.005) [-786.535] (-787.408) (-793.288) * (-789.490) (-790.489) (-793.022) [-786.997] -- 0:00:18
687000 -- (-786.252) (-788.638) [-789.018] (-787.068) * (-789.242) (-787.974) [-791.581] (-789.759) -- 0:00:18
687500 -- (-786.552) (-791.956) (-787.765) [-787.976] * (-789.539) (-785.724) [-788.959] (-791.084) -- 0:00:18
688000 -- [-786.674] (-791.739) (-787.177) (-791.383) * (-788.536) (-795.656) (-786.880) [-786.960] -- 0:00:18
688500 -- (-787.787) (-789.129) [-788.687] (-786.485) * (-789.908) (-788.093) [-787.680] (-787.313) -- 0:00:18
689000 -- (-788.478) [-787.978] (-791.127) (-791.644) * (-787.028) (-786.420) [-788.996] (-786.141) -- 0:00:18
689500 -- (-786.591) [-787.324] (-795.994) (-787.742) * [-786.909] (-790.230) (-789.154) (-787.515) -- 0:00:18
690000 -- [-788.065] (-789.500) (-789.044) (-788.123) * (-786.934) (-787.394) (-788.788) [-791.056] -- 0:00:18
Average standard deviation of split frequencies: 0.005460
690500 -- (-787.424) (-788.051) (-788.032) [-786.392] * (-789.823) (-790.484) [-787.084] (-787.128) -- 0:00:18
691000 -- (-788.108) (-786.894) (-792.441) [-791.429] * (-790.754) (-794.470) [-787.851] (-787.178) -- 0:00:18
691500 -- [-787.281] (-786.587) (-789.152) (-789.466) * (-792.458) (-788.401) [-789.572] (-790.027) -- 0:00:18
692000 -- (-787.483) (-785.912) (-788.445) [-786.773] * [-786.841] (-788.998) (-787.908) (-787.802) -- 0:00:18
692500 -- (-790.322) (-787.026) (-792.269) [-786.621] * (-788.743) (-790.810) (-787.245) [-786.509] -- 0:00:18
693000 -- (-786.792) [-787.362] (-791.253) (-789.328) * (-788.367) (-789.934) (-786.450) [-787.896] -- 0:00:18
693500 -- [-787.196] (-786.159) (-786.760) (-787.887) * [-787.605] (-790.732) (-786.866) (-786.226) -- 0:00:18
694000 -- (-786.913) [-787.161] (-786.783) (-789.253) * (-788.485) (-788.762) (-786.796) [-785.997] -- 0:00:18
694500 -- (-786.508) [-785.538] (-786.330) (-788.451) * (-785.702) (-790.518) [-786.767] (-785.990) -- 0:00:18
695000 -- (-787.011) (-787.767) (-787.017) [-788.163] * (-789.073) [-792.219] (-786.567) (-785.671) -- 0:00:17
Average standard deviation of split frequencies: 0.005554
695500 -- (-789.319) [-786.981] (-786.447) (-786.899) * (-791.246) [-787.775] (-788.499) (-786.716) -- 0:00:17
696000 -- (-786.815) (-789.779) (-788.887) [-787.917] * (-788.796) (-787.708) (-788.300) [-787.356] -- 0:00:17
696500 -- (-788.029) [-790.153] (-788.531) (-787.003) * (-788.078) (-786.537) [-787.069] (-786.643) -- 0:00:17
697000 -- (-785.505) (-788.551) (-786.049) [-788.683] * [-786.875] (-787.515) (-786.555) (-789.518) -- 0:00:17
697500 -- [-785.519] (-786.209) (-785.967) (-789.290) * [-786.828] (-788.755) (-789.957) (-786.358) -- 0:00:17
698000 -- (-787.797) [-785.867] (-786.093) (-789.580) * [-785.749] (-788.544) (-787.918) (-787.396) -- 0:00:18
698500 -- (-789.156) (-787.304) [-786.382] (-787.644) * (-785.888) (-788.763) [-788.129] (-790.442) -- 0:00:18
699000 -- (-787.490) [-786.413] (-787.780) (-787.380) * [-788.561] (-789.480) (-787.392) (-787.860) -- 0:00:18
699500 -- [-787.479] (-788.269) (-788.839) (-789.391) * [-786.679] (-787.177) (-787.218) (-786.192) -- 0:00:18
700000 -- (-789.703) [-785.607] (-789.748) (-790.624) * [-785.754] (-787.450) (-788.389) (-788.169) -- 0:00:18
Average standard deviation of split frequencies: 0.005551
700500 -- [-787.563] (-787.047) (-787.859) (-790.230) * (-788.237) [-786.656] (-785.989) (-790.410) -- 0:00:17
701000 -- (-787.335) [-785.999] (-789.686) (-789.185) * (-786.614) [-787.309] (-791.113) (-788.384) -- 0:00:17
701500 -- (-789.568) (-785.989) (-789.556) [-787.550] * (-786.832) (-786.446) (-790.518) [-786.473] -- 0:00:17
702000 -- (-791.750) (-786.073) [-790.706] (-788.817) * [-787.869] (-786.323) (-789.164) (-787.632) -- 0:00:17
702500 -- (-785.441) [-786.424] (-790.561) (-789.363) * (-786.571) [-786.882] (-786.407) (-786.141) -- 0:00:17
703000 -- (-786.169) (-793.653) (-790.491) [-787.456] * [-787.687] (-786.614) (-786.999) (-789.505) -- 0:00:17
703500 -- (-788.235) (-786.944) (-787.781) [-787.282] * (-788.691) (-790.675) [-786.752] (-787.412) -- 0:00:17
704000 -- (-793.548) [-785.890] (-792.150) (-786.063) * (-786.330) (-789.199) (-787.342) [-785.974] -- 0:00:17
704500 -- (-787.224) [-785.691] (-788.536) (-786.931) * (-787.961) (-788.923) [-788.537] (-787.985) -- 0:00:17
705000 -- [-788.599] (-786.524) (-786.592) (-785.492) * [-789.263] (-788.942) (-790.312) (-787.028) -- 0:00:17
Average standard deviation of split frequencies: 0.005634
705500 -- [-789.626] (-792.067) (-790.246) (-786.968) * [-789.166] (-789.341) (-786.053) (-787.519) -- 0:00:17
706000 -- (-785.894) (-788.572) (-787.946) [-788.069] * [-786.656] (-787.993) (-788.547) (-788.892) -- 0:00:17
706500 -- [-787.553] (-785.802) (-786.377) (-787.931) * (-786.394) (-786.753) (-786.236) [-786.898] -- 0:00:17
707000 -- [-787.299] (-787.357) (-790.927) (-786.792) * (-789.600) [-786.958] (-785.820) (-789.274) -- 0:00:17
707500 -- (-788.770) (-787.638) [-789.550] (-788.501) * [-786.940] (-786.337) (-785.984) (-789.117) -- 0:00:17
708000 -- (-789.761) [-786.101] (-786.457) (-788.208) * (-788.433) (-787.258) [-791.603] (-789.375) -- 0:00:17
708500 -- (-787.453) (-788.713) (-787.363) [-785.809] * (-786.268) [-789.112] (-789.177) (-787.902) -- 0:00:17
709000 -- (-795.520) (-788.210) (-785.985) [-786.052] * (-788.029) (-789.512) (-786.846) [-790.070] -- 0:00:17
709500 -- (-789.689) (-786.486) (-787.415) [-789.609] * [-788.830] (-789.141) (-787.144) (-790.095) -- 0:00:17
710000 -- (-789.570) (-786.884) (-787.516) [-790.145] * (-789.019) [-787.823] (-788.786) (-792.773) -- 0:00:17
Average standard deviation of split frequencies: 0.005804
710500 -- (-787.801) (-788.694) [-787.340] (-787.880) * [-786.140] (-786.886) (-786.624) (-786.133) -- 0:00:17
711000 -- (-789.512) (-789.976) [-789.150] (-789.784) * [-786.233] (-787.819) (-785.740) (-787.047) -- 0:00:17
711500 -- (-788.060) (-788.584) (-787.993) [-786.078] * (-791.624) (-787.979) [-785.965] (-786.213) -- 0:00:17
712000 -- [-789.003] (-791.620) (-788.806) (-786.017) * [-788.667] (-786.917) (-787.313) (-791.235) -- 0:00:16
712500 -- (-787.084) (-790.461) (-787.369) [-787.307] * [-787.352] (-786.631) (-785.923) (-786.600) -- 0:00:16
713000 -- (-786.479) (-787.879) [-787.689] (-787.723) * [-786.844] (-790.437) (-789.055) (-786.946) -- 0:00:16
713500 -- [-789.157] (-788.064) (-790.365) (-788.952) * [-788.903] (-787.361) (-787.250) (-788.942) -- 0:00:16
714000 -- (-786.535) (-787.634) (-787.916) [-789.184] * (-789.535) (-785.849) [-786.092] (-789.001) -- 0:00:16
714500 -- (-787.695) (-788.731) (-787.934) [-789.570] * (-787.035) [-787.838] (-787.273) (-788.627) -- 0:00:17
715000 -- (-787.322) (-791.729) (-785.877) [-786.841] * (-786.119) [-786.257] (-789.115) (-791.966) -- 0:00:17
Average standard deviation of split frequencies: 0.006337
715500 -- [-786.405] (-790.946) (-786.668) (-786.083) * (-785.960) (-788.193) (-786.323) [-792.674] -- 0:00:17
716000 -- [-789.011] (-786.462) (-787.756) (-787.081) * (-786.750) [-787.547] (-788.414) (-791.296) -- 0:00:17
716500 -- [-787.502] (-785.400) (-787.464) (-789.076) * (-787.416) (-786.484) [-787.937] (-787.930) -- 0:00:17
717000 -- (-787.698) (-790.733) (-788.569) [-787.533] * (-786.520) (-791.487) [-788.521] (-787.848) -- 0:00:16
717500 -- (-788.507) (-791.003) (-791.946) [-787.270] * (-789.077) (-786.319) [-787.609] (-788.953) -- 0:00:16
718000 -- [-786.983] (-791.022) (-789.680) (-786.936) * [-789.197] (-788.984) (-789.851) (-788.349) -- 0:00:16
718500 -- (-786.395) (-789.134) (-791.162) [-786.941] * [-790.646] (-787.912) (-790.386) (-787.786) -- 0:00:16
719000 -- (-785.503) (-789.376) (-788.883) [-788.255] * (-787.680) (-786.755) (-788.798) [-786.844] -- 0:00:16
719500 -- (-786.334) (-786.655) [-786.063] (-788.017) * (-786.798) [-789.817] (-786.144) (-788.218) -- 0:00:16
720000 -- (-789.574) [-786.229] (-789.824) (-789.306) * (-786.135) (-789.624) (-785.810) [-787.089] -- 0:00:16
Average standard deviation of split frequencies: 0.006419
720500 -- (-793.112) (-788.711) [-787.911] (-788.590) * (-786.245) (-787.443) (-787.762) [-787.284] -- 0:00:16
721000 -- (-790.959) [-787.090] (-789.896) (-792.741) * (-787.424) (-787.483) [-789.411] (-786.791) -- 0:00:16
721500 -- (-788.331) (-787.197) [-795.802] (-788.740) * (-786.600) [-791.399] (-789.147) (-786.179) -- 0:00:16
722000 -- [-789.705] (-787.251) (-787.722) (-790.056) * (-786.706) (-790.781) (-788.807) [-786.375] -- 0:00:16
722500 -- (-789.712) [-789.148] (-787.960) (-788.351) * (-787.649) (-786.905) [-788.268] (-788.802) -- 0:00:16
723000 -- (-793.063) (-787.010) [-788.565] (-787.745) * (-790.594) [-791.076] (-786.816) (-790.159) -- 0:00:16
723500 -- [-788.752] (-786.283) (-789.898) (-787.888) * [-791.667] (-785.913) (-790.070) (-790.453) -- 0:00:16
724000 -- [-788.265] (-788.191) (-787.316) (-787.990) * (-789.129) [-786.342] (-788.622) (-786.480) -- 0:00:16
724500 -- (-787.410) (-786.826) (-791.145) [-788.471] * [-789.045] (-792.124) (-788.169) (-786.668) -- 0:00:16
725000 -- (-789.317) (-786.802) [-794.551] (-786.991) * (-788.790) (-789.978) (-787.431) [-787.491] -- 0:00:16
Average standard deviation of split frequencies: 0.006574
725500 -- (-788.403) (-791.750) [-785.912] (-788.616) * (-788.642) (-790.551) (-787.938) [-788.924] -- 0:00:16
726000 -- [-785.753] (-790.140) (-786.352) (-788.611) * (-788.659) (-790.186) [-786.683] (-788.780) -- 0:00:16
726500 -- (-785.762) [-789.890] (-786.735) (-790.198) * [-789.906] (-795.560) (-786.763) (-787.745) -- 0:00:16
727000 -- (-785.731) (-789.451) (-788.340) [-788.310] * (-788.168) (-789.158) [-786.704] (-791.651) -- 0:00:16
727500 -- (-786.083) (-788.943) [-787.965] (-787.191) * (-787.504) (-787.345) [-789.119] (-787.212) -- 0:00:16
728000 -- [-786.006] (-789.795) (-790.512) (-787.805) * (-794.023) (-787.638) [-786.126] (-787.094) -- 0:00:16
728500 -- (-788.375) (-788.937) (-789.608) [-789.085] * (-787.138) (-788.878) (-788.764) [-788.935] -- 0:00:16
729000 -- (-790.420) (-792.854) (-789.466) [-793.665] * (-786.271) (-787.896) (-787.365) [-786.608] -- 0:00:15
729500 -- (-790.175) (-787.689) [-789.548] (-794.462) * (-789.077) (-791.215) (-787.179) [-786.947] -- 0:00:15
730000 -- (-785.934) (-787.599) (-789.605) [-788.710] * [-787.764] (-788.716) (-790.485) (-787.673) -- 0:00:15
Average standard deviation of split frequencies: 0.006371
730500 -- (-785.464) (-786.593) [-789.323] (-787.987) * (-788.654) (-787.689) [-786.104] (-791.461) -- 0:00:15
731000 -- (-785.816) (-790.491) (-787.298) [-786.264] * [-790.778] (-787.998) (-787.522) (-788.991) -- 0:00:16
731500 -- [-786.270] (-789.599) (-787.304) (-789.389) * (-786.778) (-786.885) [-787.025] (-796.930) -- 0:00:16
732000 -- (-789.295) [-785.473] (-785.631) (-786.248) * (-786.408) (-788.597) [-787.726] (-786.113) -- 0:00:16
732500 -- (-785.971) [-788.570] (-790.001) (-789.810) * (-790.491) [-788.179] (-786.178) (-785.706) -- 0:00:16
733000 -- (-791.304) (-787.461) (-787.135) [-790.533] * [-785.837] (-788.130) (-789.128) (-786.393) -- 0:00:16
733500 -- (-787.784) (-787.838) [-785.929] (-786.335) * (-786.562) (-790.196) (-785.488) [-787.899] -- 0:00:15
734000 -- (-786.333) [-790.288] (-789.639) (-785.790) * (-787.541) (-789.867) [-786.865] (-786.566) -- 0:00:15
734500 -- (-787.032) (-787.784) (-785.652) [-786.364] * [-786.627] (-789.046) (-787.710) (-786.775) -- 0:00:15
735000 -- (-793.692) (-787.236) [-786.205] (-786.248) * (-786.814) (-786.916) (-786.149) [-788.564] -- 0:00:15
Average standard deviation of split frequencies: 0.006365
735500 -- [-789.038] (-786.936) (-789.422) (-786.041) * [-787.718] (-788.820) (-785.965) (-786.396) -- 0:00:15
736000 -- (-791.519) (-790.381) [-788.046] (-786.417) * (-789.005) (-791.025) (-788.645) [-786.351] -- 0:00:15
736500 -- (-791.193) (-787.438) [-786.201] (-787.235) * (-787.447) (-789.425) [-788.689] (-785.743) -- 0:00:15
737000 -- (-792.253) (-787.315) (-786.301) [-786.209] * (-785.440) (-787.978) [-788.561] (-788.799) -- 0:00:15
737500 -- (-787.968) (-788.215) [-787.162] (-785.597) * (-786.024) (-787.980) (-789.965) [-787.808] -- 0:00:15
738000 -- [-787.539] (-790.904) (-787.249) (-787.669) * (-789.773) (-788.552) (-786.583) [-788.901] -- 0:00:15
738500 -- (-786.963) (-786.084) (-788.311) [-786.369] * (-786.558) [-788.069] (-787.622) (-788.097) -- 0:00:15
739000 -- [-787.578] (-787.515) (-787.828) (-785.653) * [-786.164] (-789.013) (-787.905) (-788.663) -- 0:00:15
739500 -- (-788.979) [-787.408] (-791.304) (-785.975) * [-788.186] (-788.462) (-786.353) (-786.646) -- 0:00:15
740000 -- (-786.617) (-787.968) (-786.247) [-787.315] * (-790.749) [-786.176] (-789.166) (-789.669) -- 0:00:15
Average standard deviation of split frequencies: 0.006285
740500 -- (-788.883) [-786.256] (-787.597) (-786.930) * (-786.594) (-790.491) (-790.683) [-788.927] -- 0:00:15
741000 -- (-790.278) (-786.289) [-791.256] (-790.113) * [-787.243] (-788.728) (-787.702) (-787.533) -- 0:00:15
741500 -- (-790.470) (-786.984) [-789.120] (-785.712) * [-786.880] (-789.907) (-792.491) (-787.907) -- 0:00:15
742000 -- [-790.378] (-789.551) (-788.893) (-787.911) * (-786.760) (-786.324) [-791.823] (-787.355) -- 0:00:15
742500 -- [-788.781] (-788.934) (-787.541) (-787.273) * (-786.057) [-787.120] (-791.865) (-788.530) -- 0:00:15
743000 -- (-785.517) [-789.826] (-789.927) (-787.011) * [-785.982] (-786.764) (-787.912) (-788.505) -- 0:00:15
743500 -- (-787.186) (-787.142) (-787.179) [-789.421] * (-787.444) [-789.251] (-788.261) (-786.680) -- 0:00:15
744000 -- (-788.325) (-790.400) (-786.239) [-787.184] * [-793.042] (-788.386) (-790.271) (-787.381) -- 0:00:15
744500 -- (-788.141) (-792.771) [-785.927] (-785.478) * [-786.563] (-790.528) (-788.635) (-786.211) -- 0:00:15
745000 -- (-787.296) [-789.592] (-787.197) (-785.717) * (-789.588) [-786.496] (-788.722) (-790.028) -- 0:00:15
Average standard deviation of split frequencies: 0.006240
745500 -- (-786.581) [-791.527] (-785.842) (-786.801) * [-786.630] (-787.031) (-793.528) (-789.763) -- 0:00:15
746000 -- [-787.725] (-786.047) (-785.681) (-788.740) * (-787.920) (-788.591) (-785.917) [-785.906] -- 0:00:14
746500 -- (-787.934) [-787.112] (-787.030) (-789.185) * (-786.709) (-787.469) (-786.946) [-786.378] -- 0:00:14
747000 -- (-788.905) (-787.789) [-786.932] (-787.769) * [-785.979] (-787.911) (-787.994) (-804.081) -- 0:00:14
747500 -- [-786.516] (-788.484) (-786.469) (-786.027) * (-787.979) [-786.256] (-789.308) (-791.290) -- 0:00:15
748000 -- (-786.949) (-789.221) (-790.575) [-787.514] * [-790.880] (-790.113) (-786.192) (-792.332) -- 0:00:15
748500 -- [-788.715] (-787.177) (-786.300) (-788.518) * (-791.174) (-787.059) [-787.155] (-791.262) -- 0:00:15
749000 -- (-787.000) (-786.839) [-787.643] (-786.827) * [-786.411] (-791.287) (-789.143) (-790.152) -- 0:00:15
749500 -- [-786.654] (-785.762) (-793.542) (-787.221) * [-785.863] (-792.266) (-789.626) (-785.848) -- 0:00:15
750000 -- (-786.761) (-794.581) (-787.726) [-787.274] * (-786.522) (-790.549) [-790.838] (-788.301) -- 0:00:15
Average standard deviation of split frequencies: 0.006405
750500 -- (-792.382) [-787.376] (-790.195) (-788.195) * (-789.305) [-789.606] (-787.344) (-787.144) -- 0:00:14
751000 -- (-792.480) [-786.574] (-787.491) (-789.187) * (-785.954) [-786.906] (-791.177) (-788.571) -- 0:00:14
751500 -- (-787.917) (-787.991) (-788.445) [-786.026] * [-792.910] (-786.917) (-793.603) (-788.578) -- 0:00:14
752000 -- (-789.120) (-787.906) (-786.856) [-787.188] * (-788.685) (-787.559) (-788.409) [-787.192] -- 0:00:14
752500 -- (-785.561) (-789.493) [-789.608] (-785.699) * (-787.027) (-788.490) (-786.576) [-787.978] -- 0:00:14
753000 -- [-785.505] (-787.640) (-787.311) (-788.108) * (-787.352) (-788.784) [-786.627] (-792.773) -- 0:00:14
753500 -- [-786.497] (-787.722) (-795.745) (-786.728) * (-787.362) (-787.267) (-787.394) [-786.593] -- 0:00:14
754000 -- (-788.124) (-794.750) (-787.769) [-786.710] * [-786.399] (-787.748) (-787.506) (-786.300) -- 0:00:14
754500 -- (-787.017) (-791.498) (-786.062) [-787.790] * [-788.453] (-787.636) (-786.250) (-786.821) -- 0:00:14
755000 -- (-786.508) (-789.056) [-787.353] (-786.543) * [-787.079] (-786.766) (-786.386) (-790.674) -- 0:00:14
Average standard deviation of split frequencies: 0.006194
755500 -- (-786.605) [-788.929] (-789.760) (-788.708) * (-786.741) [-788.817] (-792.491) (-788.614) -- 0:00:14
756000 -- (-785.795) [-787.095] (-790.346) (-787.282) * [-786.726] (-785.586) (-793.127) (-791.343) -- 0:00:14
756500 -- (-786.943) [-786.645] (-787.946) (-787.896) * (-787.618) (-786.143) [-789.083] (-794.803) -- 0:00:14
757000 -- (-787.080) (-795.806) [-786.241] (-786.353) * [-786.379] (-787.816) (-790.799) (-788.655) -- 0:00:14
757500 -- (-790.213) (-789.192) (-789.012) [-787.669] * [-788.985] (-791.153) (-794.163) (-788.076) -- 0:00:14
758000 -- [-787.133] (-788.921) (-791.405) (-787.427) * [-789.067] (-789.860) (-786.380) (-786.257) -- 0:00:14
758500 -- [-786.212] (-785.940) (-791.303) (-787.969) * [-788.173] (-785.984) (-787.615) (-788.905) -- 0:00:14
759000 -- (-787.879) [-787.482] (-793.908) (-788.507) * (-786.859) [-786.250] (-787.975) (-786.809) -- 0:00:14
759500 -- (-786.310) (-786.810) (-789.601) [-787.964] * (-789.080) (-786.142) (-787.664) [-788.104] -- 0:00:14
760000 -- (-788.082) (-787.410) [-787.420] (-789.093) * (-789.150) (-790.993) (-786.789) [-786.552] -- 0:00:14
Average standard deviation of split frequencies: 0.006115
760500 -- (-785.833) (-787.422) [-788.920] (-788.396) * [-785.651] (-787.429) (-787.643) (-786.112) -- 0:00:14
761000 -- (-791.000) [-790.439] (-792.187) (-789.529) * [-785.461] (-786.822) (-788.056) (-790.212) -- 0:00:14
761500 -- (-788.739) (-786.132) (-785.751) [-785.586] * (-788.136) (-785.872) (-787.735) [-793.897] -- 0:00:14
762000 -- (-787.473) [-788.245] (-791.684) (-785.609) * (-786.278) (-789.644) (-787.673) [-787.726] -- 0:00:14
762500 -- (-794.883) (-787.209) (-788.223) [-786.135] * (-787.815) (-789.894) [-789.366] (-790.251) -- 0:00:14
763000 -- [-790.735] (-790.043) (-786.512) (-785.988) * [-789.300] (-792.543) (-789.335) (-786.936) -- 0:00:13
763500 -- (-790.486) (-788.599) (-788.891) [-791.765] * (-788.699) (-787.191) [-786.710] (-789.733) -- 0:00:13
764000 -- (-787.300) [-786.902] (-789.805) (-787.140) * (-793.016) [-786.450] (-787.178) (-790.685) -- 0:00:13
764500 -- (-787.008) (-787.689) [-786.977] (-786.406) * (-791.696) [-785.956] (-788.676) (-789.377) -- 0:00:14
765000 -- [-788.448] (-786.466) (-791.066) (-786.814) * (-787.326) [-787.568] (-785.885) (-786.197) -- 0:00:14
Average standard deviation of split frequencies: 0.006693
765500 -- (-790.592) (-786.537) (-787.808) [-788.007] * (-787.897) (-790.807) [-786.600] (-788.782) -- 0:00:14
766000 -- (-788.067) (-789.167) (-787.567) [-790.279] * (-788.206) (-789.034) (-786.185) [-788.077] -- 0:00:14
766500 -- (-787.035) (-787.232) [-789.019] (-789.900) * (-785.840) (-787.932) [-789.487] (-790.104) -- 0:00:14
767000 -- [-787.414] (-791.266) (-786.027) (-786.052) * (-788.792) (-789.036) (-789.219) [-788.084] -- 0:00:13
767500 -- (-786.479) (-786.481) [-786.410] (-788.379) * (-791.318) [-789.453] (-789.515) (-787.831) -- 0:00:13
768000 -- [-786.323] (-786.273) (-786.148) (-791.036) * (-787.656) (-788.996) (-787.765) [-787.741] -- 0:00:13
768500 -- [-787.405] (-787.216) (-786.166) (-786.569) * [-788.127] (-788.306) (-786.968) (-785.928) -- 0:00:13
769000 -- (-787.831) (-787.115) (-787.387) [-788.251] * (-790.156) (-793.370) (-788.020) [-787.368] -- 0:00:13
769500 -- (-789.442) (-786.700) (-789.387) [-785.950] * (-786.675) [-791.554] (-788.515) (-785.972) -- 0:00:13
770000 -- (-787.330) [-789.960] (-789.074) (-790.565) * [-786.582] (-791.946) (-786.751) (-785.726) -- 0:00:13
Average standard deviation of split frequencies: 0.006805
770500 -- (-786.112) (-786.856) (-788.701) [-786.775] * (-789.292) (-788.964) (-785.955) [-787.606] -- 0:00:13
771000 -- (-787.202) (-786.726) [-786.690] (-792.071) * [-791.129] (-788.025) (-786.823) (-788.205) -- 0:00:13
771500 -- [-788.533] (-787.985) (-788.520) (-787.829) * (-790.273) (-788.494) [-787.210] (-789.072) -- 0:00:13
772000 -- (-790.545) [-787.074] (-792.315) (-787.110) * (-788.061) (-788.473) (-790.687) [-789.952] -- 0:00:13
772500 -- [-788.528] (-789.891) (-788.060) (-789.155) * (-788.660) (-788.076) (-789.035) [-786.903] -- 0:00:13
773000 -- [-787.224] (-788.393) (-787.636) (-786.124) * (-791.440) [-789.644] (-788.480) (-787.932) -- 0:00:13
773500 -- (-787.021) (-788.319) (-787.787) [-789.737] * (-792.762) (-791.563) (-787.313) [-787.221] -- 0:00:13
774000 -- [-787.211] (-790.016) (-785.549) (-789.273) * [-787.069] (-789.394) (-789.021) (-790.387) -- 0:00:13
774500 -- (-787.587) [-787.146] (-788.801) (-791.343) * [-787.187] (-793.135) (-788.987) (-786.679) -- 0:00:13
775000 -- (-789.547) (-787.103) [-787.371] (-786.857) * [-788.487] (-787.730) (-788.147) (-790.415) -- 0:00:13
Average standard deviation of split frequencies: 0.006758
775500 -- (-793.325) (-790.579) [-787.122] (-788.415) * (-795.002) (-789.663) [-786.164] (-790.625) -- 0:00:13
776000 -- (-788.092) [-786.210] (-786.471) (-786.445) * (-789.277) (-793.451) [-787.564] (-788.880) -- 0:00:13
776500 -- (-792.039) (-787.254) [-786.447] (-786.118) * [-788.498] (-787.946) (-786.507) (-789.279) -- 0:00:13
777000 -- (-787.985) [-788.313] (-786.131) (-788.654) * [-790.138] (-790.080) (-787.629) (-786.882) -- 0:00:13
777500 -- (-787.635) (-788.264) [-791.098] (-786.529) * (-791.752) (-789.354) [-788.434] (-787.688) -- 0:00:13
778000 -- [-786.458] (-789.034) (-788.818) (-787.906) * (-787.828) [-786.110] (-792.115) (-787.376) -- 0:00:13
778500 -- (-790.345) (-790.157) [-787.375] (-788.946) * (-789.603) (-785.852) [-787.083] (-787.612) -- 0:00:13
779000 -- (-789.088) [-788.212] (-786.850) (-789.485) * (-788.449) [-786.252] (-788.673) (-786.559) -- 0:00:13
779500 -- [-786.837] (-786.343) (-786.388) (-791.271) * [-786.461] (-786.126) (-788.698) (-786.477) -- 0:00:13
780000 -- (-787.231) (-786.749) (-786.995) [-789.833] * [-788.799] (-787.538) (-789.559) (-786.119) -- 0:00:12
Average standard deviation of split frequencies: 0.007208
780500 -- (-789.922) (-786.193) [-788.242] (-794.660) * [-786.790] (-789.257) (-788.367) (-786.118) -- 0:00:12
781000 -- (-787.600) (-789.323) (-786.004) [-787.416] * [-786.310] (-791.798) (-788.308) (-787.784) -- 0:00:13
781500 -- (-786.795) (-787.866) (-791.921) [-786.451] * (-788.519) (-788.006) [-790.952] (-787.148) -- 0:00:13
782000 -- [-788.215] (-787.289) (-789.397) (-790.644) * [-791.691] (-787.519) (-786.105) (-787.421) -- 0:00:13
782500 -- (-788.299) (-788.477) [-787.385] (-787.842) * [-788.015] (-787.475) (-786.113) (-788.729) -- 0:00:13
783000 -- (-792.652) (-786.526) (-788.415) [-793.099] * (-786.215) (-787.347) (-786.737) [-786.309] -- 0:00:13
783500 -- (-789.127) (-790.086) (-786.404) [-791.332] * (-786.615) (-786.873) [-787.878] (-787.034) -- 0:00:12
784000 -- [-788.049] (-788.161) (-787.538) (-787.922) * [-786.043] (-787.003) (-787.993) (-789.679) -- 0:00:12
784500 -- (-788.314) (-788.048) [-789.671] (-790.336) * (-787.603) (-787.400) [-787.165] (-789.036) -- 0:00:12
785000 -- (-786.541) (-790.890) (-790.478) [-787.738] * [-786.587] (-786.572) (-789.752) (-795.037) -- 0:00:12
Average standard deviation of split frequencies: 0.007122
785500 -- (-789.466) (-789.235) (-795.685) [-789.811] * (-792.485) (-787.672) (-791.816) [-791.781] -- 0:00:12
786000 -- [-787.669] (-789.651) (-792.348) (-787.065) * (-790.573) (-786.111) [-787.839] (-790.525) -- 0:00:12
786500 -- (-786.287) [-790.647] (-786.598) (-787.181) * (-791.573) (-787.515) (-786.888) [-787.285] -- 0:00:12
787000 -- (-788.635) [-788.955] (-787.828) (-787.323) * (-791.596) (-789.151) (-786.159) [-787.844] -- 0:00:12
787500 -- (-788.790) (-789.845) (-787.454) [-785.850] * [-785.626] (-790.880) (-787.633) (-788.196) -- 0:00:12
788000 -- (-788.573) [-787.248] (-788.617) (-786.470) * (-785.656) (-786.900) [-788.393] (-787.160) -- 0:00:12
788500 -- [-786.614] (-787.708) (-790.956) (-785.788) * (-786.893) (-787.750) (-787.671) [-785.919] -- 0:00:12
789000 -- [-786.314] (-788.771) (-788.438) (-788.606) * [-787.636] (-788.267) (-790.006) (-789.420) -- 0:00:12
789500 -- (-788.665) [-786.398] (-787.043) (-788.933) * (-789.427) (-787.355) [-789.480] (-789.196) -- 0:00:12
790000 -- (-788.372) (-787.039) [-789.223] (-788.445) * [-788.915] (-788.262) (-785.987) (-786.386) -- 0:00:12
Average standard deviation of split frequencies: 0.007155
790500 -- (-785.768) (-786.629) [-788.929] (-792.003) * (-792.072) (-789.817) [-787.650] (-786.540) -- 0:00:12
791000 -- [-786.649] (-786.599) (-791.730) (-789.468) * (-785.721) [-789.071] (-788.131) (-786.963) -- 0:00:12
791500 -- [-787.001] (-787.130) (-788.117) (-792.061) * (-787.391) (-785.878) [-788.530] (-789.325) -- 0:00:12
792000 -- (-792.055) (-788.342) [-788.655] (-788.160) * (-787.214) [-787.846] (-790.717) (-787.137) -- 0:00:12
792500 -- (-787.360) [-786.455] (-791.507) (-786.741) * (-787.053) [-786.744] (-787.536) (-787.743) -- 0:00:12
793000 -- (-791.649) [-787.249] (-788.241) (-787.267) * (-788.368) (-788.215) [-787.519] (-786.053) -- 0:00:12
793500 -- (-790.401) (-793.790) (-786.859) [-787.273] * [-788.500] (-787.053) (-786.346) (-786.577) -- 0:00:12
794000 -- (-789.099) (-787.482) [-787.570] (-788.138) * (-788.862) (-785.626) (-786.422) [-787.236] -- 0:00:12
794500 -- [-786.278] (-788.133) (-788.601) (-791.239) * [-790.395] (-786.990) (-787.014) (-787.123) -- 0:00:12
795000 -- (-787.887) (-788.231) (-789.256) [-789.171] * (-788.327) (-788.946) [-786.639] (-790.240) -- 0:00:12
Average standard deviation of split frequencies: 0.006959
795500 -- (-786.519) (-786.663) (-787.411) [-789.714] * (-786.757) (-786.953) (-786.397) [-788.801] -- 0:00:12
796000 -- [-786.670] (-789.063) (-787.401) (-788.658) * (-787.249) (-786.917) [-786.131] (-789.200) -- 0:00:12
796500 -- (-789.385) (-786.214) [-787.123] (-788.269) * [-786.406] (-788.433) (-785.899) (-788.970) -- 0:00:12
797000 -- (-787.597) [-786.909] (-786.112) (-790.018) * [-788.732] (-788.155) (-789.552) (-786.650) -- 0:00:11
797500 -- (-785.763) (-786.539) [-786.253] (-788.782) * (-787.927) [-789.228] (-787.528) (-790.020) -- 0:00:12
798000 -- (-786.613) [-788.328] (-790.356) (-786.601) * [-787.681] (-786.398) (-788.460) (-790.076) -- 0:00:12
798500 -- [-786.573] (-792.166) (-790.484) (-788.816) * [-789.016] (-788.371) (-787.997) (-787.119) -- 0:00:12
799000 -- (-786.682) [-787.260] (-791.736) (-787.540) * [-785.529] (-788.730) (-787.907) (-786.554) -- 0:00:12
799500 -- [-786.747] (-785.936) (-787.299) (-786.332) * (-787.511) [-786.033] (-789.180) (-792.456) -- 0:00:12
800000 -- [-787.279] (-788.640) (-787.728) (-786.106) * (-788.259) [-785.794] (-785.982) (-790.744) -- 0:00:12
Average standard deviation of split frequencies: 0.006697
800500 -- [-788.420] (-787.057) (-787.822) (-786.537) * (-788.166) (-785.406) [-786.197] (-790.462) -- 0:00:11
801000 -- (-788.455) (-788.245) [-786.373] (-787.753) * (-785.848) (-788.082) [-786.503] (-787.084) -- 0:00:11
801500 -- (-788.488) (-787.828) [-785.563] (-789.608) * (-788.718) (-789.900) (-787.669) [-789.185] -- 0:00:11
802000 -- (-787.890) [-790.981] (-786.486) (-793.629) * (-790.384) [-786.957] (-785.874) (-787.882) -- 0:00:11
802500 -- [-788.092] (-791.033) (-788.533) (-788.623) * (-786.254) (-786.951) (-786.056) [-785.834] -- 0:00:11
803000 -- [-786.687] (-791.114) (-791.934) (-788.784) * (-788.432) (-788.586) [-786.822] (-786.184) -- 0:00:11
803500 -- (-787.046) (-788.719) [-786.721] (-787.727) * (-790.013) (-791.675) (-787.078) [-786.059] -- 0:00:11
804000 -- (-787.526) (-788.469) (-786.820) [-787.186] * (-787.030) (-785.655) [-787.799] (-786.869) -- 0:00:11
804500 -- (-789.250) (-787.334) [-786.486] (-788.070) * (-787.288) [-791.412] (-788.010) (-787.068) -- 0:00:11
805000 -- (-785.860) (-786.500) [-789.724] (-787.993) * (-788.101) (-787.004) (-791.694) [-787.449] -- 0:00:11
Average standard deviation of split frequencies: 0.006507
805500 -- (-789.768) (-786.993) (-788.876) [-791.202] * (-789.343) (-787.940) [-787.887] (-787.842) -- 0:00:11
806000 -- (-789.027) [-786.967] (-790.114) (-792.132) * [-787.431] (-790.060) (-790.137) (-787.484) -- 0:00:11
806500 -- (-792.461) (-789.049) [-789.064] (-790.065) * (-787.311) (-786.800) [-790.577] (-787.702) -- 0:00:11
807000 -- (-787.300) [-787.041] (-789.914) (-786.431) * (-789.978) (-789.634) [-785.617] (-788.438) -- 0:00:11
807500 -- (-791.507) [-787.970] (-791.104) (-788.086) * (-788.534) (-787.994) (-788.073) [-787.067] -- 0:00:11
808000 -- [-787.859] (-788.527) (-786.837) (-790.339) * [-788.905] (-788.228) (-792.553) (-786.270) -- 0:00:11
808500 -- (-788.554) (-786.283) (-790.797) [-788.670] * (-785.999) (-788.957) (-788.355) [-787.939] -- 0:00:11
809000 -- (-787.524) [-787.061] (-789.174) (-786.778) * (-789.552) [-789.030] (-790.269) (-786.851) -- 0:00:11
809500 -- (-789.176) (-786.701) [-789.236] (-786.897) * (-793.351) (-790.382) [-786.693] (-786.376) -- 0:00:11
810000 -- [-787.342] (-786.866) (-789.457) (-786.592) * (-787.056) (-792.144) (-786.426) [-786.184] -- 0:00:11
Average standard deviation of split frequencies: 0.006760
810500 -- (-787.172) [-789.331] (-786.955) (-788.387) * (-787.321) (-792.138) [-786.656] (-789.762) -- 0:00:11
811000 -- [-786.999] (-785.858) (-787.329) (-787.685) * (-787.181) (-790.040) [-787.495] (-786.769) -- 0:00:11
811500 -- [-786.300] (-787.692) (-787.224) (-787.149) * (-788.145) [-787.799] (-788.910) (-786.710) -- 0:00:11
812000 -- (-790.203) (-786.416) [-788.795] (-785.832) * (-786.461) (-787.339) (-788.034) [-786.600] -- 0:00:11
812500 -- (-790.085) [-787.467] (-786.726) (-785.446) * (-788.306) (-787.343) [-788.229] (-792.819) -- 0:00:11
813000 -- (-787.154) (-788.540) (-788.431) [-789.280] * [-785.713] (-786.096) (-788.768) (-789.496) -- 0:00:11
813500 -- [-788.675] (-786.422) (-788.297) (-790.531) * (-788.698) (-789.060) [-787.850] (-789.879) -- 0:00:11
814000 -- (-788.224) (-789.287) (-787.928) [-787.929] * (-785.374) (-789.781) (-788.027) [-786.571] -- 0:00:11
814500 -- [-788.027] (-785.978) (-787.513) (-787.089) * (-786.927) (-788.988) [-786.204] (-791.145) -- 0:00:11
815000 -- (-786.728) (-786.661) (-789.061) [-790.859] * (-788.907) (-786.323) (-786.066) [-786.609] -- 0:00:11
Average standard deviation of split frequencies: 0.006509
815500 -- (-787.097) (-788.228) (-788.030) [-786.300] * (-788.255) (-786.341) (-790.419) [-787.628] -- 0:00:11
816000 -- (-789.401) (-786.637) [-785.798] (-789.541) * (-787.741) (-787.448) (-790.526) [-787.724] -- 0:00:11
816500 -- [-789.560] (-786.800) (-786.942) (-788.835) * (-788.713) (-787.449) (-788.819) [-787.112] -- 0:00:11
817000 -- [-787.364] (-792.602) (-788.926) (-788.611) * [-788.762] (-787.293) (-788.429) (-786.180) -- 0:00:10
817500 -- [-786.385] (-792.162) (-788.816) (-788.517) * [-785.888] (-789.430) (-790.008) (-787.832) -- 0:00:10
818000 -- (-787.262) (-786.586) [-787.906] (-789.991) * (-792.758) (-788.785) (-786.475) [-786.904] -- 0:00:10
818500 -- (-788.129) [-786.100] (-787.307) (-786.704) * [-789.698] (-788.317) (-787.669) (-786.963) -- 0:00:10
819000 -- (-786.133) (-787.800) (-786.093) [-785.663] * [-787.154] (-787.772) (-790.229) (-790.167) -- 0:00:10
819500 -- (-786.659) (-790.269) (-786.215) [-789.591] * [-789.262] (-788.513) (-787.821) (-788.369) -- 0:00:10
820000 -- [-787.191] (-789.555) (-786.441) (-790.495) * (-789.746) (-793.027) (-790.224) [-787.626] -- 0:00:10
Average standard deviation of split frequencies: 0.005974
820500 -- (-788.408) (-789.749) (-786.441) [-786.459] * (-789.978) (-792.788) (-786.758) [-788.051] -- 0:00:10
821000 -- (-789.595) (-787.354) [-789.536] (-787.641) * (-787.728) [-786.198] (-790.217) (-790.953) -- 0:00:10
821500 -- (-790.290) (-787.171) [-788.050] (-788.743) * (-790.096) [-786.646] (-789.568) (-793.136) -- 0:00:10
822000 -- [-788.348] (-787.598) (-788.337) (-789.439) * (-786.589) (-791.527) [-786.886] (-786.816) -- 0:00:10
822500 -- (-787.139) (-798.249) (-786.470) [-788.153] * (-786.313) (-788.315) [-786.704] (-788.973) -- 0:00:10
823000 -- (-790.584) (-786.629) (-789.097) [-787.773] * (-787.092) (-787.775) [-787.187] (-786.723) -- 0:00:10
823500 -- (-787.526) [-786.649] (-786.046) (-786.860) * [-787.193] (-790.939) (-786.897) (-787.934) -- 0:00:10
824000 -- (-787.158) (-788.107) (-786.390) [-788.672] * (-788.786) [-790.497] (-786.409) (-785.622) -- 0:00:10
824500 -- (-788.598) (-785.755) [-785.989] (-786.530) * (-789.538) (-790.036) (-787.213) [-786.436] -- 0:00:10
825000 -- [-787.329] (-786.050) (-786.182) (-787.580) * (-790.918) (-786.869) (-785.714) [-786.071] -- 0:00:10
Average standard deviation of split frequencies: 0.006050
825500 -- (-788.838) (-788.636) [-788.432] (-794.931) * (-793.954) (-787.942) (-786.514) [-787.597] -- 0:00:10
826000 -- [-789.280] (-786.998) (-788.464) (-786.821) * [-789.222] (-790.078) (-788.478) (-788.507) -- 0:00:10
826500 -- (-789.783) [-788.331] (-787.458) (-793.981) * (-786.172) (-791.908) (-787.471) [-793.381] -- 0:00:10
827000 -- (-789.713) (-787.727) [-790.340] (-790.826) * (-791.078) [-786.959] (-789.303) (-790.064) -- 0:00:10
827500 -- (-787.117) [-786.984] (-789.151) (-790.105) * [-788.273] (-786.251) (-787.790) (-789.900) -- 0:00:10
828000 -- (-786.370) [-787.302] (-793.466) (-786.405) * (-788.028) [-787.334] (-786.837) (-791.285) -- 0:00:10
828500 -- (-786.584) (-793.563) (-789.089) [-789.116] * (-787.603) (-787.466) [-788.604] (-786.944) -- 0:00:10
829000 -- (-787.547) (-789.864) (-789.229) [-786.826] * (-792.335) [-785.667] (-789.264) (-789.467) -- 0:00:10
829500 -- [-787.269] (-789.340) (-787.183) (-787.833) * (-788.976) (-786.422) [-786.494] (-787.131) -- 0:00:10
830000 -- (-788.494) [-789.523] (-789.808) (-787.855) * (-789.790) (-789.433) [-785.493] (-791.461) -- 0:00:10
Average standard deviation of split frequencies: 0.006091
830500 -- (-786.227) (-786.166) (-789.814) [-785.950] * (-791.081) [-787.744] (-785.836) (-787.945) -- 0:00:10
831000 -- (-787.735) (-785.629) [-790.773] (-786.772) * (-791.106) (-786.697) (-787.011) [-789.455] -- 0:00:10
831500 -- (-787.404) [-787.139] (-788.381) (-789.684) * (-787.705) (-786.857) [-787.379] (-787.079) -- 0:00:10
832000 -- (-789.370) (-786.106) [-788.502] (-787.142) * (-788.089) [-789.226] (-789.409) (-787.700) -- 0:00:10
832500 -- (-789.369) [-787.490] (-793.131) (-786.578) * (-786.057) (-786.588) (-786.602) [-785.913] -- 0:00:10
833000 -- [-787.627] (-788.503) (-788.650) (-788.115) * (-788.954) [-789.079] (-785.911) (-785.521) -- 0:00:10
833500 -- (-789.986) (-787.636) (-786.993) [-788.462] * (-787.962) [-789.738] (-785.911) (-788.869) -- 0:00:09
834000 -- (-791.396) (-786.839) [-788.134] (-788.462) * (-787.579) (-788.669) (-786.875) [-787.769] -- 0:00:09
834500 -- (-786.736) (-786.688) (-787.259) [-786.740] * [-786.306] (-787.318) (-788.054) (-789.481) -- 0:00:09
835000 -- [-787.626] (-789.225) (-787.689) (-788.550) * [-788.128] (-786.827) (-787.674) (-788.185) -- 0:00:09
Average standard deviation of split frequencies: 0.005864
835500 -- (-787.744) (-786.586) (-787.662) [-786.129] * (-788.896) (-786.391) [-790.053] (-791.273) -- 0:00:09
836000 -- (-786.801) [-787.558] (-786.478) (-786.484) * (-789.298) (-790.981) [-787.063] (-787.339) -- 0:00:09
836500 -- (-788.941) [-786.593] (-786.912) (-785.954) * (-790.287) (-788.734) (-787.547) [-787.087] -- 0:00:09
837000 -- (-790.918) (-791.346) (-787.804) [-786.052] * (-788.075) (-790.284) (-786.057) [-787.435] -- 0:00:09
837500 -- (-787.262) (-787.806) [-786.625] (-786.692) * (-786.269) (-788.222) [-786.583] (-786.691) -- 0:00:09
838000 -- (-787.993) (-791.795) (-788.224) [-791.725] * [-786.217] (-789.207) (-787.462) (-786.452) -- 0:00:09
838500 -- (-790.362) (-790.184) [-787.134] (-791.558) * (-789.034) [-788.526] (-786.100) (-786.567) -- 0:00:09
839000 -- [-790.193] (-785.827) (-786.026) (-787.060) * [-789.315] (-787.930) (-786.332) (-786.697) -- 0:00:09
839500 -- (-785.691) (-787.559) [-785.857] (-785.887) * [-788.081] (-786.958) (-788.466) (-786.616) -- 0:00:09
840000 -- (-785.714) (-794.917) [-786.228] (-789.217) * (-789.408) (-787.445) (-788.110) [-786.839] -- 0:00:09
Average standard deviation of split frequencies: 0.006168
840500 -- [-786.253] (-791.358) (-787.909) (-790.202) * (-786.908) (-788.503) [-786.978] (-788.581) -- 0:00:09
841000 -- (-786.743) [-789.321] (-787.397) (-788.447) * (-790.845) [-786.096] (-785.886) (-787.443) -- 0:00:09
841500 -- (-787.244) (-789.483) [-786.150] (-787.815) * (-790.802) [-786.310] (-785.641) (-788.766) -- 0:00:09
842000 -- (-786.060) (-787.131) [-785.827] (-788.794) * (-791.782) (-785.727) (-787.002) [-787.304] -- 0:00:09
842500 -- (-788.946) (-790.407) (-786.656) [-788.235] * (-787.655) (-790.290) (-788.670) [-788.026] -- 0:00:09
843000 -- (-788.471) (-790.252) (-786.321) [-785.904] * [-786.705] (-787.774) (-791.067) (-787.831) -- 0:00:09
843500 -- (-788.443) (-786.098) [-787.485] (-786.585) * (-787.716) (-787.004) (-786.319) [-789.868] -- 0:00:09
844000 -- (-785.718) (-787.124) (-788.009) [-788.835] * (-787.379) (-790.128) (-785.944) [-789.710] -- 0:00:09
844500 -- (-785.922) (-789.661) (-787.099) [-788.900] * (-786.269) [-788.264] (-788.326) (-787.766) -- 0:00:09
845000 -- (-786.500) (-786.598) [-786.406] (-786.530) * (-788.146) (-790.510) [-788.914] (-787.813) -- 0:00:09
Average standard deviation of split frequencies: 0.006167
845500 -- [-785.901] (-787.929) (-785.503) (-787.436) * (-786.504) (-787.629) (-786.979) [-790.611] -- 0:00:09
846000 -- (-787.988) (-789.706) (-785.670) [-788.549] * (-791.102) [-786.360] (-788.811) (-787.380) -- 0:00:09
846500 -- [-787.838] (-786.098) (-786.565) (-788.262) * (-790.050) (-786.902) (-787.098) [-787.526] -- 0:00:09
847000 -- (-788.960) [-785.716] (-786.667) (-788.103) * (-787.159) (-788.993) [-786.458] (-788.540) -- 0:00:09
847500 -- (-789.545) (-786.241) [-786.091] (-788.132) * (-788.100) (-787.678) (-789.065) [-790.041] -- 0:00:09
848000 -- [-787.674] (-786.239) (-791.128) (-786.316) * (-788.053) (-789.302) (-788.396) [-788.953] -- 0:00:09
848500 -- [-787.297] (-786.949) (-791.528) (-792.219) * [-787.039] (-788.703) (-792.130) (-785.960) -- 0:00:09
849000 -- [-785.640] (-786.491) (-788.061) (-789.423) * (-785.900) (-791.886) [-788.025] (-786.255) -- 0:00:09
849500 -- [-789.002] (-786.067) (-789.331) (-786.481) * (-787.314) [-789.373] (-789.261) (-788.317) -- 0:00:09
850000 -- (-789.827) [-787.016] (-788.160) (-788.378) * (-786.459) (-787.488) (-786.989) [-787.909] -- 0:00:09
Average standard deviation of split frequencies: 0.006317
850500 -- [-791.064] (-786.343) (-792.314) (-788.089) * (-786.164) (-788.157) (-788.106) [-787.023] -- 0:00:08
851000 -- (-787.394) [-787.358] (-790.816) (-792.516) * (-790.644) (-791.764) [-786.919] (-785.943) -- 0:00:08
851500 -- (-788.357) [-787.240] (-787.477) (-792.405) * [-787.579] (-787.076) (-785.977) (-785.565) -- 0:00:08
852000 -- (-786.346) (-787.559) (-787.293) [-788.213] * (-786.895) (-786.695) [-787.036] (-786.633) -- 0:00:08
852500 -- [-788.215] (-788.415) (-786.672) (-786.904) * [-785.985] (-786.808) (-787.896) (-787.142) -- 0:00:08
853000 -- [-789.502] (-787.133) (-788.027) (-788.168) * (-789.273) [-786.409] (-789.341) (-787.088) -- 0:00:08
853500 -- [-789.034] (-787.387) (-792.364) (-789.498) * (-787.146) (-787.081) [-786.852] (-789.465) -- 0:00:08
854000 -- (-786.254) [-786.874] (-792.727) (-790.547) * (-786.767) (-787.220) (-793.004) [-785.472] -- 0:00:08
854500 -- (-787.076) [-787.001] (-786.394) (-789.106) * [-788.063] (-787.905) (-791.971) (-786.643) -- 0:00:08
855000 -- (-786.941) (-788.991) (-785.704) [-791.298] * (-789.720) (-787.577) (-788.596) [-786.084] -- 0:00:08
Average standard deviation of split frequencies: 0.006094
855500 -- [-789.914] (-786.732) (-787.260) (-788.618) * (-792.145) (-786.742) [-786.261] (-785.979) -- 0:00:08
856000 -- (-789.846) [-787.739] (-789.212) (-787.711) * (-786.399) [-787.169] (-785.963) (-789.208) -- 0:00:08
856500 -- (-788.523) (-789.842) (-787.921) [-786.935] * (-792.365) (-789.418) (-786.096) [-789.005] -- 0:00:08
857000 -- (-786.577) [-787.576] (-787.080) (-788.382) * (-787.864) (-790.430) [-786.124] (-786.942) -- 0:00:08
857500 -- (-785.963) [-786.032] (-786.598) (-790.718) * (-788.642) [-788.651] (-790.909) (-786.939) -- 0:00:08
858000 -- (-786.329) [-786.424] (-786.993) (-793.958) * [-788.393] (-787.692) (-787.685) (-792.965) -- 0:00:08
858500 -- (-787.476) (-787.616) [-786.700] (-789.065) * (-788.340) [-787.193] (-790.303) (-786.693) -- 0:00:08
859000 -- (-789.679) [-786.776] (-786.336) (-786.996) * [-786.605] (-787.973) (-789.216) (-790.261) -- 0:00:08
859500 -- (-790.425) (-787.828) [-790.365] (-788.676) * [-786.737] (-788.990) (-787.067) (-791.159) -- 0:00:08
860000 -- (-788.788) (-787.199) [-785.849] (-793.936) * (-787.565) (-786.577) (-787.234) [-790.407] -- 0:00:08
Average standard deviation of split frequencies: 0.006025
860500 -- [-787.647] (-790.275) (-785.789) (-792.729) * (-787.803) (-789.074) [-786.156] (-789.551) -- 0:00:08
861000 -- (-787.215) (-787.581) [-785.949] (-787.477) * (-790.778) (-787.628) (-787.530) [-787.943] -- 0:00:08
861500 -- (-786.817) (-791.383) [-787.173] (-790.349) * (-791.908) (-788.528) (-794.079) [-786.171] -- 0:00:08
862000 -- [-786.827] (-786.593) (-788.067) (-786.274) * (-796.411) (-788.252) (-787.765) [-787.074] -- 0:00:08
862500 -- (-789.739) [-786.683] (-787.418) (-789.365) * (-786.873) (-787.746) [-787.562] (-787.474) -- 0:00:08
863000 -- (-788.194) (-785.911) [-786.900] (-787.578) * (-791.234) [-786.867] (-786.701) (-787.488) -- 0:00:08
863500 -- (-788.667) [-786.249] (-787.280) (-788.154) * (-788.581) (-788.127) [-785.754] (-789.667) -- 0:00:08
864000 -- [-786.683] (-787.357) (-789.655) (-787.556) * [-788.547] (-788.121) (-785.642) (-789.191) -- 0:00:08
864500 -- (-787.531) (-788.174) (-790.153) [-787.927] * (-790.188) (-787.647) [-789.455] (-789.272) -- 0:00:08
865000 -- [-789.750] (-795.757) (-790.685) (-787.081) * (-789.539) [-785.707] (-786.374) (-789.482) -- 0:00:08
Average standard deviation of split frequencies: 0.006278
865500 -- (-786.640) [-787.194] (-787.298) (-786.888) * [-785.717] (-786.033) (-790.305) (-789.273) -- 0:00:08
866000 -- (-786.822) (-787.906) [-787.674] (-787.484) * (-786.075) (-786.496) (-788.664) [-789.360] -- 0:00:08
866500 -- (-787.649) (-787.318) (-786.365) [-789.562] * [-785.838] (-786.784) (-788.709) (-788.613) -- 0:00:08
867000 -- (-788.625) (-792.240) [-786.745] (-789.362) * (-785.874) [-786.224] (-786.261) (-786.448) -- 0:00:07
867500 -- (-786.096) [-786.841] (-787.414) (-787.871) * (-786.426) (-785.911) [-785.716] (-786.934) -- 0:00:07
868000 -- (-786.547) (-786.388) (-786.995) [-787.638] * (-790.608) (-787.109) (-787.644) [-786.787] -- 0:00:07
868500 -- (-791.131) [-789.767] (-791.007) (-787.369) * (-788.504) (-793.133) [-787.238] (-788.187) -- 0:00:07
869000 -- [-788.271] (-789.090) (-789.630) (-788.653) * (-788.165) (-788.847) [-786.546] (-787.083) -- 0:00:07
869500 -- (-789.952) (-790.616) (-785.476) [-788.312] * (-791.765) (-788.044) [-785.770] (-786.036) -- 0:00:07
870000 -- (-786.026) [-793.156] (-785.944) (-786.882) * (-797.475) (-788.500) (-786.181) [-786.846] -- 0:00:07
Average standard deviation of split frequencies: 0.006281
870500 -- (-786.480) (-790.505) [-788.474] (-791.871) * (-791.330) (-787.223) (-788.608) [-787.664] -- 0:00:07
871000 -- (-786.597) [-790.580] (-786.944) (-788.978) * (-792.245) [-787.347] (-790.436) (-790.855) -- 0:00:07
871500 -- [-785.860] (-790.419) (-790.395) (-788.228) * (-786.714) (-790.342) [-791.747] (-786.523) -- 0:00:07
872000 -- [-786.704] (-789.570) (-786.947) (-788.518) * (-788.346) (-789.790) (-787.761) [-787.817] -- 0:00:07
872500 -- (-786.377) (-788.605) [-791.101] (-788.149) * (-793.427) [-785.498] (-789.015) (-787.733) -- 0:00:07
873000 -- [-788.255] (-788.026) (-787.469) (-787.737) * (-788.364) [-789.810] (-790.692) (-787.733) -- 0:00:07
873500 -- [-786.790] (-787.712) (-786.259) (-788.510) * [-787.886] (-786.195) (-788.272) (-788.210) -- 0:00:07
874000 -- (-786.107) [-787.190] (-789.316) (-786.636) * (-786.960) (-786.400) (-786.974) [-788.576] -- 0:00:07
874500 -- (-787.402) (-787.627) (-791.423) [-785.707] * (-786.005) (-786.468) [-786.545] (-788.800) -- 0:00:07
875000 -- (-792.441) (-786.540) [-787.129] (-787.145) * (-790.786) (-792.049) [-786.113] (-789.401) -- 0:00:07
Average standard deviation of split frequencies: 0.006099
875500 -- (-792.593) (-791.714) [-788.498] (-787.966) * (-786.198) (-787.974) [-786.322] (-788.723) -- 0:00:07
876000 -- (-789.235) (-786.114) (-787.470) [-786.487] * (-786.348) (-788.888) (-789.500) [-786.870] -- 0:00:07
876500 -- (-786.334) [-788.252] (-787.875) (-787.718) * [-790.406] (-787.998) (-788.547) (-787.106) -- 0:00:07
877000 -- [-788.716] (-785.716) (-786.854) (-789.407) * (-786.973) (-787.834) (-790.870) [-788.195] -- 0:00:07
877500 -- (-788.870) [-787.131] (-788.513) (-789.479) * [-785.581] (-789.594) (-790.535) (-787.963) -- 0:00:07
878000 -- (-789.198) [-787.516] (-788.628) (-787.676) * (-788.910) (-786.749) (-790.673) [-786.792] -- 0:00:07
878500 -- (-789.817) (-786.660) (-786.465) [-790.720] * (-787.427) (-786.554) (-791.300) [-786.315] -- 0:00:07
879000 -- (-789.692) (-786.469) (-789.019) [-789.583] * (-786.337) [-787.501] (-791.325) (-786.346) -- 0:00:07
879500 -- (-787.657) (-789.478) [-786.675] (-786.922) * (-786.400) (-788.352) [-788.223] (-789.907) -- 0:00:07
880000 -- (-789.448) [-788.355] (-790.732) (-787.684) * (-791.142) [-788.640] (-787.539) (-787.291) -- 0:00:07
Average standard deviation of split frequencies: 0.006067
880500 -- (-789.196) (-786.581) (-791.064) [-787.384] * (-785.840) (-787.029) [-787.367] (-788.534) -- 0:00:07
881000 -- [-788.171] (-788.939) (-788.032) (-788.662) * (-786.694) (-787.151) (-789.082) [-786.499] -- 0:00:07
881500 -- (-792.751) [-786.211] (-789.856) (-789.458) * (-786.460) (-786.564) (-789.175) [-786.242] -- 0:00:07
882000 -- (-790.622) (-786.611) [-788.034] (-787.301) * (-791.188) (-790.733) (-789.888) [-792.119] -- 0:00:07
882500 -- (-788.403) [-789.132] (-792.169) (-786.033) * [-787.926] (-790.580) (-791.462) (-788.496) -- 0:00:07
883000 -- (-787.717) [-788.167] (-792.239) (-790.824) * (-795.180) [-789.996] (-786.461) (-786.543) -- 0:00:07
883500 -- (-788.712) (-786.904) (-792.078) [-788.719] * [-789.989] (-789.345) (-786.432) (-787.254) -- 0:00:06
884000 -- [-787.106] (-789.563) (-790.982) (-785.918) * (-786.746) [-787.390] (-787.272) (-788.411) -- 0:00:06
884500 -- (-787.288) [-786.452] (-791.800) (-786.855) * [-792.806] (-790.659) (-787.047) (-786.706) -- 0:00:06
885000 -- (-788.129) (-788.657) [-787.303] (-787.624) * (-790.398) [-788.124] (-788.232) (-786.021) -- 0:00:06
Average standard deviation of split frequencies: 0.005995
885500 -- [-787.637] (-787.594) (-786.618) (-788.683) * (-787.006) (-790.411) (-788.598) [-786.501] -- 0:00:06
886000 -- (-793.543) [-785.955] (-788.064) (-787.173) * (-790.914) [-787.095] (-790.761) (-786.294) -- 0:00:06
886500 -- (-786.307) (-786.375) (-785.660) [-788.369] * (-789.978) [-787.389] (-791.100) (-786.622) -- 0:00:06
887000 -- [-788.203] (-786.374) (-789.556) (-787.458) * (-788.037) (-790.060) [-789.143] (-786.237) -- 0:00:06
887500 -- (-787.415) (-791.948) [-786.144] (-788.427) * (-786.754) (-788.113) (-788.649) [-787.144] -- 0:00:06
888000 -- (-787.422) (-789.041) [-788.774] (-787.234) * (-787.381) (-786.244) (-788.045) [-787.621] -- 0:00:06
888500 -- (-786.879) [-786.365] (-787.358) (-786.345) * (-787.520) (-788.127) [-786.833] (-787.886) -- 0:00:06
889000 -- (-785.826) (-788.832) (-789.332) [-787.078] * [-787.658] (-787.987) (-786.834) (-786.940) -- 0:00:06
889500 -- (-786.511) [-787.514] (-790.858) (-786.564) * (-787.448) (-790.779) [-787.075] (-787.032) -- 0:00:06
890000 -- (-788.435) (-787.099) [-788.368] (-787.609) * (-785.984) [-789.546] (-787.494) (-790.112) -- 0:00:06
Average standard deviation of split frequencies: 0.005716
890500 -- (-790.695) [-786.431] (-788.124) (-791.679) * [-787.044] (-786.095) (-789.238) (-786.371) -- 0:00:06
891000 -- [-788.555] (-786.385) (-785.793) (-789.326) * (-787.265) (-789.734) [-788.746] (-786.454) -- 0:00:06
891500 -- (-790.338) (-787.848) [-786.319] (-789.186) * (-787.372) (-787.508) [-790.013] (-787.885) -- 0:00:06
892000 -- (-791.418) (-787.285) [-785.610] (-788.801) * [-790.283] (-791.739) (-786.814) (-785.617) -- 0:00:06
892500 -- (-789.044) (-787.874) [-786.597] (-791.736) * (-789.701) (-787.834) (-788.262) [-787.078] -- 0:00:06
893000 -- [-787.110] (-786.679) (-787.192) (-787.991) * [-788.800] (-786.494) (-788.539) (-789.302) -- 0:00:06
893500 -- (-793.942) [-787.635] (-788.667) (-791.171) * (-790.638) [-785.525] (-787.671) (-790.522) -- 0:00:06
894000 -- (-789.051) [-790.215] (-787.937) (-785.495) * (-788.489) (-790.014) [-786.380] (-789.898) -- 0:00:06
894500 -- (-788.280) [-786.100] (-786.429) (-785.830) * [-787.374] (-788.043) (-786.678) (-787.542) -- 0:00:06
895000 -- (-788.989) (-786.392) [-787.205] (-786.772) * (-785.912) (-787.648) (-785.988) [-790.647] -- 0:00:06
Average standard deviation of split frequencies: 0.006033
895500 -- (-785.773) (-786.523) [-787.447] (-785.986) * (-789.072) (-792.399) (-786.791) [-791.453] -- 0:00:06
896000 -- (-787.736) (-790.230) [-787.634] (-787.213) * (-791.819) [-786.696] (-785.862) (-787.381) -- 0:00:06
896500 -- (-790.899) (-786.750) [-786.548] (-788.504) * (-786.774) [-787.471] (-785.863) (-787.566) -- 0:00:06
897000 -- (-791.033) (-786.597) [-790.134] (-789.938) * (-787.580) (-786.236) (-788.764) [-787.047] -- 0:00:06
897500 -- [-788.938] (-786.452) (-790.270) (-788.766) * (-789.115) (-790.835) [-789.133] (-790.098) -- 0:00:06
898000 -- (-787.379) [-786.387] (-789.886) (-789.807) * (-788.258) (-788.369) (-786.075) [-786.619] -- 0:00:06
898500 -- (-786.588) [-789.729] (-787.368) (-789.668) * (-787.897) (-787.872) (-791.526) [-786.651] -- 0:00:06
899000 -- (-786.727) [-787.598] (-788.669) (-789.799) * (-787.098) (-789.022) (-786.223) [-789.270] -- 0:00:06
899500 -- (-786.555) (-787.190) (-785.819) [-786.241] * (-789.876) (-787.654) [-786.295] (-787.034) -- 0:00:06
900000 -- (-785.897) (-788.233) [-787.750] (-789.903) * [-788.354] (-788.037) (-787.320) (-787.808) -- 0:00:06
Average standard deviation of split frequencies: 0.006106
900500 -- (-785.797) (-787.277) (-790.429) [-787.551] * (-786.664) (-787.644) (-789.355) [-787.039] -- 0:00:05
901000 -- [-785.975] (-787.945) (-793.561) (-786.706) * (-787.554) (-788.853) [-788.663] (-786.866) -- 0:00:05
901500 -- (-788.007) (-788.147) [-787.358] (-788.012) * [-785.966] (-788.887) (-787.748) (-787.564) -- 0:00:05
902000 -- (-788.298) (-791.552) [-789.011] (-788.930) * (-785.447) (-787.326) [-787.318] (-788.054) -- 0:00:05
902500 -- (-786.741) [-786.849] (-790.523) (-787.931) * [-787.775] (-787.024) (-786.623) (-794.807) -- 0:00:05
903000 -- (-786.258) (-788.855) (-787.716) [-787.079] * (-788.219) (-786.278) [-786.795] (-787.122) -- 0:00:05
903500 -- (-789.432) (-790.584) (-787.177) [-788.709] * (-789.435) [-786.897] (-787.833) (-790.076) -- 0:00:05
904000 -- [-797.043] (-786.909) (-786.621) (-787.247) * (-791.530) (-789.968) (-786.542) [-787.890] -- 0:00:05
904500 -- [-786.674] (-787.274) (-790.098) (-791.875) * [-789.628] (-787.168) (-786.084) (-789.722) -- 0:00:05
905000 -- [-787.875] (-787.570) (-786.522) (-789.464) * (-786.588) [-785.754] (-787.835) (-786.813) -- 0:00:05
Average standard deviation of split frequencies: 0.006244
905500 -- (-786.975) (-787.190) [-786.551] (-787.937) * (-789.482) [-786.215] (-787.484) (-788.394) -- 0:00:05
906000 -- (-786.843) (-789.925) [-788.881] (-787.020) * [-785.994] (-786.517) (-787.540) (-787.764) -- 0:00:05
906500 -- [-787.000] (-792.076) (-789.087) (-788.966) * (-788.011) (-787.115) [-786.990] (-787.689) -- 0:00:05
907000 -- [-787.505] (-790.476) (-790.748) (-788.481) * (-787.088) (-788.843) (-785.608) [-787.915] -- 0:00:05
907500 -- [-788.208] (-793.308) (-793.262) (-786.919) * (-787.117) (-785.923) [-790.503] (-788.594) -- 0:00:05
908000 -- (-788.628) (-787.035) [-786.551] (-787.954) * (-788.473) (-787.434) [-790.308] (-787.778) -- 0:00:05
908500 -- (-788.814) [-786.336] (-788.040) (-789.183) * [-786.588] (-785.589) (-789.004) (-789.674) -- 0:00:05
909000 -- [-786.597] (-792.343) (-786.337) (-789.915) * (-787.305) (-788.349) [-787.131] (-787.308) -- 0:00:05
909500 -- (-787.772) [-789.684] (-785.575) (-788.315) * (-794.089) (-788.091) (-787.256) [-785.932] -- 0:00:05
910000 -- [-790.792] (-789.227) (-786.986) (-787.791) * (-797.649) (-790.445) [-785.743] (-789.592) -- 0:00:05
Average standard deviation of split frequencies: 0.006108
910500 -- [-793.826] (-785.681) (-786.877) (-789.853) * (-787.736) (-788.686) [-788.769] (-789.617) -- 0:00:05
911000 -- (-786.364) (-787.435) [-789.762] (-785.745) * (-786.817) [-788.705] (-794.007) (-786.884) -- 0:00:05
911500 -- (-786.340) (-785.884) (-785.967) [-787.023] * (-786.538) [-787.120] (-788.733) (-788.691) -- 0:00:05
912000 -- (-790.000) (-785.848) [-786.902] (-790.234) * (-786.667) (-788.101) (-786.878) [-786.423] -- 0:00:05
912500 -- (-788.019) (-790.967) [-789.325] (-791.880) * (-787.991) (-786.590) (-786.658) [-785.891] -- 0:00:05
913000 -- [-789.510] (-787.020) (-788.930) (-788.953) * (-786.879) (-789.874) (-787.561) [-789.169] -- 0:00:05
913500 -- (-787.535) (-785.953) (-790.950) [-789.577] * (-787.953) [-790.711] (-786.558) (-788.703) -- 0:00:05
914000 -- (-787.148) [-787.417] (-786.190) (-788.660) * (-788.142) (-790.971) (-789.958) [-786.999] -- 0:00:05
914500 -- (-786.100) [-785.760] (-786.580) (-788.371) * (-787.526) (-788.217) [-786.280] (-789.180) -- 0:00:05
915000 -- (-785.910) (-788.099) [-786.948] (-787.944) * [-787.664] (-787.758) (-785.821) (-786.627) -- 0:00:05
Average standard deviation of split frequencies: 0.005901
915500 -- (-788.606) (-789.603) [-790.172] (-789.356) * (-788.940) (-788.171) (-786.195) [-786.413] -- 0:00:05
916000 -- (-791.228) (-790.905) [-786.755] (-786.338) * (-787.868) (-786.605) (-785.592) [-787.513] -- 0:00:05
916500 -- (-790.096) [-785.914] (-788.040) (-791.636) * (-788.769) (-790.446) (-789.465) [-785.970] -- 0:00:05
917000 -- (-787.781) (-785.997) (-787.808) [-787.892] * (-786.186) [-790.123] (-786.977) (-789.853) -- 0:00:04
917500 -- (-788.429) (-789.416) [-787.291] (-792.055) * (-786.935) (-786.656) [-787.841] (-793.833) -- 0:00:04
918000 -- (-786.344) (-785.450) [-789.134] (-785.648) * [-787.916] (-790.613) (-788.810) (-787.005) -- 0:00:04
918500 -- (-787.180) [-786.871] (-788.119) (-785.854) * [-787.784] (-790.951) (-787.438) (-787.368) -- 0:00:04
919000 -- (-788.227) (-788.981) [-787.492] (-785.908) * (-788.742) [-787.885] (-789.523) (-786.539) -- 0:00:04
919500 -- (-786.810) (-788.801) [-786.407] (-791.653) * [-792.089] (-788.495) (-788.762) (-788.301) -- 0:00:04
920000 -- [-788.304] (-786.867) (-788.473) (-791.093) * (-788.619) (-790.965) (-787.065) [-786.930] -- 0:00:04
Average standard deviation of split frequencies: 0.006486
920500 -- [-787.137] (-787.294) (-788.383) (-790.462) * (-789.984) [-785.718] (-786.256) (-787.565) -- 0:00:04
921000 -- (-787.491) (-785.748) [-785.779] (-787.456) * (-787.273) [-786.485] (-786.478) (-794.289) -- 0:00:04
921500 -- [-787.424] (-785.805) (-786.444) (-787.606) * [-786.832] (-787.855) (-787.107) (-795.281) -- 0:00:04
922000 -- (-786.922) (-786.166) [-788.030] (-786.430) * [-788.152] (-787.611) (-786.704) (-789.451) -- 0:00:04
922500 -- [-791.639] (-787.762) (-786.867) (-786.750) * (-795.619) (-788.368) (-791.339) [-786.755] -- 0:00:04
923000 -- (-786.349) (-787.746) [-786.289] (-794.352) * [-789.180] (-792.769) (-786.053) (-788.662) -- 0:00:04
923500 -- (-786.307) (-789.305) [-786.294] (-788.078) * [-787.748] (-790.878) (-786.023) (-794.975) -- 0:00:04
924000 -- (-786.490) [-787.099] (-787.292) (-793.794) * (-787.502) [-786.819] (-787.620) (-790.023) -- 0:00:04
924500 -- (-787.204) [-785.857] (-789.890) (-791.486) * (-786.138) (-789.401) [-787.643] (-787.421) -- 0:00:04
925000 -- (-790.370) (-786.041) (-786.995) [-788.963] * [-786.250] (-787.124) (-792.325) (-786.687) -- 0:00:04
Average standard deviation of split frequencies: 0.006720
925500 -- [-790.987] (-787.734) (-785.560) (-788.307) * (-790.320) (-785.907) [-789.375] (-786.143) -- 0:00:04
926000 -- (-787.723) (-786.774) [-785.578] (-789.509) * (-787.438) (-789.074) (-787.736) [-790.660] -- 0:00:04
926500 -- (-787.903) (-788.314) [-787.677] (-787.026) * (-787.800) (-786.408) (-788.597) [-787.800] -- 0:00:04
927000 -- (-789.061) (-788.209) [-789.205] (-788.804) * (-788.593) [-788.013] (-788.449) (-786.435) -- 0:00:04
927500 -- (-788.793) (-791.196) (-790.262) [-788.481] * (-786.572) [-786.499] (-790.407) (-786.570) -- 0:00:04
928000 -- (-791.442) [-790.048] (-786.625) (-792.170) * (-787.868) [-788.723] (-789.352) (-785.604) -- 0:00:04
928500 -- [-788.532] (-786.272) (-788.525) (-787.062) * [-788.225] (-792.417) (-789.139) (-786.520) -- 0:00:04
929000 -- [-786.950] (-787.338) (-788.316) (-789.536) * (-786.145) [-793.620] (-787.557) (-786.959) -- 0:00:04
929500 -- (-791.255) (-786.435) (-788.905) [-785.469] * (-787.269) (-790.179) [-787.524] (-789.303) -- 0:00:04
930000 -- (-787.298) [-786.238] (-789.652) (-790.177) * (-788.259) (-789.418) (-787.100) [-785.824] -- 0:00:04
Average standard deviation of split frequencies: 0.006990
930500 -- (-788.000) [-785.773] (-790.490) (-789.822) * (-786.508) (-788.224) (-787.671) [-785.653] -- 0:00:04
931000 -- (-795.614) (-786.773) (-792.827) [-792.994] * (-792.406) (-787.903) (-785.786) [-787.220] -- 0:00:04
931500 -- [-792.273] (-786.632) (-785.812) (-789.553) * [-786.699] (-793.906) (-788.705) (-787.192) -- 0:00:04
932000 -- (-786.469) [-785.706] (-788.580) (-786.282) * [-786.781] (-790.176) (-787.538) (-787.002) -- 0:00:04
932500 -- (-786.623) (-787.223) [-786.018] (-785.724) * (-788.949) (-790.130) [-787.440] (-791.125) -- 0:00:04
933000 -- (-786.815) (-787.899) (-786.808) [-787.079] * (-788.733) (-794.277) [-789.420] (-792.517) -- 0:00:04
933500 -- (-792.082) (-787.420) [-788.850] (-789.296) * (-792.210) [-787.708] (-787.981) (-788.781) -- 0:00:03
934000 -- (-791.264) (-790.099) [-786.178] (-789.960) * [-787.260] (-786.952) (-787.353) (-788.626) -- 0:00:03
934500 -- [-789.006] (-789.414) (-788.205) (-792.077) * (-787.523) (-785.789) [-787.987] (-795.249) -- 0:00:03
935000 -- (-787.629) (-787.413) [-789.307] (-788.529) * (-787.048) [-786.425] (-785.872) (-789.240) -- 0:00:03
Average standard deviation of split frequencies: 0.006379
935500 -- (-788.450) [-788.096] (-790.390) (-788.428) * (-785.744) (-785.921) [-785.896] (-785.986) -- 0:00:03
936000 -- (-788.186) [-788.862] (-787.530) (-788.302) * [-786.900] (-787.110) (-786.282) (-791.967) -- 0:00:03
936500 -- [-785.788] (-791.516) (-787.486) (-787.206) * (-787.372) (-791.071) [-787.759] (-789.706) -- 0:00:03
937000 -- (-788.879) [-790.865] (-788.373) (-786.068) * [-789.057] (-786.243) (-788.113) (-787.439) -- 0:00:03
937500 -- (-793.278) [-786.000] (-787.695) (-787.398) * [-790.484] (-787.066) (-787.618) (-787.202) -- 0:00:03
938000 -- [-792.232] (-787.347) (-788.013) (-790.650) * [-789.619] (-787.650) (-790.088) (-787.819) -- 0:00:03
938500 -- (-786.923) [-788.479] (-788.894) (-788.694) * (-787.494) (-791.772) (-788.397) [-786.952] -- 0:00:03
939000 -- [-787.001] (-785.528) (-790.173) (-787.494) * [-786.115] (-791.125) (-787.459) (-789.990) -- 0:00:03
939500 -- (-786.638) (-787.066) (-788.574) [-786.234] * (-791.734) (-786.633) [-785.771] (-785.682) -- 0:00:03
940000 -- (-786.714) [-789.303] (-788.387) (-785.877) * (-788.462) [-789.688] (-786.044) (-787.132) -- 0:00:03
Average standard deviation of split frequencies: 0.006515
940500 -- (-792.592) (-786.798) (-790.053) [-792.501] * (-787.781) [-786.096] (-791.995) (-789.680) -- 0:00:03
941000 -- (-786.861) (-795.305) (-789.680) [-790.087] * (-786.095) (-785.545) [-787.968] (-788.516) -- 0:00:03
941500 -- (-789.309) (-788.910) [-787.986] (-786.732) * [-787.680] (-786.426) (-788.762) (-791.387) -- 0:00:03
942000 -- [-789.375] (-786.167) (-788.465) (-786.660) * (-788.862) [-787.255] (-791.941) (-790.335) -- 0:00:03
942500 -- (-792.156) [-786.198] (-788.613) (-785.481) * (-787.517) (-790.176) (-788.882) [-786.687] -- 0:00:03
943000 -- [-787.799] (-786.238) (-791.986) (-787.295) * [-785.977] (-788.337) (-791.817) (-786.628) -- 0:00:03
943500 -- (-793.864) (-786.628) (-787.214) [-785.883] * (-785.906) [-788.645] (-786.224) (-793.388) -- 0:00:03
944000 -- (-790.269) [-789.781] (-789.003) (-790.084) * [-787.753] (-788.968) (-786.077) (-786.905) -- 0:00:03
944500 -- [-786.435] (-787.588) (-790.138) (-792.175) * (-786.826) (-787.900) (-786.393) [-787.035] -- 0:00:03
945000 -- (-786.102) (-788.573) [-786.223] (-790.027) * [-789.766] (-786.973) (-786.176) (-787.358) -- 0:00:03
Average standard deviation of split frequencies: 0.006644
945500 -- (-786.684) [-788.834] (-786.979) (-786.708) * (-787.293) [-788.121] (-788.136) (-789.105) -- 0:00:03
946000 -- (-788.038) (-790.265) (-786.099) [-787.446] * (-788.677) (-789.681) (-786.388) [-789.016] -- 0:00:03
946500 -- (-785.896) (-790.896) (-785.827) [-785.664] * (-786.307) (-788.552) [-788.025] (-786.273) -- 0:00:03
947000 -- (-791.357) [-789.335] (-787.960) (-785.604) * (-786.784) (-786.475) [-787.428] (-787.877) -- 0:00:03
947500 -- (-790.980) (-796.350) (-790.314) [-786.634] * (-788.228) [-786.487] (-786.410) (-790.685) -- 0:00:03
948000 -- (-788.934) (-786.660) [-786.189] (-790.083) * [-788.085] (-787.008) (-786.094) (-787.299) -- 0:00:03
948500 -- (-785.675) [-790.062] (-788.870) (-788.055) * (-787.741) [-786.504] (-792.666) (-787.361) -- 0:00:03
949000 -- (-791.214) (-788.586) [-789.596] (-786.162) * (-789.396) (-787.500) (-790.885) [-786.890] -- 0:00:03
949500 -- [-789.593] (-785.853) (-789.973) (-791.019) * (-797.022) (-788.942) (-788.161) [-788.623] -- 0:00:03
950000 -- (-786.613) (-788.587) [-789.156] (-792.271) * (-792.730) (-786.805) [-785.932] (-786.462) -- 0:00:03
Average standard deviation of split frequencies: 0.006810
950500 -- (-788.076) (-786.343) [-787.456] (-785.713) * (-793.552) (-787.930) (-786.400) [-788.668] -- 0:00:02
951000 -- (-787.799) (-791.364) (-786.471) [-790.377] * [-787.999] (-790.835) (-788.117) (-787.763) -- 0:00:02
951500 -- [-786.045] (-788.886) (-786.750) (-789.265) * (-787.834) (-788.234) (-789.838) [-787.792] -- 0:00:02
952000 -- [-786.918] (-786.923) (-787.951) (-790.115) * (-787.866) [-789.228] (-789.224) (-789.897) -- 0:00:02
952500 -- (-785.954) [-786.768] (-787.248) (-789.191) * (-789.031) (-789.096) (-787.981) [-793.959] -- 0:00:02
953000 -- (-786.208) [-786.960] (-788.515) (-786.699) * (-788.652) (-790.472) (-789.384) [-790.192] -- 0:00:02
953500 -- (-788.361) (-789.176) (-787.015) [-786.679] * (-788.087) (-788.321) [-785.796] (-789.230) -- 0:00:02
954000 -- (-788.570) (-788.991) (-789.689) [-789.281] * (-785.805) (-788.124) (-789.941) [-787.757] -- 0:00:02
954500 -- (-788.337) [-787.358] (-786.516) (-787.889) * (-786.339) (-788.771) [-788.258] (-786.739) -- 0:00:02
955000 -- (-790.074) (-787.358) [-787.319] (-787.649) * [-790.037] (-788.460) (-787.224) (-786.505) -- 0:00:02
Average standard deviation of split frequencies: 0.006805
955500 -- [-788.811] (-789.011) (-788.657) (-788.514) * [-791.377] (-788.849) (-787.794) (-787.555) -- 0:00:02
956000 -- (-788.492) [-786.201] (-786.043) (-794.033) * [-785.873] (-786.474) (-788.442) (-790.096) -- 0:00:02
956500 -- (-787.572) (-785.985) (-788.674) [-786.612] * [-787.505] (-787.066) (-787.442) (-789.232) -- 0:00:02
957000 -- [-786.870] (-787.646) (-788.910) (-787.593) * (-787.534) (-786.131) [-790.171] (-788.944) -- 0:00:02
957500 -- (-787.511) [-787.967] (-794.756) (-786.650) * [-788.338] (-787.158) (-789.996) (-788.863) -- 0:00:02
958000 -- (-785.636) (-787.993) [-788.570] (-788.443) * [-786.686] (-788.523) (-787.656) (-788.382) -- 0:00:02
958500 -- (-785.929) [-787.129] (-789.290) (-788.190) * (-787.765) (-786.987) [-789.087] (-786.146) -- 0:00:02
959000 -- (-786.172) (-789.997) [-788.179] (-788.207) * [-786.876] (-785.765) (-787.479) (-787.493) -- 0:00:02
959500 -- [-786.138] (-788.698) (-788.837) (-788.410) * (-788.881) (-785.832) (-789.268) [-786.444] -- 0:00:02
960000 -- [-786.232] (-786.314) (-788.623) (-787.619) * [-787.744] (-787.333) (-789.259) (-788.678) -- 0:00:02
Average standard deviation of split frequencies: 0.006870
960500 -- (-787.887) [-790.022] (-789.188) (-787.665) * [-788.187] (-787.200) (-789.640) (-788.222) -- 0:00:02
961000 -- (-789.173) (-789.227) (-793.106) [-790.133] * (-787.224) (-791.093) [-787.888] (-789.390) -- 0:00:02
961500 -- (-785.778) (-792.752) (-793.142) [-790.586] * (-788.907) (-791.548) (-786.732) [-785.695] -- 0:00:02
962000 -- (-786.798) [-787.438] (-786.035) (-790.507) * [-790.891] (-793.992) (-789.277) (-789.538) -- 0:00:02
962500 -- (-788.132) [-786.030] (-786.855) (-790.888) * (-790.523) (-789.386) [-787.026] (-788.270) -- 0:00:02
963000 -- (-786.074) (-786.566) (-787.869) [-787.488] * (-788.739) (-789.160) (-786.253) [-786.576] -- 0:00:02
963500 -- (-785.778) [-787.967] (-787.757) (-786.138) * (-786.951) (-786.688) (-787.331) [-786.346] -- 0:00:02
964000 -- (-787.094) (-790.888) [-788.290] (-786.967) * (-787.276) [-786.517] (-788.222) (-787.592) -- 0:00:02
964500 -- [-786.818] (-788.657) (-787.945) (-793.042) * (-789.752) [-785.523] (-790.764) (-787.916) -- 0:00:02
965000 -- (-787.143) (-790.965) [-787.292] (-788.395) * (-788.435) [-786.791] (-790.294) (-787.079) -- 0:00:02
Average standard deviation of split frequencies: 0.006864
965500 -- (-785.807) (-791.465) [-786.539] (-786.892) * (-786.024) (-785.712) (-787.843) [-787.138] -- 0:00:02
966000 -- (-785.820) [-789.375] (-787.002) (-786.212) * (-786.834) (-789.474) (-788.341) [-789.783] -- 0:00:02
966500 -- (-788.167) (-787.964) (-788.626) [-786.873] * [-788.164] (-787.226) (-786.686) (-786.836) -- 0:00:02
967000 -- [-787.426] (-786.266) (-786.689) (-790.258) * (-789.704) (-786.936) [-787.688] (-786.606) -- 0:00:01
967500 -- [-786.470] (-787.228) (-788.034) (-791.238) * (-786.791) (-789.208) [-786.862] (-788.025) -- 0:00:01
968000 -- [-790.512] (-789.005) (-791.112) (-789.390) * (-786.119) (-789.556) [-789.322] (-790.744) -- 0:00:01
968500 -- [-789.098] (-788.086) (-787.834) (-788.144) * (-785.994) (-790.763) [-788.111] (-785.818) -- 0:00:01
969000 -- (-787.699) [-790.529] (-788.854) (-791.832) * (-787.752) (-790.998) (-790.503) [-790.332] -- 0:00:01
969500 -- (-790.594) (-795.946) (-786.013) [-786.709] * (-788.897) [-786.240] (-791.049) (-788.465) -- 0:00:01
970000 -- (-788.715) [-788.622] (-786.846) (-788.472) * (-791.499) [-786.485] (-790.727) (-789.036) -- 0:00:01
Average standard deviation of split frequencies: 0.006216
970500 -- (-786.706) (-787.863) [-789.315] (-790.226) * [-786.160] (-792.687) (-788.733) (-788.844) -- 0:00:01
971000 -- (-787.817) (-786.764) [-788.410] (-789.498) * (-789.170) (-786.324) (-788.135) [-789.334] -- 0:00:01
971500 -- (-788.073) (-786.993) (-788.928) [-789.585] * (-787.586) (-785.708) [-790.141] (-789.407) -- 0:00:01
972000 -- (-785.913) [-789.831] (-789.837) (-787.996) * (-787.751) [-787.978] (-788.691) (-786.798) -- 0:00:01
972500 -- (-788.703) [-789.228] (-786.987) (-787.567) * (-786.689) [-786.603] (-787.092) (-787.253) -- 0:00:01
973000 -- (-790.276) (-789.650) (-792.829) [-789.946] * (-786.154) (-787.899) [-786.590] (-786.121) -- 0:00:01
973500 -- (-786.142) (-789.575) [-787.544] (-790.075) * [-786.535] (-786.911) (-785.701) (-786.094) -- 0:00:01
974000 -- (-786.636) (-793.153) (-794.201) [-788.096] * (-786.720) (-786.553) [-786.484] (-789.025) -- 0:00:01
974500 -- (-789.173) (-788.475) [-788.214] (-785.610) * (-786.158) [-786.200] (-787.868) (-787.110) -- 0:00:01
975000 -- (-786.987) [-789.205] (-787.618) (-788.640) * (-788.222) (-788.133) (-787.558) [-789.121] -- 0:00:01
Average standard deviation of split frequencies: 0.005893
975500 -- [-787.462] (-791.619) (-789.696) (-787.896) * [-786.772] (-787.597) (-794.164) (-789.922) -- 0:00:01
976000 -- [-787.997] (-791.548) (-786.453) (-792.424) * [-786.223] (-788.090) (-789.390) (-787.468) -- 0:00:01
976500 -- [-786.518] (-789.859) (-788.376) (-787.116) * (-787.108) (-789.744) [-788.516] (-786.710) -- 0:00:01
977000 -- (-788.788) (-786.508) (-788.207) [-786.130] * (-787.136) [-790.850] (-787.802) (-786.326) -- 0:00:01
977500 -- (-786.261) (-786.882) [-788.778] (-786.130) * (-786.975) (-791.216) [-787.995] (-789.525) -- 0:00:01
978000 -- (-788.437) (-787.234) (-795.678) [-786.707] * (-787.508) (-791.359) [-789.896] (-786.003) -- 0:00:01
978500 -- [-785.688] (-787.889) (-786.754) (-788.803) * (-789.806) (-787.785) (-787.851) [-791.050] -- 0:00:01
979000 -- (-786.189) [-789.628] (-788.561) (-789.770) * (-789.751) (-788.932) (-789.232) [-785.925] -- 0:00:01
979500 -- (-787.310) [-786.575] (-789.604) (-787.441) * (-789.562) (-788.389) (-786.719) [-786.176] -- 0:00:01
980000 -- (-789.469) (-786.885) [-786.680] (-790.150) * (-788.449) (-793.061) (-787.088) [-786.244] -- 0:00:01
Average standard deviation of split frequencies: 0.006185
980500 -- [-792.387] (-787.283) (-790.771) (-787.876) * (-787.395) [-786.653] (-786.759) (-786.252) -- 0:00:01
981000 -- (-788.115) (-790.814) [-792.442] (-790.323) * (-785.962) (-788.356) [-786.703] (-787.669) -- 0:00:01
981500 -- (-788.822) (-790.245) (-787.148) [-786.901] * (-788.239) [-788.237] (-786.257) (-786.386) -- 0:00:01
982000 -- (-787.095) (-790.672) [-787.047] (-786.495) * [-787.632] (-789.678) (-792.775) (-791.316) -- 0:00:01
982500 -- (-787.002) (-788.446) (-786.288) [-788.030] * (-786.546) (-790.364) [-788.650] (-792.594) -- 0:00:01
983000 -- (-787.698) [-786.436] (-786.174) (-791.525) * [-786.674] (-792.073) (-788.803) (-787.275) -- 0:00:01
983500 -- (-787.126) (-786.559) (-788.041) [-792.158] * (-789.909) [-786.037] (-789.438) (-787.040) -- 0:00:00
984000 -- (-786.726) [-786.726] (-787.620) (-789.435) * (-788.482) (-791.498) [-790.523] (-786.172) -- 0:00:00
984500 -- (-787.638) (-788.284) (-788.300) [-786.577] * [-788.027] (-790.908) (-787.632) (-785.747) -- 0:00:00
985000 -- (-789.752) (-789.156) (-789.203) [-786.319] * (-786.378) (-792.914) [-789.351] (-786.861) -- 0:00:00
Average standard deviation of split frequencies: 0.006120
985500 -- (-789.712) [-787.389] (-789.098) (-786.195) * [-786.483] (-794.426) (-786.071) (-786.290) -- 0:00:00
986000 -- (-788.615) [-786.596] (-786.337) (-787.577) * (-787.108) (-786.904) [-786.473] (-790.311) -- 0:00:00
986500 -- (-791.649) (-789.114) [-787.628] (-786.091) * (-788.510) [-788.659] (-790.876) (-788.504) -- 0:00:00
987000 -- (-787.696) [-786.223] (-788.297) (-787.337) * (-790.211) [-787.405] (-789.285) (-788.548) -- 0:00:00
987500 -- (-790.091) [-785.768] (-787.443) (-787.857) * (-789.632) [-788.721] (-787.393) (-786.064) -- 0:00:00
988000 -- (-793.093) [-786.990] (-787.833) (-787.724) * [-787.468] (-787.696) (-787.767) (-785.574) -- 0:00:00
988500 -- (-786.100) [-787.059] (-792.542) (-786.030) * (-787.759) (-787.532) [-789.735] (-786.793) -- 0:00:00
989000 -- (-786.868) (-786.916) [-791.213] (-786.532) * (-789.260) [-787.635] (-788.230) (-788.473) -- 0:00:00
989500 -- [-788.800] (-792.607) (-790.443) (-786.251) * [-786.153] (-788.775) (-788.694) (-787.599) -- 0:00:00
990000 -- [-786.210] (-787.132) (-786.415) (-794.750) * (-787.105) (-787.148) (-787.355) [-786.605] -- 0:00:00
Average standard deviation of split frequencies: 0.006503
990500 -- [-789.045] (-786.579) (-789.613) (-786.078) * (-788.580) [-788.693] (-789.356) (-785.813) -- 0:00:00
991000 -- (-788.477) [-786.042] (-787.597) (-785.664) * (-788.595) (-786.784) (-786.595) [-787.659] -- 0:00:00
991500 -- (-788.106) (-788.535) [-789.602] (-788.424) * (-788.770) (-786.139) [-787.754] (-790.872) -- 0:00:00
992000 -- [-789.442] (-787.986) (-789.393) (-793.117) * (-788.982) (-788.251) [-787.022] (-788.245) -- 0:00:00
992500 -- (-786.900) (-788.929) (-788.924) [-786.512] * (-787.497) [-788.219] (-787.477) (-788.667) -- 0:00:00
993000 -- [-787.022] (-789.636) (-786.666) (-787.234) * (-789.922) (-787.494) (-787.649) [-787.413] -- 0:00:00
993500 -- (-792.904) (-788.579) (-785.709) [-785.524] * (-792.959) (-788.507) [-788.039] (-788.233) -- 0:00:00
994000 -- [-789.054] (-788.207) (-788.602) (-785.684) * [-791.038] (-786.015) (-787.041) (-788.234) -- 0:00:00
994500 -- (-788.561) [-788.538] (-789.815) (-787.542) * (-791.510) (-787.270) (-786.653) [-788.444] -- 0:00:00
995000 -- (-786.583) [-787.266] (-790.574) (-787.435) * (-787.321) (-788.836) (-787.014) [-790.331] -- 0:00:00
Average standard deviation of split frequencies: 0.006374
995500 -- (-786.519) [-788.919] (-789.601) (-787.102) * (-789.593) (-786.906) [-789.580] (-787.021) -- 0:00:00
996000 -- (-787.523) [-785.333] (-786.373) (-794.766) * (-790.552) (-787.267) [-787.969] (-788.965) -- 0:00:00
996500 -- (-789.976) [-787.082] (-786.003) (-791.247) * (-787.128) (-788.277) [-787.657] (-789.035) -- 0:00:00
997000 -- (-790.328) (-789.790) [-786.127] (-790.524) * (-787.890) (-787.143) [-787.003] (-789.485) -- 0:00:00
997500 -- (-786.282) (-786.836) [-785.781] (-788.764) * (-790.352) [-788.026] (-787.500) (-788.036) -- 0:00:00
998000 -- (-794.569) (-792.470) (-786.092) [-787.820] * (-786.201) [-789.741] (-786.011) (-785.963) -- 0:00:00
998500 -- (-788.069) (-788.050) [-786.949] (-789.391) * (-786.711) (-788.406) [-786.465] (-789.557) -- 0:00:00
999000 -- (-786.960) [-787.910] (-789.364) (-790.767) * (-787.326) (-788.026) [-787.412] (-786.706) -- 0:00:00
999500 -- (-787.679) (-790.395) (-785.948) [-788.671] * (-787.935) (-788.766) (-788.411) [-789.651] -- 0:00:00
1000000 -- (-788.711) [-790.538] (-788.609) (-790.264) * (-789.446) [-788.672] (-790.744) (-785.567) -- 0:00:00
Average standard deviation of split frequencies: 0.006470
Analysis completed in 60 seconds
Analysis used 58.84 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -785.29
Likelihood of best state for "cold" chain of run 2 was -785.29
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.1 % ( 29 %) Dirichlet(Pi{all})
31.4 % ( 25 %) Slider(Pi{all})
78.2 % ( 49 %) Multiplier(Alpha{1,2})
77.3 % ( 48 %) Multiplier(Alpha{3})
21.4 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.2 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 62 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.0 % ( 28 %) Dirichlet(Pi{all})
31.3 % ( 28 %) Slider(Pi{all})
78.9 % ( 59 %) Multiplier(Alpha{1,2})
77.5 % ( 63 %) Multiplier(Alpha{3})
22.0 % ( 38 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.6 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166171 0.82 0.67
3 | 166542 167106 0.84
4 | 166780 166907 166494
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166759 0.82 0.67
3 | 166532 165724 0.84
4 | 166382 167236 167367
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -787.08
| 1 2 |
| 1 |
| 1 2 1 1 2 |
| 2 1 1 22 1 2 2 |
| 1 1 1 11 2 2 1 |
| 1 222 1 2 1 2 * 2 1 |
|1 2 ** 1 2 * ** 2 2 1 2 2 1|
| 1 2 * 12 2 1 1 1 2 1 1 |
| 1 2 2 1 2 1 1 2 1 22 2 2 |
|2 1 22 1 1 12 |
| 12 1 2 122 |
| 2 2 1 12 1 11 11 2|
| * 1 2 1 1 |
| 2 2 1 2 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -788.52
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -786.99 -790.70
2 -787.01 -790.27
--------------------------------------
TOTAL -787.00 -790.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902935 0.089619 0.375300 1.481279 0.873117 1231.75 1366.38 1.000
r(A<->C){all} 0.161411 0.020646 0.000053 0.453441 0.118866 88.29 155.71 1.000
r(A<->G){all} 0.168313 0.020815 0.000070 0.462889 0.130753 243.15 267.54 1.001
r(A<->T){all} 0.171221 0.020153 0.000133 0.446188 0.134815 245.89 260.06 1.008
r(C<->G){all} 0.170532 0.019831 0.000130 0.454825 0.136755 159.59 238.25 1.011
r(C<->T){all} 0.164816 0.018745 0.000036 0.441876 0.129772 288.52 294.51 1.002
r(G<->T){all} 0.163707 0.019142 0.000076 0.446530 0.128336 204.82 230.47 1.000
pi(A){all} 0.236539 0.000315 0.201919 0.270991 0.236609 1381.22 1441.11 1.002
pi(C){all} 0.368492 0.000400 0.331804 0.410661 0.367788 1461.13 1477.61 1.000
pi(G){all} 0.233863 0.000295 0.199498 0.267437 0.233546 1132.83 1233.42 1.000
pi(T){all} 0.161106 0.000225 0.131155 0.189134 0.160887 1333.50 1417.25 1.000
alpha{1,2} 0.418773 0.235490 0.000134 1.423934 0.243525 1333.85 1345.62 1.000
alpha{3} 0.454099 0.226179 0.000133 1.402378 0.298590 1110.85 1305.92 1.000
pinvar{all} 0.997268 0.000011 0.991167 0.999999 0.998338 1068.61 1279.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ...*.*
9 -- .***.*
10 -- .*...*
11 -- .****.
12 -- ...**.
13 -- ..*.*.
14 -- ..*..*
15 -- ....**
16 -- .**...
17 -- ..**..
18 -- .*..*.
19 -- ..****
20 -- .**.**
21 -- .*.*..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.008951 0.145903 0.158561 2
8 455 0.151566 0.016488 0.139907 0.163225 2
9 448 0.149234 0.000942 0.148568 0.149900 2
10 442 0.147235 0.005653 0.143238 0.151233 2
11 429 0.142905 0.008009 0.137242 0.148568 2
12 429 0.142905 0.001413 0.141905 0.143904 2
13 429 0.142905 0.006124 0.138574 0.147235 2
14 429 0.142905 0.005182 0.139241 0.146569 2
15 429 0.142905 0.018373 0.129913 0.155896 2
16 422 0.140573 0.004711 0.137242 0.143904 2
17 421 0.140240 0.007066 0.135243 0.145237 2
18 419 0.139574 0.005182 0.135909 0.143238 2
19 417 0.138907 0.001413 0.137908 0.139907 2
20 407 0.135576 0.004240 0.132578 0.138574 2
21 405 0.134910 0.003298 0.132578 0.137242 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099693 0.010656 0.000023 0.307808 0.066536 1.000 2
length{all}[2] 0.101026 0.009734 0.000008 0.298965 0.071741 1.000 2
length{all}[3] 0.099742 0.009804 0.000025 0.294069 0.071036 1.000 2
length{all}[4] 0.099225 0.009426 0.000049 0.295449 0.069358 1.000 2
length{all}[5] 0.098288 0.009427 0.000041 0.295041 0.068121 1.000 2
length{all}[6] 0.102378 0.010461 0.000003 0.306970 0.070705 1.000 2
length{all}[7] 0.097650 0.008474 0.000392 0.263079 0.075321 1.000 2
length{all}[8] 0.102497 0.010256 0.000024 0.300259 0.071022 0.998 2
length{all}[9] 0.104329 0.009908 0.000008 0.306814 0.076535 0.999 2
length{all}[10] 0.098681 0.009644 0.000261 0.298106 0.071553 0.998 2
length{all}[11] 0.095783 0.009077 0.000141 0.303603 0.061235 0.998 2
length{all}[12] 0.102139 0.009264 0.000262 0.295884 0.070788 0.998 2
length{all}[13] 0.098431 0.009846 0.000123 0.326487 0.066978 0.998 2
length{all}[14] 0.104827 0.011136 0.000301 0.312122 0.069028 1.002 2
length{all}[15] 0.096013 0.008738 0.000004 0.267018 0.069405 1.005 2
length{all}[16] 0.104200 0.010519 0.000022 0.329854 0.071426 1.002 2
length{all}[17] 0.103178 0.009716 0.000454 0.298005 0.075031 1.000 2
length{all}[18] 0.095172 0.010288 0.000368 0.303968 0.065093 1.004 2
length{all}[19] 0.097253 0.009003 0.000108 0.306432 0.067354 0.998 2
length{all}[20] 0.094595 0.008554 0.000087 0.270597 0.069723 0.999 2
length{all}[21] 0.101103 0.011772 0.000042 0.325026 0.068397 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006470
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 585
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 195 / 195 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 195 / 195 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069271 0.097351 0.081142 0.041538 0.011186 0.012325 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -812.830453
Iterating by ming2
Initial: fx= 812.830453
x= 0.06927 0.09735 0.08114 0.04154 0.01119 0.01233 0.30000 1.30000
1 h-m-p 0.0000 0.0001 464.4679 ++ 800.194957 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0002 89.0469 ++ 799.520141 m 0.0002 24 | 2/8
3 h-m-p 0.0000 0.0001 3603.6295 ++ 793.416736 m 0.0001 35 | 3/8
4 h-m-p 0.0000 0.0000 71387.9297 ++ 792.937250 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0003 1157.6224 +++ 788.766674 m 0.0003 58 | 5/8
6 h-m-p 0.0001 0.0005 978.1186 ++ 774.280794 m 0.0005 69 | 6/8
7 h-m-p 0.0160 8.0000 33.8317 -------------.. | 6/8
8 h-m-p 0.0000 0.0006 185.7731 +++ 753.341719 m 0.0006 103 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 753.341719 m 8.0000 114 | 7/8
10 h-m-p 0.0160 8.0000 0.0002 +++++ 753.341719 m 8.0000 129 | 7/8
11 h-m-p 0.0160 8.0000 0.8054 +++++ 753.341667 m 8.0000 144 | 7/8
12 h-m-p 1.6000 8.0000 0.3038 ++ 753.341664 m 8.0000 156 | 7/8
13 h-m-p 0.6827 8.0000 3.5600 ++ 753.341656 m 8.0000 168 | 7/8
14 h-m-p 1.6000 8.0000 1.5187 ++ 753.341656 m 8.0000 179 | 7/8
15 h-m-p 1.6000 8.0000 1.2861 ++ 753.341655 m 8.0000 190 | 7/8
16 h-m-p 1.6000 8.0000 4.6803 ----------Y 753.341655 0 0.0000 211 | 7/8
17 h-m-p 0.9000 8.0000 0.0000 -------C 753.341655 0 0.0000 229 | 7/8
18 h-m-p 1.6000 8.0000 0.0000 -----N 753.341655 0 0.0004 246
Out..
lnL = -753.341655
247 lfun, 247 eigenQcodon, 1482 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025200 0.077199 0.058353 0.072486 0.066759 0.030580 0.000100 0.603252 0.448383
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.724418
np = 9
lnL0 = -815.746890
Iterating by ming2
Initial: fx= 815.746890
x= 0.02520 0.07720 0.05835 0.07249 0.06676 0.03058 0.00011 0.60325 0.44838
1 h-m-p 0.0000 0.0000 453.9212 ++ 814.684659 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0009 188.9875 ++++ 786.829017 m 0.0009 28 | 2/9
3 h-m-p 0.0000 0.0000 403.3882 ++ 782.822038 m 0.0000 40 | 3/9
4 h-m-p 0.0001 0.0009 284.0692 +++ 758.400029 m 0.0009 53 | 4/9
5 h-m-p 0.0000 0.0000 922.0507 ++ 757.850132 m 0.0000 65 | 4/9
6 h-m-p 0.0005 0.0025 14.2325 -----------.. | 4/9
7 h-m-p 0.0000 0.0000 332.1353 ++ 755.324038 m 0.0000 98 | 5/9
8 h-m-p 0.0000 0.0000 9.0073 ----.. | 5/9
9 h-m-p 0.0000 0.0000 273.1832 ++ 753.921653 m 0.0000 124 | 6/9
10 h-m-p 0.0003 0.0603 11.0083 ----------.. | 6/9
11 h-m-p 0.0000 0.0000 194.0113 ++ 753.341806 m 0.0000 156 | 7/9
12 h-m-p 0.0404 8.0000 0.0000 ++++ 753.341806 m 8.0000 170 | 7/9
13 h-m-p 0.0433 8.0000 0.0020 ++++ 753.341805 m 8.0000 186 | 7/9
14 h-m-p 0.0421 0.2106 0.0754 -----------Y 753.341805 0 0.0000 211 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 C 753.341805 0 0.0160 225 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 753.341805 m 8.0000 242 | 7/9
17 h-m-p 0.0010 0.1406 0.1132 ----------N 753.341805 0 0.0000 266 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 N 753.341805 0 0.0160 280 | 7/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 753.341805 m 8.0000 297 | 7/9
20 h-m-p 0.0002 0.0741 0.2087 ------Y 753.341805 0 0.0000 317 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 753.341805 m 8.0000 334 | 7/9
22 h-m-p 0.0015 0.0862 0.1826 --------C 753.341805 0 0.0000 356 | 7/9
23 h-m-p 0.0160 8.0000 0.0000 --------Y 753.341805 0 0.0000 378 | 7/9
24 h-m-p 0.0160 8.0000 0.0000 C 753.341805 0 0.0040 392
Out..
lnL = -753.341805
393 lfun, 1179 eigenQcodon, 4716 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103243 0.014514 0.105991 0.081790 0.103999 0.027763 0.000100 1.598036 0.358410 0.176079 71.063443
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 1.074681
np = 11
lnL0 = -784.161257
Iterating by ming2
Initial: fx= 784.161257
x= 0.10324 0.01451 0.10599 0.08179 0.10400 0.02776 0.00011 1.59804 0.35841 0.17608 71.06344
1 h-m-p 0.0000 0.0000 67.5385 ++ 784.137149 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0142 22.8435 +++++ 777.759492 m 0.0142 33 | 2/11
3 h-m-p 0.0017 0.0084 29.9037 ++ 772.805421 m 0.0084 47 | 3/11
4 h-m-p 0.0093 0.0467 12.9672 ++ 763.525688 m 0.0467 61 | 4/11
5 h-m-p 0.0000 0.0001 1280.7250 ++ 762.513425 m 0.0001 75 | 5/11
6 h-m-p 0.0001 0.0003 596.2067 ++ 761.020363 m 0.0003 89 | 6/11
7 h-m-p 0.0000 0.0000 35336.4722 ++ 753.789995 m 0.0000 103 | 7/11
8 h-m-p 0.0000 0.0000 8352.6332 ++ 753.341699 m 0.0000 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0007 ++ 753.341699 m 8.0000 131 | 8/11
10 h-m-p 0.0160 8.0000 0.5180 +++++ 753.341664 m 8.0000 151 | 8/11
11 h-m-p 1.6000 8.0000 0.3394 C 753.341663 0 1.9536 168 | 8/11
12 h-m-p 1.6000 8.0000 0.0486 Y 753.341663 0 0.9619 185 | 8/11
13 h-m-p 1.6000 8.0000 0.0001 ++ 753.341663 m 8.0000 202 | 8/11
14 h-m-p 0.0281 8.0000 0.0193 +++C 753.341663 0 1.9439 222 | 8/11
15 h-m-p 1.6000 8.0000 0.0006 ++ 753.341663 m 8.0000 239 | 8/11
16 h-m-p 0.0160 8.0000 1.1492 +++++ 753.341655 m 8.0000 259 | 8/11
17 h-m-p 1.6000 8.0000 0.2543 ++ 753.341655 m 8.0000 273 | 8/11
18 h-m-p 1.6000 8.0000 0.2100 ++ 753.341655 m 8.0000 290 | 8/11
19 h-m-p 0.8261 8.0000 2.0339 ++ 753.341655 m 8.0000 307 | 8/11
20 h-m-p 1.6000 8.0000 7.6756 ++ 753.341655 m 8.0000 321 | 8/11
21 h-m-p 0.0597 0.2985 111.8870 ++ 753.341655 m 0.2985 335 | 8/11
22 h-m-p -0.0000 -0.0000 54.4335
h-m-p: -0.00000000e+00 -0.00000000e+00 5.44334550e+01 753.341655
.. | 8/11
23 h-m-p 0.0160 8.0000 0.0000 Y 753.341655 0 0.0079 360 | 8/11
24 h-m-p 0.5765 8.0000 0.0000 ------Y 753.341655 0 0.0000 383
Out..
lnL = -753.341655
384 lfun, 1536 eigenQcodon, 6912 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -753.337271 S = -753.337157 -0.000044
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:04
did 20 / 52 patterns 0:04
did 30 / 52 patterns 0:04
did 40 / 52 patterns 0:04
did 50 / 52 patterns 0:04
did 52 / 52 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.012288 0.025978 0.102642 0.028472 0.052420 0.029731 0.000100 1.194159 1.598943
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.975114
np = 9
lnL0 = -801.004154
Iterating by ming2
Initial: fx= 801.004154
x= 0.01229 0.02598 0.10264 0.02847 0.05242 0.02973 0.00011 1.19416 1.59894
1 h-m-p 0.0000 0.0000 456.2795 ++ 799.535417 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0814 15.5860 ----------.. | 1/9
3 h-m-p 0.0000 0.0001 456.8709 ++ 787.328598 m 0.0001 46 | 2/9
4 h-m-p 0.0019 0.1061 12.5384 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 420.7165 ++ 774.413593 m 0.0001 80 | 3/9
6 h-m-p 0.0036 0.2361 7.4826 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 380.1485 ++ 772.515039 m 0.0000 114 | 4/9
8 h-m-p 0.0008 0.3385 5.4589 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 328.9254 ++ 771.798349 m 0.0000 147 | 5/9
10 h-m-p 0.0008 0.4183 4.6106 -----------.. | 5/9
11 h-m-p 0.0000 0.0001 267.3257 ++ 763.153944 m 0.0001 180 | 6/9
12 h-m-p 0.0067 0.5557 3.3786 ------------.. | 6/9
13 h-m-p 0.0000 0.0003 189.7713 +++ 753.341796 m 0.0003 215 | 7/9
14 h-m-p 1.4003 8.0000 0.0000 ++ 753.341796 m 8.0000 227 | 7/9
15 h-m-p 0.0615 8.0000 0.0015 ++++ 753.341796 m 8.0000 243 | 7/9
16 h-m-p 0.0160 8.0000 0.8770 +++++ 753.341781 m 8.0000 260 | 7/9
17 h-m-p 1.6000 8.0000 0.2856 ++ 753.341780 m 8.0000 274 | 7/9
18 h-m-p 0.5901 8.0000 3.8719 ++ 753.341778 m 8.0000 288 | 7/9
19 h-m-p 1.6000 8.0000 1.9121 --------Y 753.341778 0 0.0000 308 | 7/9
20 h-m-p 0.7050 8.0000 0.0000 ---C 753.341778 0 0.0028 323
Out..
lnL = -753.341778
324 lfun, 3564 eigenQcodon, 19440 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.051828 0.047847 0.054325 0.019149 0.012074 0.079231 0.000100 0.900000 1.145577 1.050917 61.161766
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.594526
np = 11
lnL0 = -776.662775
Iterating by ming2
Initial: fx= 776.662775
x= 0.05183 0.04785 0.05433 0.01915 0.01207 0.07923 0.00011 0.90000 1.14558 1.05092 61.16177
1 h-m-p 0.0000 0.0000 131.9964 ++ 776.538500 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 1844.0490 ++ 771.146148 m 0.0000 30 | 2/11
3 h-m-p 0.0000 0.0001 152.2113 ++ 768.655454 m 0.0001 44 | 3/11
4 h-m-p 0.0001 0.0003 275.6277 +CYCCC 763.216953 4 0.0002 67 | 3/11
5 h-m-p 0.0014 0.0068 7.6452 ++ 762.928193 m 0.0068 81 | 4/11
6 h-m-p 0.0003 0.0015 20.0054 ++ 762.132165 m 0.0015 95 | 5/11
7 h-m-p 0.0000 0.0002 93.7956 ++ 758.971265 m 0.0002 109 | 6/11
8 h-m-p 0.0001 0.0039 9.2559 +++ 753.341739 m 0.0039 124 | 7/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 753.341739 m 8.0000 138 | 7/11
10 h-m-p 0.0160 8.0000 0.0541 --------Y 753.341739 0 0.0000 164 | 7/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 753.341739 m 8.0000 185 | 7/11
12 h-m-p 0.0060 2.9928 0.8605 ++++
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
+ 753.341697 m 2.9928 206
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46666, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46635, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46650, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
13 h-m-p 1.6000 8.0000 0.4330
QuantileBeta(0.85, 4.15916, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.23712, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
+ 753.341684 m 8.0000 224
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.93000, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92956, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.92978, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
14 h-m-p 1.0961 8.0000 3.1605
QuantileBeta(0.85, 10.39306, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.78289, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
+ 753.341663 m 8.0000 241
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20686, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.20685, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
15 h-m-p 1.6000 8.0000 2.6622
QuantileBeta(0.85, 36.46520, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 49.24028, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
+ 753.341659 m 8.0000 255
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49866, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 53.49863, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
16 h-m-p 0.6985 3.4927 13.0310 ++ 753.341657 m 3.4927 269 | 8/11
17 h-m-p 0.0000 0.0000 18.5436
h-m-p: 0.00000000e+00 0.00000000e+00 1.85435994e+01 753.341657
.. | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 753.341657 m 8.0000 297 | 8/11
19 h-m-p 0.0018 0.0090 0.0061 ----C 753.341657 0 0.0000 318 | 8/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 753.341657 m 8.0000 338 | 8/11
21 h-m-p 0.0035 1.7631 0.2640 +++++ 753.341655 m 1.7631 358 | 9/11
22 h-m-p 0.7734 8.0000 0.0194 ++ 753.341655 m 8.0000 375 | 9/11
23 h-m-p 0.0160 8.0000 13.0551 +++++ 753.341654 m 8.0000 394 | 9/11
24 h-m-p 1.6000 8.0000 0.0000 N 753.341654 0 1.6000 408 | 9/11
25 h-m-p 0.0160 8.0000 0.0000 +Y 753.341654 0 0.0640 425
Out..
lnL = -753.341654
426 lfun, 5112 eigenQcodon, 28116 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -753.337237 S = -753.337149 -0.000039
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:21
did 20 / 52 patterns 0:21
did 30 / 52 patterns 0:21
did 40 / 52 patterns 0:21
did 50 / 52 patterns 0:21
did 52 / 52 patterns 0:21
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=195
NC_011896_1_WP_010907943_1_853_MLBR_RS03980 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
NC_002677_1_NP_301619_1_491_ML0813 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG
**************************************************
NC_011896_1_WP_010907943_1_853_MLBR_RS03980 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
NC_002677_1_NP_301619_1_491_ML0813 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495 DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA
**************************************************
NC_011896_1_WP_010907943_1_853_MLBR_RS03980 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
NC_002677_1_NP_301619_1_491_ML0813 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495 APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV
**************************************************
NC_011896_1_WP_010907943_1_853_MLBR_RS03980 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
NC_002677_1_NP_301619_1_491_ML0813 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495 LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
*********************************************
>NC_011896_1_WP_010907943_1_853_MLBR_RS03980 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT CAACCAACAACGCGGTCATCGCAACCTGCACCCGT >NC_002677_1_NP_301619_1_491_ML0813 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT CAACCAACAACGCGGTCATCGCAACCTGCACCCGT >NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT CAACCAACAACGCGGTCATCGCAACCTGCACCCGT >NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT CAACCAACAACGCGGTCATCGCAACCTGCACCCGT >NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT CAACCAACAACGCGGTCATCGCAACCTGCACCCGT >NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495 ATGCGACTAACGGAGACAACCTCTATCCGCCGGACAACTACGACGAGCTA CTCTGGCCATCCAATCGTAGATGGCCGCCAAGTCGCCGCACTCCTCGGCA GCGTGGCGGCACTCTGCGCCATTGCGACCGCCGTCATCATCAACAGTGGA GACAACGCAACGACCAAGGCGATAGTGGGAGCACCAACGCCCCGCCCGGT GCTCACCACGCCGTCGATCCCTTTACCGGCGACCCCGTCCAGCACGCCCC CATTACTATTACTCCCAGACACAGCAACCGCCACGATACCGCACAAAGCT GCGCCACCAGCGCTACATCCACGCACCGTCGTTTACAACGTGACCGGCAT GAAGGAGCTCCTCGACCTGGTAACTGTCGTCTACACCGACGCCCGTGGCT ACCCCAAAACCGAGTTCAACGTGGTGCTGCCATGGACAAAGGCTGTAGTC CTTAACCTGGGCGTCAAAACCCAGTCGGTCGTTGCCACCAGCTTCCATAG TCAACTCCACTGCTCAATCGTCAACGCCGAGGGGCAACCAGTCGTGGCGT CAACCAACAACGCGGTCATCGCAACCTGCACCCGT
>NC_011896_1_WP_010907943_1_853_MLBR_RS03980 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR >NC_002677_1_NP_301619_1_491_ML0813 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR >NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR >NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR >NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR >NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495 MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSG DNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKA APPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVV LNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
#NEXUS
[ID: 0545386360]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907943_1_853_MLBR_RS03980
NC_002677_1_NP_301619_1_491_ML0813
NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150
NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080
NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425
NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907943_1_853_MLBR_RS03980,
2 NC_002677_1_NP_301619_1_491_ML0813,
3 NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150,
4 NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080,
5 NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425,
6 NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0665361,2:0.07174067,3:0.07103568,4:0.06935802,5:0.06812098,6:0.07070542);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0665361,2:0.07174067,3:0.07103568,4:0.06935802,5:0.06812098,6:0.07070542);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -786.99 -790.70
2 -787.01 -790.27
--------------------------------------
TOTAL -787.00 -790.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902935 0.089619 0.375300 1.481279 0.873117 1231.75 1366.38 1.000
r(A<->C){all} 0.161411 0.020646 0.000053 0.453441 0.118866 88.29 155.71 1.000
r(A<->G){all} 0.168313 0.020815 0.000070 0.462889 0.130753 243.15 267.54 1.001
r(A<->T){all} 0.171221 0.020153 0.000133 0.446188 0.134815 245.89 260.06 1.008
r(C<->G){all} 0.170532 0.019831 0.000130 0.454825 0.136755 159.59 238.25 1.011
r(C<->T){all} 0.164816 0.018745 0.000036 0.441876 0.129772 288.52 294.51 1.002
r(G<->T){all} 0.163707 0.019142 0.000076 0.446530 0.128336 204.82 230.47 1.000
pi(A){all} 0.236539 0.000315 0.201919 0.270991 0.236609 1381.22 1441.11 1.002
pi(C){all} 0.368492 0.000400 0.331804 0.410661 0.367788 1461.13 1477.61 1.000
pi(G){all} 0.233863 0.000295 0.199498 0.267437 0.233546 1132.83 1233.42 1.000
pi(T){all} 0.161106 0.000225 0.131155 0.189134 0.160887 1333.50 1417.25 1.000
alpha{1,2} 0.418773 0.235490 0.000134 1.423934 0.243525 1333.85 1345.62 1.000
alpha{3} 0.454099 0.226179 0.000133 1.402378 0.298590 1110.85 1305.92 1.000
pinvar{all} 0.997268 0.000011 0.991167 0.999999 0.998338 1068.61 1279.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0813/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 195
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 4 4 4 4 4 4 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 2
CTC 8 8 8 8 8 8 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 4 4 4 4 4 4
CTA 3 3 3 3 3 3 | CCA 9 9 9 9 9 9 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 5 5 5 5 5 5 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 7 7 7 7 7 7 | ACC 15 15 15 15 15 15 | AAC 8 8 8 8 8 8 | AGC 4 4 4 4 4 4
ATA 2 2 2 2 2 2 | ACA 4 4 4 4 4 4 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 8 8 8 8 8 8 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 0 0 0 0 0 0
GTC 11 11 11 11 11 11 | GCC 7 7 7 7 7 7 | GAC 4 4 4 4 4 4 | GGC 6 6 6 6 6 6
GTA 3 3 3 3 3 3 | GCA 6 6 6 6 6 6 | Glu GAA 0 0 0 0 0 0 | GGA 2 2 2 2 2 2
GTG 7 7 7 7 7 7 | GCG 8 8 8 8 8 8 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907943_1_853_MLBR_RS03980
position 1: T:0.10256 C:0.25641 A:0.31282 G:0.32821
position 2: T:0.28205 C:0.39487 A:0.18462 G:0.13846
position 3: T:0.09744 C:0.45641 A:0.21026 G:0.23590
Average T:0.16068 C:0.36923 A:0.23590 G:0.23419
#2: NC_002677_1_NP_301619_1_491_ML0813
position 1: T:0.10256 C:0.25641 A:0.31282 G:0.32821
position 2: T:0.28205 C:0.39487 A:0.18462 G:0.13846
position 3: T:0.09744 C:0.45641 A:0.21026 G:0.23590
Average T:0.16068 C:0.36923 A:0.23590 G:0.23419
#3: NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150
position 1: T:0.10256 C:0.25641 A:0.31282 G:0.32821
position 2: T:0.28205 C:0.39487 A:0.18462 G:0.13846
position 3: T:0.09744 C:0.45641 A:0.21026 G:0.23590
Average T:0.16068 C:0.36923 A:0.23590 G:0.23419
#4: NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080
position 1: T:0.10256 C:0.25641 A:0.31282 G:0.32821
position 2: T:0.28205 C:0.39487 A:0.18462 G:0.13846
position 3: T:0.09744 C:0.45641 A:0.21026 G:0.23590
Average T:0.16068 C:0.36923 A:0.23590 G:0.23419
#5: NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425
position 1: T:0.10256 C:0.25641 A:0.31282 G:0.32821
position 2: T:0.28205 C:0.39487 A:0.18462 G:0.13846
position 3: T:0.09744 C:0.45641 A:0.21026 G:0.23590
Average T:0.16068 C:0.36923 A:0.23590 G:0.23419
#6: NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495
position 1: T:0.10256 C:0.25641 A:0.31282 G:0.32821
position 2: T:0.28205 C:0.39487 A:0.18462 G:0.13846
position 3: T:0.09744 C:0.45641 A:0.21026 G:0.23590
Average T:0.16068 C:0.36923 A:0.23590 G:0.23419
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 24 | TGC 18
Leu L TTA 18 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 12
CTC 48 | CCC 18 | CAC 12 | CGC 24
CTA 18 | CCA 54 | Gln Q CAA 18 | CGA 6
CTG 18 | CCG 30 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 12
ATC 42 | ACC 90 | AAC 48 | AGC 24
ATA 12 | ACA 24 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 48 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 0
GTC 66 | GCC 42 | GAC 24 | GGC 36
GTA 18 | GCA 36 | Glu E GAA 0 | GGA 12
GTG 42 | GCG 48 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10256 C:0.25641 A:0.31282 G:0.32821
position 2: T:0.28205 C:0.39487 A:0.18462 G:0.13846
position 3: T:0.09744 C:0.45641 A:0.21026 G:0.23590
Average T:0.16068 C:0.36923 A:0.23590 G:0.23419
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -753.341655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 61.161766
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907943_1_853_MLBR_RS03980: 0.000004, NC_002677_1_NP_301619_1_491_ML0813: 0.000004, NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150: 0.000004, NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080: 0.000004, NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425: 0.000004, NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 61.16177
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 428.1 156.9 61.1618 0.0000 0.0000 0.0 0.0
7..2 0.000 428.1 156.9 61.1618 0.0000 0.0000 0.0 0.0
7..3 0.000 428.1 156.9 61.1618 0.0000 0.0000 0.0 0.0
7..4 0.000 428.1 156.9 61.1618 0.0000 0.0000 0.0 0.0
7..5 0.000 428.1 156.9 61.1618 0.0000 0.0000 0.0 0.0
7..6 0.000 428.1 156.9 61.1618 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -753.341805 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.631001 0.014216
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907943_1_853_MLBR_RS03980: 0.000004, NC_002677_1_NP_301619_1_491_ML0813: 0.000004, NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150: 0.000004, NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080: 0.000004, NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425: 0.000004, NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.63100 0.36900
w: 0.01422 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 428.1 156.9 0.3780 0.0000 0.0000 0.0 0.0
7..2 0.000 428.1 156.9 0.3780 0.0000 0.0000 0.0 0.0
7..3 0.000 428.1 156.9 0.3780 0.0000 0.0000 0.0 0.0
7..4 0.000 428.1 156.9 0.3780 0.0000 0.0000 0.0 0.0
7..5 0.000 428.1 156.9 0.3780 0.0000 0.0000 0.0 0.0
7..6 0.000 428.1 156.9 0.3780 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -753.341655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 96.487619
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907943_1_853_MLBR_RS03980: 0.000004, NC_002677_1_NP_301619_1_491_ML0813: 0.000004, NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150: 0.000004, NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080: 0.000004, NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425: 0.000004, NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 96.48762
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 428.1 156.9 96.4876 0.0000 0.0000 0.0 0.0
7..2 0.000 428.1 156.9 96.4876 0.0000 0.0000 0.0 0.0
7..3 0.000 428.1 156.9 96.4876 0.0000 0.0000 0.0 0.0
7..4 0.000 428.1 156.9 96.4876 0.0000 0.0000 0.0 0.0
7..5 0.000 428.1 156.9 96.4876 0.0000 0.0000 0.0 0.0
7..6 0.000 428.1 156.9 96.4876 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907943_1_853_MLBR_RS03980)
Pr(w>1) post mean +- SE for w
1 M 1.000** 96.488
2 R 1.000** 96.488
3 L 1.000** 96.488
4 T 1.000** 96.488
5 E 1.000** 96.488
6 T 1.000** 96.488
7 T 1.000** 96.488
8 S 1.000** 96.488
9 I 1.000** 96.488
10 R 1.000** 96.488
11 R 1.000** 96.488
12 T 1.000** 96.488
13 T 1.000** 96.488
14 T 1.000** 96.488
15 T 1.000** 96.488
16 S 1.000** 96.488
17 Y 1.000** 96.488
18 S 1.000** 96.488
19 G 1.000** 96.488
20 H 1.000** 96.488
21 P 1.000** 96.488
22 I 1.000** 96.488
23 V 1.000** 96.488
24 D 1.000** 96.488
25 G 1.000** 96.488
26 R 1.000** 96.488
27 Q 1.000** 96.488
28 V 1.000** 96.488
29 A 1.000** 96.488
30 A 1.000** 96.488
31 L 1.000** 96.488
32 L 1.000** 96.488
33 G 1.000** 96.488
34 S 1.000** 96.488
35 V 1.000** 96.488
36 A 1.000** 96.488
37 A 1.000** 96.488
38 L 1.000** 96.488
39 C 1.000** 96.488
40 A 1.000** 96.488
41 I 1.000** 96.488
42 A 1.000** 96.488
43 T 1.000** 96.488
44 A 1.000** 96.488
45 V 1.000** 96.488
46 I 1.000** 96.488
47 I 1.000** 96.488
48 N 1.000** 96.488
49 S 1.000** 96.488
50 G 1.000** 96.488
51 D 1.000** 96.488
52 N 1.000** 96.488
53 A 1.000** 96.488
54 T 1.000** 96.488
55 T 1.000** 96.488
56 K 1.000** 96.488
57 A 1.000** 96.488
58 I 1.000** 96.488
59 V 1.000** 96.488
60 G 1.000** 96.488
61 A 1.000** 96.488
62 P 1.000** 96.488
63 T 1.000** 96.488
64 P 1.000** 96.488
65 R 1.000** 96.488
66 P 1.000** 96.488
67 V 1.000** 96.488
68 L 1.000** 96.488
69 T 1.000** 96.488
70 T 1.000** 96.488
71 P 1.000** 96.488
72 S 1.000** 96.488
73 I 1.000** 96.488
74 P 1.000** 96.488
75 L 1.000** 96.488
76 P 1.000** 96.488
77 A 1.000** 96.488
78 T 1.000** 96.488
79 P 1.000** 96.488
80 S 1.000** 96.488
81 S 1.000** 96.488
82 T 1.000** 96.488
83 P 1.000** 96.488
84 P 1.000** 96.488
85 L 1.000** 96.488
86 L 1.000** 96.488
87 L 1.000** 96.488
88 L 1.000** 96.488
89 P 1.000** 96.488
90 D 1.000** 96.488
91 T 1.000** 96.488
92 A 1.000** 96.488
93 T 1.000** 96.488
94 A 1.000** 96.488
95 T 1.000** 96.488
96 I 1.000** 96.488
97 P 1.000** 96.488
98 H 1.000** 96.488
99 K 1.000** 96.488
100 A 1.000** 96.488
101 A 1.000** 96.488
102 P 1.000** 96.488
103 P 1.000** 96.488
104 A 1.000** 96.488
105 L 1.000** 96.488
106 H 1.000** 96.488
107 P 1.000** 96.488
108 R 1.000** 96.488
109 T 1.000** 96.488
110 V 1.000** 96.488
111 V 1.000** 96.488
112 Y 1.000** 96.488
113 N 1.000** 96.488
114 V 1.000** 96.488
115 T 1.000** 96.488
116 G 1.000** 96.488
117 M 1.000** 96.488
118 K 1.000** 96.488
119 E 1.000** 96.488
120 L 1.000** 96.488
121 L 1.000** 96.488
122 D 1.000** 96.488
123 L 1.000** 96.488
124 V 1.000** 96.488
125 T 1.000** 96.488
126 V 1.000** 96.488
127 V 1.000** 96.488
128 Y 1.000** 96.488
129 T 1.000** 96.488
130 D 1.000** 96.488
131 A 1.000** 96.488
132 R 1.000** 96.488
133 G 1.000** 96.488
134 Y 1.000** 96.488
135 P 1.000** 96.488
136 K 1.000** 96.488
137 T 1.000** 96.488
138 E 1.000** 96.488
139 F 1.000** 96.488
140 N 1.000** 96.488
141 V 1.000** 96.488
142 V 1.000** 96.488
143 L 1.000** 96.488
144 P 1.000** 96.488
145 W 1.000** 96.488
146 T 1.000** 96.488
147 K 1.000** 96.488
148 A 1.000** 96.488
149 V 1.000** 96.488
150 V 1.000** 96.488
151 L 1.000** 96.488
152 N 1.000** 96.488
153 L 1.000** 96.488
154 G 1.000** 96.488
155 V 1.000** 96.488
156 K 1.000** 96.488
157 T 1.000** 96.488
158 Q 1.000** 96.488
159 S 1.000** 96.488
160 V 1.000** 96.488
161 V 1.000** 96.488
162 A 1.000** 96.488
163 T 1.000** 96.488
164 S 1.000** 96.488
165 F 1.000** 96.488
166 H 1.000** 96.488
167 S 1.000** 96.488
168 Q 1.000** 96.488
169 L 1.000** 96.488
170 H 1.000** 96.488
171 C 1.000** 96.488
172 S 1.000** 96.488
173 I 1.000** 96.488
174 V 1.000** 96.488
175 N 1.000** 96.488
176 A 1.000** 96.488
177 E 1.000** 96.488
178 G 1.000** 96.488
179 Q 1.000** 96.488
180 P 1.000** 96.488
181 V 1.000** 96.488
182 V 1.000** 96.488
183 A 1.000** 96.488
184 S 1.000** 96.488
185 T 1.000** 96.488
186 N 1.000** 96.488
187 N 1.000** 96.488
188 A 1.000** 96.488
189 V 1.000** 96.488
190 I 1.000** 96.488
191 A 1.000** 96.488
192 T 1.000** 96.488
193 C 1.000** 96.488
194 T 1.000** 96.488
195 R 1.000** 96.488
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907943_1_853_MLBR_RS03980)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -753.341778 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 32.178102 27.350225
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907943_1_853_MLBR_RS03980: 0.000004, NC_002677_1_NP_301619_1_491_ML0813: 0.000004, NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150: 0.000004, NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080: 0.000004, NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425: 0.000004, NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 32.17810 q = 27.35023
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.43430 0.47360 0.49714 0.51596 0.53285 0.54915 0.56591 0.58446 0.60743 0.64524
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 428.1 156.9 0.5406 0.0000 0.0000 0.0 0.0
7..2 0.000 428.1 156.9 0.5406 0.0000 0.0000 0.0 0.0
7..3 0.000 428.1 156.9 0.5406 0.0000 0.0000 0.0 0.0
7..4 0.000 428.1 156.9 0.5406 0.0000 0.0000 0.0 0.0
7..5 0.000 428.1 156.9 0.5406 0.0000 0.0000 0.0 0.0
7..6 0.000 428.1 156.9 0.5406 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -753.341654 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 97.809057 0.005000 163.540740
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907943_1_853_MLBR_RS03980: 0.000004, NC_002677_1_NP_301619_1_491_ML0813: 0.000004, NZ_LVXE01000001_1_WP_010907943_1_238_A3216_RS01150: 0.000004, NZ_LYPH01000001_1_WP_010907943_1_227_A8144_RS01080: 0.000004, NZ_CP029543_1_WP_010907943_1_871_DIJ64_RS04425: 0.000004, NZ_AP014567_1_WP_010907943_1_885_JK2ML_RS04495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 97.80906 q = 0.00500
(p1 = 0.99999) w = 163.54074
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 163.54074
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 428.1 156.9 163.5391 0.0000 0.0000 0.0 0.0
7..2 0.000 428.1 156.9 163.5391 0.0000 0.0000 0.0 0.0
7..3 0.000 428.1 156.9 163.5391 0.0000 0.0000 0.0 0.0
7..4 0.000 428.1 156.9 163.5391 0.0000 0.0000 0.0 0.0
7..5 0.000 428.1 156.9 163.5391 0.0000 0.0000 0.0 0.0
7..6 0.000 428.1 156.9 163.5391 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907943_1_853_MLBR_RS03980)
Pr(w>1) post mean +- SE for w
1 M 1.000** 163.539
2 R 1.000** 163.539
3 L 1.000** 163.539
4 T 1.000** 163.539
5 E 1.000** 163.539
6 T 1.000** 163.539
7 T 1.000** 163.539
8 S 1.000** 163.539
9 I 1.000** 163.539
10 R 1.000** 163.539
11 R 1.000** 163.539
12 T 1.000** 163.539
13 T 1.000** 163.539
14 T 1.000** 163.539
15 T 1.000** 163.539
16 S 1.000** 163.539
17 Y 1.000** 163.539
18 S 1.000** 163.539
19 G 1.000** 163.539
20 H 1.000** 163.539
21 P 1.000** 163.539
22 I 1.000** 163.539
23 V 1.000** 163.539
24 D 1.000** 163.539
25 G 1.000** 163.539
26 R 1.000** 163.539
27 Q 1.000** 163.539
28 V 1.000** 163.539
29 A 1.000** 163.539
30 A 1.000** 163.539
31 L 1.000** 163.539
32 L 1.000** 163.539
33 G 1.000** 163.539
34 S 1.000** 163.539
35 V 1.000** 163.539
36 A 1.000** 163.539
37 A 1.000** 163.539
38 L 1.000** 163.539
39 C 1.000** 163.539
40 A 1.000** 163.539
41 I 1.000** 163.539
42 A 1.000** 163.539
43 T 1.000** 163.539
44 A 1.000** 163.539
45 V 1.000** 163.539
46 I 1.000** 163.539
47 I 1.000** 163.539
48 N 1.000** 163.539
49 S 1.000** 163.539
50 G 1.000** 163.539
51 D 1.000** 163.539
52 N 1.000** 163.539
53 A 1.000** 163.539
54 T 1.000** 163.539
55 T 1.000** 163.539
56 K 1.000** 163.539
57 A 1.000** 163.539
58 I 1.000** 163.539
59 V 1.000** 163.539
60 G 1.000** 163.539
61 A 1.000** 163.539
62 P 1.000** 163.539
63 T 1.000** 163.539
64 P 1.000** 163.539
65 R 1.000** 163.539
66 P 1.000** 163.539
67 V 1.000** 163.539
68 L 1.000** 163.539
69 T 1.000** 163.539
70 T 1.000** 163.539
71 P 1.000** 163.539
72 S 1.000** 163.539
73 I 1.000** 163.539
74 P 1.000** 163.539
75 L 1.000** 163.539
76 P 1.000** 163.539
77 A 1.000** 163.539
78 T 1.000** 163.539
79 P 1.000** 163.539
80 S 1.000** 163.539
81 S 1.000** 163.539
82 T 1.000** 163.539
83 P 1.000** 163.539
84 P 1.000** 163.539
85 L 1.000** 163.539
86 L 1.000** 163.539
87 L 1.000** 163.539
88 L 1.000** 163.539
89 P 1.000** 163.539
90 D 1.000** 163.539
91 T 1.000** 163.539
92 A 1.000** 163.539
93 T 1.000** 163.539
94 A 1.000** 163.539
95 T 1.000** 163.539
96 I 1.000** 163.539
97 P 1.000** 163.539
98 H 1.000** 163.539
99 K 1.000** 163.539
100 A 1.000** 163.539
101 A 1.000** 163.539
102 P 1.000** 163.539
103 P 1.000** 163.539
104 A 1.000** 163.539
105 L 1.000** 163.539
106 H 1.000** 163.539
107 P 1.000** 163.539
108 R 1.000** 163.539
109 T 1.000** 163.539
110 V 1.000** 163.539
111 V 1.000** 163.539
112 Y 1.000** 163.539
113 N 1.000** 163.539
114 V 1.000** 163.539
115 T 1.000** 163.539
116 G 1.000** 163.539
117 M 1.000** 163.539
118 K 1.000** 163.539
119 E 1.000** 163.539
120 L 1.000** 163.539
121 L 1.000** 163.539
122 D 1.000** 163.539
123 L 1.000** 163.539
124 V 1.000** 163.539
125 T 1.000** 163.539
126 V 1.000** 163.539
127 V 1.000** 163.539
128 Y 1.000** 163.539
129 T 1.000** 163.539
130 D 1.000** 163.539
131 A 1.000** 163.539
132 R 1.000** 163.539
133 G 1.000** 163.539
134 Y 1.000** 163.539
135 P 1.000** 163.539
136 K 1.000** 163.539
137 T 1.000** 163.539
138 E 1.000** 163.539
139 F 1.000** 163.539
140 N 1.000** 163.539
141 V 1.000** 163.539
142 V 1.000** 163.539
143 L 1.000** 163.539
144 P 1.000** 163.539
145 W 1.000** 163.539
146 T 1.000** 163.539
147 K 1.000** 163.539
148 A 1.000** 163.539
149 V 1.000** 163.539
150 V 1.000** 163.539
151 L 1.000** 163.539
152 N 1.000** 163.539
153 L 1.000** 163.539
154 G 1.000** 163.539
155 V 1.000** 163.539
156 K 1.000** 163.539
157 T 1.000** 163.539
158 Q 1.000** 163.539
159 S 1.000** 163.539
160 V 1.000** 163.539
161 V 1.000** 163.539
162 A 1.000** 163.539
163 T 1.000** 163.539
164 S 1.000** 163.539
165 F 1.000** 163.539
166 H 1.000** 163.539
167 S 1.000** 163.539
168 Q 1.000** 163.539
169 L 1.000** 163.539
170 H 1.000** 163.539
171 C 1.000** 163.539
172 S 1.000** 163.539
173 I 1.000** 163.539
174 V 1.000** 163.539
175 N 1.000** 163.539
176 A 1.000** 163.539
177 E 1.000** 163.539
178 G 1.000** 163.539
179 Q 1.000** 163.539
180 P 1.000** 163.539
181 V 1.000** 163.539
182 V 1.000** 163.539
183 A 1.000** 163.539
184 S 1.000** 163.539
185 T 1.000** 163.539
186 N 1.000** 163.539
187 N 1.000** 163.539
188 A 1.000** 163.539
189 V 1.000** 163.539
190 I 1.000** 163.539
191 A 1.000** 163.539
192 T 1.000** 163.539
193 C 1.000** 163.539
194 T 1.000** 163.539
195 R 1.000** 163.539
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907943_1_853_MLBR_RS03980)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:21
Model 1: NearlyNeutral -753.341805 Model 2: PositiveSelection -753.341655 Model 0: one-ratio -753.341655 Model 7: beta -753.341778 Model 8: beta&w>1 -753.341654 Model 0 vs 1 3.000000001520675E-4 Model 2 vs 1 3.000000001520675E-4 Model 8 vs 7 2.480000000559812E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
