--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:46:48 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0814/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -335.47 -338.84
2 -335.47 -338.64
--------------------------------------
TOTAL -335.47 -338.75
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890745 0.088624 0.362279 1.461502 0.853113 1303.60 1402.30 1.000
r(A<->C){all} 0.170828 0.019717 0.000032 0.448799 0.135666 178.95 217.36 1.002
r(A<->G){all} 0.165598 0.020791 0.000051 0.464564 0.123036 159.63 206.90 1.002
r(A<->T){all} 0.159913 0.019150 0.000012 0.449125 0.123841 220.59 237.67 1.000
r(C<->G){all} 0.164214 0.019365 0.000061 0.443237 0.129383 217.59 223.00 1.002
r(C<->T){all} 0.168353 0.021172 0.000013 0.461217 0.132667 220.92 232.00 1.000
r(G<->T){all} 0.171093 0.020645 0.000056 0.463406 0.136720 171.21 208.60 1.002
pi(A){all} 0.194863 0.000629 0.147375 0.243571 0.194013 695.47 1098.23 1.000
pi(C){all} 0.264487 0.000761 0.210453 0.318323 0.264092 1219.35 1313.66 1.000
pi(G){all} 0.344294 0.000858 0.287954 0.402189 0.343767 1495.09 1498.05 1.000
pi(T){all} 0.196356 0.000621 0.150602 0.249390 0.195367 1465.70 1483.35 1.000
alpha{1,2} 0.410390 0.208659 0.000225 1.339720 0.252776 1159.89 1330.45 1.000
alpha{3} 0.457757 0.242920 0.000210 1.419612 0.300507 1163.39 1226.39 1.000
pinvar{all} 0.993110 0.000074 0.977593 0.999992 0.995784 982.06 1204.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -320.79878
Model 2: PositiveSelection -320.798635
Model 0: one-ratio -320.798815
Model 7: beta -320.798635
Model 8: beta&w>1 -320.798635
Model 0 vs 1 6.999999993695383E-5
Model 2 vs 1 2.9000000006362825E-4
Model 8 vs 7 0.0
>C1
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C2
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C3
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C4
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C5
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C6
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=82
C1 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C2 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C3 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C4 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C5 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C6 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
**************************************************
C1 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C2 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C3 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C4 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C5 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C6 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2460]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2460]--->[2460]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.603 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C2 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C3 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C4 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C5 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
C6 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
**************************************************
C1 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C2 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C3 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C4 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C5 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
C6 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
C2 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
C3 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
C4 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
C5 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
C6 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
**************************************************
C1 CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
C2 CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
C3 CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
C4 CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
C5 CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
C6 CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
**************************************************
C1 GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
C2 GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
C3 GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
C4 GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
C5 GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
C6 GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
**************************************************
C1 CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
C2 CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
C3 CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
C4 CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
C5 CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
C6 CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
**************************************************
C1 TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
C2 TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
C3 TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
C4 TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
C5 TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
C6 TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
**********************************************
>C1
GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
>C2
GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
>C3
GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
>C4
GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
>C5
GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
>C6
GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC
CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC
GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC
CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC
TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
>C1
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C2
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C3
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C4
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C5
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
>C6
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
LIHGAKIAYVEIGVADARRVGFGIGAESATNG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 246 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579797904
Setting output file names to "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 378216200
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0020960818
Seed = 1040660599
Swapseed = 1579797904
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -550.559761 -- -24.965149
Chain 2 -- -550.559709 -- -24.965149
Chain 3 -- -550.559792 -- -24.965149
Chain 4 -- -550.559792 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -550.559792 -- -24.965149
Chain 2 -- -550.559792 -- -24.965149
Chain 3 -- -550.559792 -- -24.965149
Chain 4 -- -550.559709 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-550.560] (-550.560) (-550.560) (-550.560) * [-550.560] (-550.560) (-550.560) (-550.560)
500 -- [-356.186] (-351.896) (-341.673) (-346.147) * (-347.445) (-345.915) [-346.445] (-344.444) -- 0:00:00
1000 -- (-352.700) [-340.295] (-346.545) (-340.695) * (-341.981) (-348.489) (-347.714) [-345.676] -- 0:00:00
1500 -- (-350.654) [-344.803] (-342.539) (-343.193) * [-347.021] (-345.728) (-343.132) (-351.482) -- 0:00:00
2000 -- [-349.571] (-343.215) (-345.003) (-353.835) * (-345.894) [-341.929] (-342.416) (-342.218) -- 0:00:00
2500 -- (-348.593) (-344.606) [-345.931] (-342.951) * (-356.967) (-343.746) [-343.054] (-350.055) -- 0:00:00
3000 -- (-351.982) [-342.022] (-346.222) (-348.977) * (-341.926) (-343.454) [-344.100] (-346.256) -- 0:00:00
3500 -- (-342.448) (-348.645) (-347.268) [-341.660] * (-343.745) [-345.732] (-343.241) (-339.087) -- 0:00:00
4000 -- [-342.309] (-344.328) (-346.617) (-365.559) * (-347.421) (-347.171) [-340.629] (-356.988) -- 0:00:00
4500 -- (-342.554) [-343.725] (-340.577) (-343.723) * (-347.363) (-345.666) (-344.761) [-345.469] -- 0:03:41
5000 -- (-346.259) (-344.141) [-346.162] (-344.963) * [-343.833] (-348.700) (-345.151) (-343.594) -- 0:03:19
Average standard deviation of split frequencies: 0.067344
5500 -- (-349.515) (-348.370) (-345.014) [-342.016] * (-341.340) (-343.436) (-351.986) [-348.207] -- 0:03:00
6000 -- (-351.124) (-345.057) [-344.031] (-353.901) * (-347.599) (-342.199) (-346.673) [-342.946] -- 0:02:45
6500 -- (-343.204) (-347.657) [-347.394] (-349.328) * [-340.851] (-345.023) (-349.434) (-340.699) -- 0:02:32
7000 -- (-341.675) (-353.730) [-345.869] (-359.082) * (-344.706) (-339.432) (-342.511) [-341.995] -- 0:02:21
7500 -- (-351.728) (-348.967) (-352.186) [-342.968] * [-343.303] (-347.938) (-345.128) (-343.497) -- 0:02:12
8000 -- (-347.407) [-346.825] (-345.545) (-344.572) * [-346.002] (-347.211) (-341.501) (-347.205) -- 0:02:04
8500 -- [-349.492] (-343.789) (-345.512) (-348.498) * [-341.899] (-346.007) (-347.592) (-350.255) -- 0:01:56
9000 -- (-347.664) (-341.503) (-334.428) [-340.582] * [-342.896] (-343.690) (-346.049) (-349.053) -- 0:01:50
9500 -- (-346.834) (-351.760) [-335.462] (-346.818) * [-348.740] (-348.548) (-343.389) (-343.312) -- 0:01:44
10000 -- (-347.744) (-352.643) (-334.921) [-344.396] * [-348.626] (-343.226) (-344.701) (-347.733) -- 0:01:39
Average standard deviation of split frequencies: 0.061872
10500 -- (-344.802) (-344.171) [-335.972] (-345.258) * [-347.160] (-348.529) (-348.003) (-345.631) -- 0:01:34
11000 -- (-354.627) (-338.179) [-336.740] (-349.967) * (-340.217) (-355.890) (-341.802) [-340.852] -- 0:01:29
11500 -- (-353.110) (-341.738) (-336.072) [-345.254] * (-349.983) [-345.507] (-348.163) (-348.937) -- 0:01:25
12000 -- (-356.911) (-334.084) [-334.662] (-349.588) * (-346.874) (-350.596) (-343.059) [-345.643] -- 0:01:22
12500 -- (-358.867) (-336.533) (-338.536) [-344.577] * (-347.848) [-340.457] (-346.886) (-351.076) -- 0:01:19
13000 -- (-350.751) (-337.252) [-336.912] (-357.178) * (-342.488) (-353.234) [-343.889] (-342.449) -- 0:01:15
13500 -- (-342.184) (-336.101) [-335.856] (-349.225) * (-341.672) [-347.948] (-338.109) (-352.599) -- 0:01:13
14000 -- (-342.404) (-335.271) [-334.550] (-340.068) * (-346.092) (-349.333) (-342.612) [-338.315] -- 0:01:10
14500 -- [-337.666] (-334.175) (-342.561) (-337.921) * [-345.746] (-352.895) (-360.082) (-358.146) -- 0:01:07
15000 -- [-336.379] (-336.365) (-335.813) (-335.420) * (-343.173) [-346.669] (-350.620) (-356.192) -- 0:01:05
Average standard deviation of split frequencies: 0.069780
15500 -- [-335.534] (-334.891) (-334.168) (-336.027) * [-348.929] (-346.510) (-343.281) (-346.567) -- 0:01:03
16000 -- (-335.243) (-336.677) [-334.674] (-334.773) * (-342.079) (-353.920) (-341.781) [-335.603] -- 0:01:01
16500 -- (-337.510) (-335.576) (-337.237) [-337.497] * (-338.666) (-355.267) [-336.315] (-338.526) -- 0:00:59
17000 -- (-336.372) (-338.162) [-334.349] (-338.678) * (-350.828) (-347.078) (-335.179) [-335.629] -- 0:00:57
17500 -- [-337.845] (-338.088) (-334.956) (-337.090) * (-341.516) [-345.407] (-335.624) (-339.350) -- 0:00:56
18000 -- [-337.457] (-335.686) (-336.671) (-337.570) * (-349.641) (-344.205) [-334.391] (-339.743) -- 0:00:54
18500 -- [-334.946] (-338.174) (-340.946) (-340.889) * (-343.475) (-356.066) (-334.982) [-336.131] -- 0:00:53
19000 -- (-335.664) (-337.360) [-336.185] (-336.282) * (-344.940) (-353.138) [-335.898] (-337.095) -- 0:00:51
19500 -- (-339.367) (-336.980) [-337.614] (-335.730) * [-343.563] (-350.702) (-336.703) (-335.326) -- 0:00:50
20000 -- (-341.055) (-334.857) (-334.781) [-335.337] * (-349.726) (-340.691) [-336.401] (-336.789) -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- [-335.562] (-339.882) (-335.928) (-336.303) * (-343.468) (-343.360) (-335.980) [-337.411] -- 0:01:35
21000 -- (-334.106) (-336.586) [-339.693] (-336.510) * (-350.254) [-339.043] (-335.762) (-335.821) -- 0:01:33
21500 -- [-337.431] (-338.848) (-335.903) (-334.854) * (-347.157) [-340.769] (-337.422) (-339.626) -- 0:01:31
22000 -- (-337.422) [-336.147] (-336.171) (-335.734) * (-352.038) (-347.211) (-340.315) [-337.459] -- 0:01:28
22500 -- (-336.388) (-337.452) (-336.433) [-337.956] * (-348.210) [-347.830] (-334.177) (-337.427) -- 0:01:26
23000 -- (-339.791) (-336.927) [-334.984] (-338.039) * (-351.512) (-342.163) (-336.697) [-338.088] -- 0:01:24
23500 -- (-337.968) (-335.041) [-335.785] (-334.908) * (-345.352) (-343.254) (-335.614) [-335.995] -- 0:01:23
24000 -- (-334.820) [-335.457] (-335.506) (-335.320) * (-346.697) [-345.635] (-335.412) (-334.541) -- 0:01:21
24500 -- (-335.794) (-345.293) [-335.902] (-334.306) * (-346.810) [-337.402] (-337.727) (-334.333) -- 0:01:19
25000 -- (-335.919) (-337.162) [-335.874] (-334.687) * [-348.875] (-351.249) (-337.277) (-335.163) -- 0:01:18
Average standard deviation of split frequencies: 0.044503
25500 -- (-336.028) [-335.385] (-335.557) (-336.347) * (-343.581) (-345.274) (-334.060) [-335.441] -- 0:01:16
26000 -- (-336.265) (-335.645) [-338.282] (-334.930) * (-350.977) (-345.189) (-334.355) [-335.137] -- 0:01:14
26500 -- (-336.199) [-334.019] (-334.985) (-334.704) * (-343.453) [-344.543] (-336.652) (-336.928) -- 0:01:13
27000 -- (-338.544) (-336.425) [-335.628] (-334.584) * (-369.245) [-341.151] (-337.442) (-334.038) -- 0:01:12
27500 -- (-336.519) [-338.066] (-339.886) (-334.038) * (-362.379) (-356.685) (-334.468) [-335.405] -- 0:01:10
28000 -- (-336.503) (-339.515) [-339.298] (-337.494) * (-340.427) (-345.231) (-336.344) [-335.511] -- 0:01:09
28500 -- [-335.961] (-334.978) (-338.578) (-334.997) * [-336.301] (-345.205) (-339.772) (-334.790) -- 0:01:08
29000 -- (-336.980) [-335.678] (-336.924) (-336.850) * (-335.519) [-341.577] (-334.591) (-335.521) -- 0:01:06
29500 -- (-335.649) [-334.489] (-337.677) (-337.127) * (-336.570) [-352.821] (-336.315) (-334.090) -- 0:01:05
30000 -- [-334.658] (-333.891) (-339.400) (-336.849) * [-337.587] (-349.099) (-336.001) (-336.573) -- 0:01:04
Average standard deviation of split frequencies: 0.043810
30500 -- [-334.147] (-334.437) (-339.599) (-337.911) * (-336.390) [-341.995] (-337.875) (-335.061) -- 0:01:03
31000 -- (-334.544) (-335.642) [-336.485] (-335.844) * (-333.989) (-362.389) [-334.582] (-334.539) -- 0:01:02
31500 -- (-337.855) (-334.747) (-335.774) [-338.346] * (-334.312) (-360.298) [-336.710] (-335.228) -- 0:01:01
32000 -- [-335.864] (-334.446) (-334.159) (-337.778) * (-336.735) (-356.000) (-335.947) [-335.117] -- 0:01:00
32500 -- (-337.588) (-334.621) (-335.372) [-335.001] * (-339.844) (-351.298) (-335.098) [-337.796] -- 0:00:59
33000 -- (-337.714) [-337.010] (-337.974) (-334.638) * (-335.332) (-349.757) (-334.679) [-334.969] -- 0:00:58
33500 -- [-335.124] (-337.945) (-335.746) (-336.910) * [-341.213] (-336.309) (-337.635) (-335.426) -- 0:00:57
34000 -- (-335.779) (-334.962) [-335.757] (-336.263) * (-338.084) [-336.622] (-335.450) (-337.550) -- 0:00:56
34500 -- (-334.270) (-339.108) (-339.115) [-335.477] * [-336.255] (-334.655) (-336.910) (-334.558) -- 0:00:55
35000 -- [-334.358] (-336.057) (-334.365) (-334.715) * (-338.003) [-337.117] (-335.253) (-337.880) -- 0:00:55
Average standard deviation of split frequencies: 0.038629
35500 -- [-336.196] (-337.680) (-334.943) (-334.666) * (-334.251) (-335.822) (-335.440) [-337.470] -- 0:00:54
36000 -- [-339.957] (-335.833) (-340.787) (-337.958) * [-335.163] (-334.370) (-334.067) (-336.071) -- 0:00:53
36500 -- (-335.190) (-335.791) (-337.100) [-335.335] * (-336.131) [-334.044] (-336.028) (-336.243) -- 0:00:52
37000 -- (-335.697) (-337.075) (-336.012) [-335.151] * (-336.789) [-336.775] (-334.566) (-336.297) -- 0:00:52
37500 -- (-334.869) (-334.499) (-335.521) [-337.853] * (-336.459) (-333.851) (-336.630) [-335.278] -- 0:01:17
38000 -- (-336.547) [-335.777] (-335.409) (-334.007) * (-336.919) (-337.180) (-341.080) [-335.598] -- 0:01:15
38500 -- (-336.297) (-335.083) [-337.319] (-336.957) * (-337.392) [-337.322] (-340.056) (-336.045) -- 0:01:14
39000 -- [-335.082] (-336.641) (-336.936) (-334.539) * (-335.869) (-335.178) [-336.072] (-337.429) -- 0:01:13
39500 -- (-336.096) (-340.370) (-336.259) [-335.352] * [-337.686] (-336.524) (-337.210) (-335.788) -- 0:01:12
40000 -- (-336.776) (-334.619) [-339.422] (-334.704) * (-336.834) (-336.800) [-337.810] (-335.701) -- 0:01:12
Average standard deviation of split frequencies: 0.036225
40500 -- (-333.946) (-336.118) (-335.433) [-335.009] * (-334.888) (-337.653) (-337.332) [-337.967] -- 0:01:11
41000 -- [-334.829] (-335.393) (-335.405) (-335.603) * (-337.576) (-335.724) [-336.772] (-336.058) -- 0:01:10
41500 -- (-336.704) (-334.908) (-336.177) [-335.123] * (-340.096) (-334.264) (-338.787) [-334.989] -- 0:01:09
42000 -- (-334.222) (-335.962) [-335.142] (-335.172) * (-335.792) [-334.324] (-335.737) (-336.061) -- 0:01:08
42500 -- [-334.648] (-336.911) (-337.838) (-334.876) * (-335.306) (-342.267) (-336.581) [-335.109] -- 0:01:07
43000 -- (-340.005) (-337.551) [-335.564] (-335.637) * [-336.967] (-337.074) (-336.828) (-337.416) -- 0:01:06
43500 -- (-338.150) (-335.922) (-335.024) [-337.169] * (-338.679) [-335.479] (-339.897) (-338.556) -- 0:01:05
44000 -- [-337.147] (-334.424) (-336.327) (-338.608) * (-334.828) [-335.673] (-341.394) (-342.233) -- 0:01:05
44500 -- (-335.623) (-338.227) (-337.497) [-335.240] * (-336.273) [-335.096] (-336.703) (-338.998) -- 0:01:04
45000 -- (-335.480) [-337.488] (-335.821) (-338.359) * (-334.099) (-336.710) (-338.378) [-337.244] -- 0:01:03
Average standard deviation of split frequencies: 0.025154
45500 -- (-343.299) (-337.113) [-336.513] (-336.050) * (-334.762) [-339.483] (-337.079) (-336.397) -- 0:01:02
46000 -- (-338.646) (-340.332) (-338.105) [-336.037] * (-335.399) (-336.040) (-339.114) [-334.889] -- 0:01:02
46500 -- (-343.290) [-338.989] (-337.771) (-334.825) * (-334.829) (-337.068) [-336.114] (-334.752) -- 0:01:01
47000 -- (-339.620) [-334.362] (-335.441) (-336.694) * (-336.687) (-337.905) (-338.841) [-334.883] -- 0:01:00
47500 -- (-337.135) (-335.419) [-335.025] (-335.759) * (-335.068) (-338.235) (-335.001) [-335.609] -- 0:01:00
48000 -- [-334.776] (-335.732) (-335.714) (-339.457) * (-335.451) (-337.734) [-334.693] (-335.982) -- 0:00:59
48500 -- (-335.151) (-338.126) [-333.971] (-339.083) * (-338.371) (-338.218) (-335.639) [-336.484] -- 0:00:58
49000 -- (-336.008) [-335.443] (-334.483) (-336.154) * (-336.242) [-338.655] (-339.250) (-335.027) -- 0:00:58
49500 -- (-337.620) [-341.734] (-334.220) (-337.657) * (-338.689) (-337.063) (-337.440) [-337.004] -- 0:00:57
50000 -- (-335.110) [-338.308] (-334.908) (-334.288) * (-335.789) (-338.762) (-337.459) [-335.509] -- 0:00:57
Average standard deviation of split frequencies: 0.029871
50500 -- [-337.148] (-336.920) (-334.853) (-337.280) * (-334.834) (-338.078) [-337.048] (-336.687) -- 0:00:56
51000 -- [-335.226] (-335.069) (-334.606) (-337.671) * [-335.679] (-334.946) (-339.106) (-338.268) -- 0:00:55
51500 -- (-334.413) [-336.694] (-336.004) (-335.277) * (-336.380) (-334.898) (-338.588) [-335.188] -- 0:00:55
52000 -- (-337.214) (-336.375) [-335.640] (-337.081) * [-336.661] (-333.945) (-339.184) (-335.202) -- 0:00:54
52500 -- (-334.692) (-334.675) [-337.831] (-338.147) * (-334.240) (-334.449) (-335.105) [-335.081] -- 0:00:54
53000 -- [-335.385] (-336.569) (-337.240) (-337.744) * (-335.720) (-334.877) (-336.624) [-337.014] -- 0:00:53
53500 -- (-334.659) (-336.049) [-336.957] (-336.402) * (-334.341) (-336.810) (-334.960) [-334.606] -- 0:00:53
54000 -- (-335.587) [-334.658] (-336.831) (-336.702) * (-337.631) (-335.985) [-335.701] (-335.435) -- 0:00:52
54500 -- (-338.663) (-334.780) (-340.659) [-339.039] * (-340.221) (-338.395) [-337.958] (-336.318) -- 0:01:09
55000 -- (-337.599) (-334.293) [-335.556] (-334.434) * (-336.851) (-335.138) (-335.559) [-335.596] -- 0:01:08
Average standard deviation of split frequencies: 0.031900
55500 -- (-336.814) (-336.535) [-336.969] (-335.752) * (-336.573) [-335.001] (-335.778) (-335.924) -- 0:01:08
56000 -- [-336.242] (-339.131) (-337.837) (-335.370) * [-338.307] (-334.550) (-334.422) (-336.259) -- 0:01:07
56500 -- (-343.085) [-341.804] (-336.751) (-339.506) * [-337.825] (-337.452) (-335.750) (-339.336) -- 0:01:06
57000 -- (-340.174) (-339.530) [-338.070] (-340.174) * (-334.430) (-335.819) (-334.954) [-338.449] -- 0:01:06
57500 -- (-335.404) (-336.908) [-336.205] (-334.617) * (-335.470) [-336.041] (-334.357) (-336.933) -- 0:01:05
58000 -- (-338.625) (-338.726) [-335.940] (-339.603) * (-334.465) (-335.790) [-335.324] (-335.853) -- 0:01:04
58500 -- (-336.301) (-341.781) (-335.885) [-337.476] * (-334.832) [-336.980] (-336.526) (-334.633) -- 0:01:04
59000 -- (-334.519) [-336.558] (-335.165) (-337.163) * (-336.055) (-335.983) (-334.381) [-336.012] -- 0:01:03
59500 -- [-336.126] (-334.422) (-337.127) (-338.686) * (-336.331) (-336.972) [-337.251] (-335.589) -- 0:01:03
60000 -- (-339.897) (-337.237) [-334.763] (-336.732) * (-334.112) (-340.697) [-335.105] (-341.211) -- 0:01:02
Average standard deviation of split frequencies: 0.033944
60500 -- [-340.087] (-334.024) (-337.158) (-336.061) * [-336.691] (-338.822) (-335.526) (-336.505) -- 0:01:02
61000 -- (-336.916) (-336.434) [-335.974] (-337.412) * (-338.088) (-339.415) [-336.721] (-336.355) -- 0:01:01
61500 -- [-334.223] (-336.817) (-343.608) (-336.495) * (-334.247) (-334.938) (-336.414) [-340.204] -- 0:01:01
62000 -- (-337.080) [-336.843] (-337.952) (-333.901) * (-335.920) [-334.856] (-337.402) (-336.679) -- 0:01:00
62500 -- [-339.281] (-338.485) (-337.280) (-337.812) * (-337.591) (-336.593) (-335.138) [-334.105] -- 0:01:00
63000 -- (-335.636) (-336.936) (-340.687) [-334.737] * (-335.047) (-334.612) (-334.953) [-335.766] -- 0:00:59
63500 -- (-337.798) (-333.944) (-335.456) [-334.694] * (-336.281) [-334.988] (-337.496) (-338.362) -- 0:00:58
64000 -- [-340.665] (-334.031) (-335.206) (-335.995) * (-335.382) (-335.432) (-335.693) [-337.503] -- 0:00:58
64500 -- (-333.788) (-337.248) (-335.586) [-337.849] * (-334.082) (-334.403) [-335.234] (-339.281) -- 0:00:58
65000 -- (-334.218) [-336.006] (-334.307) (-338.010) * [-340.245] (-335.654) (-336.626) (-335.346) -- 0:00:57
Average standard deviation of split frequencies: 0.033672
65500 -- (-336.547) [-334.776] (-336.349) (-338.489) * (-336.259) [-336.025] (-339.819) (-336.004) -- 0:00:57
66000 -- (-338.959) (-334.141) [-335.236] (-335.550) * [-334.931] (-336.524) (-334.704) (-336.280) -- 0:00:56
66500 -- [-337.182] (-336.390) (-335.594) (-337.921) * (-336.273) (-336.601) (-337.247) [-337.462] -- 0:00:56
67000 -- (-335.779) [-335.347] (-335.796) (-338.512) * (-335.115) (-336.174) [-336.185] (-337.023) -- 0:00:55
67500 -- (-336.055) [-336.477] (-337.666) (-335.718) * (-335.720) [-338.931] (-338.836) (-337.220) -- 0:00:55
68000 -- (-335.990) (-336.135) [-339.249] (-335.811) * (-334.969) [-339.532] (-335.087) (-335.896) -- 0:00:54
68500 -- (-335.475) (-334.242) (-340.675) [-335.980] * [-336.687] (-336.218) (-335.628) (-342.190) -- 0:00:54
69000 -- [-334.168] (-334.628) (-338.103) (-339.908) * [-337.057] (-337.367) (-334.979) (-341.710) -- 0:00:53
69500 -- (-338.874) (-337.410) (-339.688) [-338.059] * (-336.338) (-335.840) [-339.744] (-337.170) -- 0:00:53
70000 -- (-339.234) [-335.451] (-340.159) (-337.266) * [-335.714] (-336.725) (-336.959) (-336.647) -- 0:00:53
Average standard deviation of split frequencies: 0.031950
70500 -- (-343.235) [-334.752] (-336.630) (-336.439) * (-335.652) (-336.362) [-335.464] (-336.504) -- 0:00:52
71000 -- (-340.116) (-336.211) (-336.246) [-334.877] * (-340.060) [-334.519] (-337.008) (-335.980) -- 0:00:52
71500 -- (-336.088) (-337.999) (-336.515) [-334.519] * [-336.002] (-335.658) (-335.425) (-335.407) -- 0:01:04
72000 -- (-337.078) [-335.209] (-335.246) (-334.886) * (-335.674) (-337.157) [-335.937] (-337.037) -- 0:01:04
72500 -- (-338.575) (-338.899) (-336.356) [-336.487] * (-337.375) [-335.608] (-335.555) (-336.347) -- 0:01:03
73000 -- (-335.454) (-340.250) (-336.863) [-335.692] * (-334.846) [-335.069] (-335.294) (-339.098) -- 0:01:03
73500 -- [-336.381] (-341.250) (-336.766) (-335.060) * [-336.727] (-333.843) (-339.563) (-336.208) -- 0:01:03
74000 -- [-339.014] (-333.811) (-336.112) (-335.086) * [-336.384] (-334.176) (-337.555) (-337.090) -- 0:01:02
74500 -- (-338.607) (-335.391) (-338.299) [-334.509] * (-338.536) [-336.801] (-334.608) (-336.196) -- 0:01:02
75000 -- [-335.059] (-338.650) (-336.418) (-334.892) * [-335.400] (-335.198) (-336.965) (-335.820) -- 0:01:01
Average standard deviation of split frequencies: 0.032972
75500 -- (-335.291) [-336.053] (-335.905) (-334.973) * (-335.077) (-339.042) (-340.834) [-338.660] -- 0:01:01
76000 -- (-337.018) (-340.579) [-336.558] (-337.293) * (-336.656) (-334.628) (-337.595) [-334.681] -- 0:01:00
76500 -- (-344.236) (-337.598) [-334.319] (-334.729) * (-334.476) [-334.793] (-335.542) (-337.284) -- 0:01:00
77000 -- (-338.269) (-335.689) (-337.044) [-336.216] * [-336.927] (-335.427) (-335.528) (-339.122) -- 0:00:59
77500 -- (-336.555) [-337.400] (-335.670) (-335.178) * (-339.726) [-335.214] (-335.425) (-335.856) -- 0:00:59
78000 -- (-335.746) (-336.028) [-335.540] (-339.395) * (-334.911) (-337.524) [-335.496] (-337.708) -- 0:00:59
78500 -- (-336.479) (-334.491) [-336.252] (-338.687) * (-336.747) (-335.351) [-334.299] (-339.237) -- 0:00:58
79000 -- (-336.449) [-334.507] (-335.704) (-337.713) * [-336.275] (-334.611) (-336.439) (-334.544) -- 0:00:58
79500 -- (-336.475) (-335.215) (-336.519) [-334.747] * [-335.417] (-337.678) (-337.876) (-339.102) -- 0:00:57
80000 -- (-336.881) (-335.668) (-337.441) [-340.146] * [-337.622] (-334.609) (-337.460) (-335.110) -- 0:00:57
Average standard deviation of split frequencies: 0.031987
80500 -- (-338.150) (-334.344) [-337.855] (-337.548) * (-334.915) (-335.833) [-336.096] (-335.030) -- 0:00:57
81000 -- (-336.980) (-334.714) [-336.219] (-336.580) * (-338.454) [-336.678] (-335.980) (-335.512) -- 0:00:56
81500 -- (-339.854) [-337.226] (-337.941) (-337.074) * (-336.570) (-337.742) (-335.410) [-335.773] -- 0:00:56
82000 -- (-340.744) (-336.754) (-336.502) [-335.101] * (-338.922) (-338.622) (-334.116) [-335.709] -- 0:00:55
82500 -- (-336.260) [-334.677] (-337.273) (-335.442) * [-339.713] (-335.171) (-336.993) (-336.623) -- 0:00:55
83000 -- [-335.826] (-336.436) (-338.883) (-334.992) * [-338.355] (-335.719) (-334.810) (-336.581) -- 0:00:55
83500 -- [-335.732] (-336.371) (-339.576) (-336.784) * (-336.779) (-335.089) [-335.187] (-335.003) -- 0:00:54
84000 -- (-336.251) (-335.008) [-336.564] (-335.551) * (-335.732) [-334.360] (-335.041) (-335.747) -- 0:00:54
84500 -- [-335.709] (-336.434) (-336.821) (-335.762) * (-339.963) [-335.387] (-334.468) (-335.691) -- 0:00:54
85000 -- (-335.098) (-338.941) [-334.712] (-335.863) * (-337.896) (-335.675) (-336.066) [-335.703] -- 0:00:53
Average standard deviation of split frequencies: 0.030148
85500 -- (-335.592) [-335.904] (-335.507) (-337.305) * (-338.447) (-340.608) [-336.408] (-339.669) -- 0:00:53
86000 -- [-335.782] (-338.694) (-336.808) (-336.968) * (-336.795) (-334.955) (-340.285) [-336.008] -- 0:00:53
86500 -- [-335.304] (-335.611) (-334.124) (-335.618) * (-336.595) (-335.146) (-345.436) [-334.515] -- 0:00:52
87000 -- (-340.501) (-336.555) [-336.099] (-335.652) * (-334.202) (-335.186) (-340.500) [-335.988] -- 0:00:52
87500 -- (-336.043) (-337.329) (-336.193) [-335.113] * [-336.007] (-334.959) (-335.628) (-336.605) -- 0:00:52
88000 -- (-335.626) (-344.716) (-334.628) [-335.071] * (-335.118) [-335.509] (-334.410) (-335.928) -- 0:00:51
88500 -- [-336.483] (-339.630) (-337.162) (-335.095) * [-337.668] (-335.624) (-334.240) (-336.276) -- 0:01:01
89000 -- (-336.267) (-337.261) (-336.886) [-336.322] * (-337.488) (-334.753) (-335.870) [-339.784] -- 0:01:01
89500 -- [-336.679] (-338.678) (-337.453) (-334.567) * (-337.047) [-336.017] (-335.462) (-338.268) -- 0:01:01
90000 -- (-334.886) (-336.259) (-335.984) [-334.596] * (-336.889) [-335.893] (-336.376) (-337.505) -- 0:01:00
Average standard deviation of split frequencies: 0.028596
90500 -- [-336.930] (-334.414) (-338.340) (-335.725) * [-337.600] (-335.041) (-336.319) (-334.755) -- 0:01:00
91000 -- (-335.014) [-339.128] (-334.791) (-339.942) * [-337.992] (-334.358) (-342.602) (-334.591) -- 0:00:59
91500 -- (-335.115) (-338.396) (-339.450) [-337.624] * (-336.587) (-334.909) (-336.821) [-336.067] -- 0:00:59
92000 -- (-337.616) [-334.867] (-336.360) (-334.588) * [-340.235] (-335.575) (-334.172) (-335.256) -- 0:00:59
92500 -- (-337.350) (-335.812) (-337.140) [-337.145] * (-337.218) [-336.531] (-335.734) (-335.434) -- 0:00:58
93000 -- (-335.200) (-336.206) [-336.277] (-335.268) * (-335.621) (-338.247) [-335.230] (-336.562) -- 0:00:58
93500 -- [-336.117] (-337.158) (-344.252) (-338.905) * (-338.314) (-337.604) (-336.832) [-336.774] -- 0:00:58
94000 -- (-339.942) (-339.690) (-336.481) [-336.881] * (-334.641) (-337.204) (-335.177) [-342.531] -- 0:00:57
94500 -- (-341.724) (-337.482) [-335.766] (-336.195) * (-335.857) (-338.834) [-334.361] (-336.850) -- 0:00:57
95000 -- (-337.470) (-336.398) (-334.148) [-336.184] * (-335.445) (-343.140) [-334.704] (-336.658) -- 0:00:57
Average standard deviation of split frequencies: 0.027654
95500 -- (-335.373) [-334.833] (-336.892) (-336.599) * (-335.862) (-334.324) [-336.752] (-338.405) -- 0:00:56
96000 -- (-334.938) [-338.319] (-334.352) (-340.092) * [-334.488] (-334.498) (-337.565) (-335.170) -- 0:00:56
96500 -- (-334.829) [-339.795] (-334.067) (-337.093) * [-334.811] (-337.042) (-337.076) (-340.173) -- 0:00:56
97000 -- (-334.911) (-336.515) [-334.494] (-337.156) * (-335.599) [-337.417] (-334.633) (-335.490) -- 0:00:55
97500 -- [-334.809] (-334.340) (-334.811) (-336.702) * (-336.704) (-339.656) (-335.301) [-334.794] -- 0:00:55
98000 -- (-339.097) (-335.175) [-334.683] (-334.258) * (-336.573) (-335.948) [-339.034] (-334.477) -- 0:00:55
98500 -- (-335.984) [-334.270] (-335.876) (-337.970) * (-338.169) (-336.290) (-338.037) [-335.441] -- 0:00:54
99000 -- [-336.546] (-342.354) (-335.770) (-335.760) * (-335.444) [-335.054] (-335.251) (-336.326) -- 0:00:54
99500 -- (-336.208) (-341.203) [-336.145] (-336.110) * (-336.295) (-335.510) [-336.615] (-343.276) -- 0:00:54
100000 -- (-333.954) (-334.791) [-336.060] (-336.397) * [-335.593] (-338.548) (-335.869) (-337.931) -- 0:00:54
Average standard deviation of split frequencies: 0.024400
100500 -- (-334.568) (-335.650) (-337.168) [-335.180] * (-337.843) (-335.577) (-336.332) [-336.853] -- 0:00:53
101000 -- (-336.102) (-333.901) (-339.874) [-334.320] * [-336.903] (-336.286) (-340.087) (-335.961) -- 0:00:53
101500 -- (-340.351) [-334.733] (-339.248) (-334.354) * (-335.762) (-338.578) [-335.189] (-336.504) -- 0:00:53
102000 -- (-334.618) [-337.485] (-338.954) (-335.411) * (-339.092) (-336.182) [-336.471] (-335.120) -- 0:00:52
102500 -- (-336.107) (-337.558) [-335.789] (-341.903) * (-340.719) (-338.873) [-339.375] (-336.359) -- 0:00:52
103000 -- (-336.982) [-344.175] (-336.770) (-339.038) * (-336.554) (-339.823) [-337.194] (-336.869) -- 0:00:52
103500 -- (-335.741) (-338.854) (-338.447) [-335.123] * (-337.029) [-335.529] (-341.836) (-334.654) -- 0:00:51
104000 -- [-336.720] (-335.261) (-338.267) (-337.031) * (-335.057) [-334.400] (-341.848) (-337.120) -- 0:00:51
104500 -- (-335.454) (-337.890) (-336.674) [-336.619] * [-339.261] (-335.949) (-338.230) (-334.417) -- 0:00:51
105000 -- (-333.843) (-338.179) [-335.284] (-335.648) * [-336.378] (-336.110) (-336.808) (-336.573) -- 0:00:51
Average standard deviation of split frequencies: 0.022014
105500 -- [-334.229] (-339.851) (-337.915) (-336.357) * [-336.811] (-337.991) (-341.102) (-335.764) -- 0:00:59
106000 -- (-334.503) (-336.201) [-335.348] (-336.060) * (-337.070) (-340.558) (-334.506) [-338.899] -- 0:00:59
106500 -- (-335.105) (-337.504) [-335.093] (-337.108) * [-334.707] (-340.941) (-337.534) (-335.509) -- 0:00:58
107000 -- [-335.162] (-335.162) (-335.599) (-336.827) * (-336.277) (-339.098) [-335.093] (-337.618) -- 0:00:58
107500 -- (-335.259) (-334.999) [-336.184] (-336.466) * (-334.192) (-337.965) (-335.564) [-336.592] -- 0:00:58
108000 -- (-337.626) (-335.515) [-335.462] (-334.809) * [-335.308] (-338.569) (-337.524) (-336.680) -- 0:00:57
108500 -- (-334.856) (-338.763) (-335.843) [-333.991] * [-336.879] (-337.777) (-338.154) (-337.179) -- 0:00:57
109000 -- [-335.088] (-339.747) (-336.917) (-335.748) * [-334.713] (-334.120) (-339.169) (-340.391) -- 0:00:57
109500 -- (-337.777) (-335.293) [-334.474] (-336.926) * [-334.995] (-338.119) (-334.364) (-337.568) -- 0:00:56
110000 -- [-338.923] (-336.226) (-337.954) (-333.818) * (-339.126) [-336.976] (-337.001) (-336.506) -- 0:00:56
Average standard deviation of split frequencies: 0.021747
110500 -- (-336.277) [-338.043] (-336.944) (-334.933) * (-334.511) [-336.310] (-336.285) (-335.363) -- 0:00:56
111000 -- (-337.040) (-338.905) (-337.131) [-336.051] * (-335.455) [-335.424] (-334.986) (-335.294) -- 0:00:56
111500 -- [-334.626] (-335.268) (-335.055) (-341.721) * [-336.128] (-335.441) (-339.003) (-335.404) -- 0:00:55
112000 -- (-335.878) (-336.639) (-340.495) [-334.918] * (-338.791) (-334.907) (-335.774) [-336.067] -- 0:00:55
112500 -- (-334.883) [-334.457] (-336.101) (-334.304) * (-335.044) [-336.469] (-334.733) (-336.163) -- 0:00:55
113000 -- [-336.027] (-336.090) (-338.617) (-335.374) * [-336.898] (-337.615) (-335.993) (-341.836) -- 0:00:54
113500 -- (-339.817) (-334.671) (-341.389) [-337.692] * (-344.624) (-335.178) [-335.472] (-338.560) -- 0:00:54
114000 -- (-335.481) (-336.051) [-336.508] (-335.405) * (-333.983) (-336.024) (-336.388) [-336.886] -- 0:00:54
114500 -- (-335.171) (-338.080) (-337.033) [-341.073] * (-338.031) (-335.738) [-334.466] (-335.361) -- 0:00:54
115000 -- (-337.688) (-337.524) [-338.522] (-337.947) * [-338.430] (-339.813) (-335.630) (-336.132) -- 0:00:53
Average standard deviation of split frequencies: 0.023527
115500 -- [-336.133] (-338.481) (-338.452) (-336.601) * (-336.312) (-335.556) [-336.524] (-336.976) -- 0:00:53
116000 -- (-336.197) (-335.540) (-336.992) [-336.189] * [-337.669] (-336.083) (-335.101) (-336.841) -- 0:00:53
116500 -- [-335.737] (-337.455) (-333.885) (-335.697) * (-337.661) [-335.714] (-335.368) (-334.651) -- 0:00:53
117000 -- [-334.854] (-334.678) (-334.254) (-336.751) * (-338.540) (-334.765) (-334.970) [-336.742] -- 0:00:52
117500 -- [-334.497] (-334.984) (-335.359) (-336.645) * (-334.813) (-334.983) [-336.385] (-334.474) -- 0:00:52
118000 -- (-334.566) (-339.070) (-338.990) [-340.167] * (-335.148) (-335.696) (-333.997) [-335.509] -- 0:00:52
118500 -- (-337.762) (-337.192) (-335.529) [-334.781] * (-337.305) [-334.671] (-335.942) (-334.590) -- 0:00:52
119000 -- [-337.035] (-335.821) (-338.377) (-335.186) * [-336.778] (-337.827) (-335.299) (-334.112) -- 0:00:51
119500 -- (-336.106) (-335.934) [-335.271] (-334.705) * (-336.082) (-337.926) [-338.332] (-335.135) -- 0:00:51
120000 -- (-336.165) (-334.857) (-336.672) [-334.676] * (-335.678) [-342.604] (-336.343) (-335.746) -- 0:00:51
Average standard deviation of split frequencies: 0.024262
120500 -- [-336.681] (-338.270) (-339.336) (-335.832) * (-335.031) (-334.458) [-336.844] (-337.755) -- 0:00:51
121000 -- (-336.728) [-336.811] (-339.449) (-335.467) * (-334.354) [-339.584] (-335.610) (-335.996) -- 0:00:58
121500 -- (-335.753) [-334.779] (-334.639) (-334.711) * (-334.784) [-334.915] (-334.107) (-340.079) -- 0:00:57
122000 -- [-336.767] (-336.342) (-336.366) (-340.942) * (-340.420) [-336.797] (-336.706) (-334.818) -- 0:00:57
122500 -- (-334.930) (-340.662) (-335.822) [-334.713] * (-337.243) [-336.587] (-339.383) (-342.250) -- 0:00:57
123000 -- (-335.575) [-334.919] (-335.120) (-338.681) * [-336.203] (-340.043) (-343.299) (-338.240) -- 0:00:57
123500 -- (-335.999) [-337.274] (-335.559) (-338.978) * (-336.006) (-336.802) (-339.985) [-335.799] -- 0:00:56
124000 -- (-334.859) [-336.181] (-334.226) (-334.893) * (-334.822) (-337.064) (-334.460) [-334.631] -- 0:00:56
124500 -- (-334.699) (-336.416) (-334.893) [-335.466] * (-336.016) (-335.577) [-336.961] (-335.248) -- 0:00:56
125000 -- (-335.103) (-336.207) (-336.043) [-334.839] * [-335.897] (-342.754) (-339.319) (-337.400) -- 0:00:56
Average standard deviation of split frequencies: 0.023383
125500 -- (-334.727) (-337.054) [-336.885] (-334.714) * (-342.043) (-346.038) (-336.554) [-336.476] -- 0:00:55
126000 -- (-334.951) [-336.399] (-335.508) (-334.583) * (-334.193) (-334.598) [-334.982] (-336.711) -- 0:00:55
126500 -- [-333.817] (-337.007) (-334.986) (-337.050) * (-338.221) (-335.460) (-334.785) [-335.706] -- 0:00:55
127000 -- [-334.366] (-338.248) (-338.029) (-335.930) * (-338.851) (-337.528) (-335.999) [-336.406] -- 0:00:54
127500 -- (-338.070) (-336.752) (-335.262) [-335.323] * (-334.859) (-334.005) (-335.098) [-336.812] -- 0:00:54
128000 -- (-338.573) [-335.140] (-335.300) (-339.625) * (-335.901) [-334.893] (-335.525) (-337.476) -- 0:00:54
128500 -- (-335.726) (-335.732) (-334.436) [-336.898] * (-335.064) (-334.748) [-337.492] (-336.300) -- 0:00:54
129000 -- [-334.139] (-334.628) (-337.656) (-342.787) * (-335.092) (-335.536) (-335.001) [-337.887] -- 0:00:54
129500 -- (-335.663) (-335.054) (-336.348) [-337.118] * (-338.039) (-334.332) (-335.467) [-338.752] -- 0:00:53
130000 -- (-338.620) (-337.023) (-335.560) [-337.833] * (-334.729) [-337.580] (-335.491) (-343.769) -- 0:00:53
Average standard deviation of split frequencies: 0.024893
130500 -- (-334.958) (-338.746) [-337.579] (-336.355) * (-334.931) [-334.458] (-339.601) (-341.463) -- 0:00:53
131000 -- (-336.516) (-334.866) (-335.863) [-336.488] * (-338.205) (-335.853) [-337.880] (-336.712) -- 0:00:53
131500 -- [-334.619] (-336.248) (-334.594) (-335.381) * (-336.506) (-337.579) (-338.859) [-335.976] -- 0:00:52
132000 -- (-335.787) [-335.250] (-336.772) (-334.982) * (-335.412) [-334.615] (-336.396) (-336.036) -- 0:00:52
132500 -- (-336.083) (-336.833) (-340.885) [-336.653] * [-337.926] (-339.722) (-337.427) (-336.023) -- 0:00:52
133000 -- (-335.167) (-337.473) (-335.506) [-334.575] * (-335.125) (-337.386) [-337.193] (-335.391) -- 0:00:52
133500 -- (-339.038) [-339.437] (-342.042) (-335.033) * (-343.838) (-337.076) (-335.675) [-335.306] -- 0:00:51
134000 -- (-334.742) (-337.855) [-335.393] (-339.090) * (-334.769) (-338.012) [-334.098] (-334.654) -- 0:00:51
134500 -- [-338.399] (-337.214) (-335.385) (-338.385) * [-337.158] (-335.758) (-334.799) (-335.997) -- 0:00:51
135000 -- (-338.299) (-334.170) (-336.147) [-346.900] * [-336.214] (-337.060) (-335.454) (-334.995) -- 0:00:51
Average standard deviation of split frequencies: 0.026863
135500 -- (-336.662) (-335.000) [-337.586] (-338.625) * [-337.463] (-337.871) (-335.136) (-336.242) -- 0:00:51
136000 -- [-335.849] (-338.941) (-336.165) (-335.765) * [-334.658] (-337.629) (-337.946) (-335.645) -- 0:00:50
136500 -- (-337.592) (-337.870) [-336.541] (-340.556) * (-336.422) (-336.393) (-337.172) [-336.370] -- 0:00:50
137000 -- [-336.437] (-335.992) (-338.526) (-336.055) * (-339.167) (-340.929) (-335.254) [-335.704] -- 0:00:50
137500 -- (-336.427) (-337.306) (-340.048) [-335.290] * (-337.490) (-335.311) (-336.435) [-334.386] -- 0:00:50
138000 -- (-336.501) (-338.761) (-336.055) [-334.763] * [-334.072] (-335.960) (-336.634) (-335.422) -- 0:00:56
138500 -- (-336.660) (-334.999) (-335.191) [-336.005] * (-336.409) [-337.627] (-335.062) (-337.293) -- 0:00:55
139000 -- (-334.765) (-334.793) (-338.570) [-334.923] * (-337.911) [-335.398] (-335.619) (-336.287) -- 0:00:55
139500 -- (-337.935) (-336.937) (-336.293) [-334.087] * (-336.309) (-334.994) (-336.577) [-335.705] -- 0:00:55
140000 -- (-339.447) [-340.578] (-336.498) (-334.698) * [-333.986] (-334.717) (-334.422) (-335.730) -- 0:00:55
Average standard deviation of split frequencies: 0.025302
140500 -- (-334.755) (-335.978) (-335.770) [-335.104] * (-334.368) (-335.777) (-336.520) [-336.586] -- 0:00:55
141000 -- (-340.752) (-336.335) (-336.077) [-335.107] * (-336.949) (-336.195) [-336.294] (-338.419) -- 0:00:54
141500 -- (-335.354) (-335.772) [-338.234] (-334.837) * (-338.271) (-339.448) (-336.007) [-337.675] -- 0:00:54
142000 -- (-340.015) (-337.232) [-334.579] (-334.560) * (-336.676) (-339.370) (-335.481) [-338.578] -- 0:00:54
142500 -- (-336.518) (-340.097) (-335.064) [-335.271] * (-339.686) [-336.454] (-338.887) (-336.465) -- 0:00:54
143000 -- (-338.427) (-337.166) (-334.757) [-335.602] * (-334.801) (-334.310) (-336.193) [-336.983] -- 0:00:53
143500 -- [-335.629] (-337.420) (-336.947) (-336.325) * (-335.097) [-334.018] (-336.319) (-334.672) -- 0:00:53
144000 -- [-335.382] (-335.223) (-340.411) (-339.734) * (-335.339) (-337.743) (-339.287) [-335.481] -- 0:00:53
144500 -- [-338.138] (-334.533) (-336.936) (-334.357) * [-338.607] (-334.852) (-337.087) (-336.815) -- 0:00:53
145000 -- (-338.449) (-341.631) [-336.327] (-336.379) * (-338.401) (-340.401) [-334.622] (-340.303) -- 0:00:53
Average standard deviation of split frequencies: 0.021218
145500 -- (-337.519) (-340.466) [-338.054] (-335.564) * (-334.317) (-334.606) [-334.226] (-335.923) -- 0:00:52
146000 -- [-337.287] (-338.114) (-336.043) (-336.310) * (-334.416) (-334.616) (-336.597) [-339.100] -- 0:00:52
146500 -- [-335.539] (-334.445) (-340.530) (-335.731) * (-335.582) (-336.408) [-335.047] (-341.388) -- 0:00:52
147000 -- (-337.520) (-337.405) (-335.746) [-335.267] * (-335.782) [-335.267] (-335.276) (-337.422) -- 0:00:52
147500 -- (-336.750) (-337.896) [-335.446] (-337.192) * [-335.480] (-336.309) (-339.426) (-337.807) -- 0:00:52
148000 -- (-338.884) [-335.216] (-336.508) (-340.757) * [-334.380] (-336.590) (-339.283) (-337.440) -- 0:00:51
148500 -- [-335.072] (-337.050) (-334.552) (-336.913) * (-336.345) (-335.516) (-341.299) [-336.408] -- 0:00:51
149000 -- (-336.895) (-333.967) [-337.744] (-335.111) * (-338.007) [-334.608] (-337.485) (-339.694) -- 0:00:51
149500 -- [-334.844] (-336.173) (-335.475) (-337.023) * [-335.195] (-336.324) (-336.966) (-335.792) -- 0:00:51
150000 -- (-335.040) (-336.760) [-335.860] (-335.688) * (-337.181) (-334.682) (-335.965) [-334.880] -- 0:00:51
Average standard deviation of split frequencies: 0.022058
150500 -- (-336.075) (-334.599) (-333.879) [-335.465] * (-337.440) (-335.425) (-334.515) [-335.329] -- 0:00:50
151000 -- (-337.185) (-334.875) (-334.910) [-337.245] * (-337.681) (-337.669) (-335.693) [-334.887] -- 0:00:50
151500 -- (-349.220) (-335.272) (-336.584) [-339.241] * [-334.466] (-336.038) (-337.274) (-335.592) -- 0:00:50
152000 -- (-349.250) [-334.908] (-335.578) (-335.329) * (-335.073) (-334.272) [-336.187] (-339.105) -- 0:00:50
152500 -- (-346.001) (-334.212) (-335.165) [-336.005] * (-335.378) (-335.852) (-334.169) [-336.370] -- 0:00:50
153000 -- (-343.208) [-338.638] (-334.308) (-335.525) * [-338.411] (-336.408) (-337.852) (-335.466) -- 0:00:49
153500 -- (-340.482) (-334.300) (-335.555) [-334.901] * (-337.355) (-337.281) [-334.350] (-334.699) -- 0:00:49
154000 -- (-340.219) (-336.579) [-338.676] (-335.250) * (-337.688) (-337.763) (-334.643) [-336.940] -- 0:00:49
154500 -- [-338.454] (-337.661) (-335.642) (-335.243) * (-336.732) (-336.087) [-335.145] (-335.498) -- 0:00:49
155000 -- [-337.494] (-336.437) (-335.918) (-335.163) * [-336.940] (-335.982) (-335.795) (-336.276) -- 0:00:54
Average standard deviation of split frequencies: 0.020246
155500 -- [-342.597] (-337.215) (-337.289) (-336.185) * (-335.792) [-336.018] (-337.377) (-336.935) -- 0:00:54
156000 -- (-336.382) (-337.296) [-335.662] (-338.534) * [-336.084] (-338.521) (-336.003) (-336.918) -- 0:00:54
156500 -- [-340.851] (-337.190) (-336.088) (-335.677) * [-335.226] (-335.431) (-337.895) (-337.336) -- 0:00:53
157000 -- [-335.962] (-337.901) (-334.882) (-336.143) * (-335.481) (-339.390) [-336.579] (-335.392) -- 0:00:53
157500 -- (-336.637) [-335.050] (-336.382) (-336.096) * (-339.624) (-335.364) [-337.140] (-338.055) -- 0:00:53
158000 -- (-335.894) (-335.312) (-337.023) [-334.775] * [-336.906] (-335.465) (-337.107) (-335.932) -- 0:00:53
158500 -- (-335.561) (-335.337) (-339.609) [-334.402] * [-337.383] (-333.993) (-335.402) (-336.073) -- 0:00:53
159000 -- (-336.922) (-336.226) [-336.290] (-334.627) * (-340.799) [-335.981] (-335.312) (-336.807) -- 0:00:52
159500 -- [-334.827] (-336.565) (-335.123) (-336.103) * (-335.015) (-336.201) (-342.295) [-334.022] -- 0:00:52
160000 -- (-334.700) [-334.727] (-335.987) (-336.677) * (-337.811) (-334.789) (-334.303) [-334.138] -- 0:00:52
Average standard deviation of split frequencies: 0.020701
160500 -- (-336.062) [-338.167] (-335.317) (-335.550) * (-338.535) (-335.133) [-334.128] (-337.988) -- 0:00:52
161000 -- (-336.680) (-339.802) (-336.435) [-334.902] * (-338.537) [-334.770] (-334.254) (-335.254) -- 0:00:52
161500 -- (-335.996) [-336.087] (-335.266) (-338.682) * [-334.086] (-336.166) (-334.424) (-334.323) -- 0:00:51
162000 -- (-336.824) [-334.488] (-344.809) (-334.727) * [-337.537] (-339.625) (-334.411) (-335.967) -- 0:00:51
162500 -- (-338.338) (-335.751) [-339.066] (-337.488) * (-336.269) (-334.685) [-336.474] (-335.008) -- 0:00:51
163000 -- (-343.295) [-334.366] (-336.594) (-335.597) * (-335.394) (-335.164) (-334.103) [-336.733] -- 0:00:51
163500 -- (-337.637) (-335.496) (-337.091) [-334.993] * [-334.655] (-334.894) (-336.585) (-337.843) -- 0:00:51
164000 -- [-335.336] (-335.430) (-339.446) (-336.686) * (-336.820) (-336.353) [-336.580] (-338.774) -- 0:00:50
164500 -- [-334.664] (-338.586) (-335.892) (-335.839) * [-336.791] (-339.890) (-337.589) (-336.982) -- 0:00:50
165000 -- (-334.459) (-334.724) [-334.561] (-338.598) * (-335.300) (-336.405) (-336.216) [-336.370] -- 0:00:50
Average standard deviation of split frequencies: 0.020730
165500 -- (-335.513) (-335.678) [-336.925] (-338.078) * (-335.521) (-342.242) (-335.624) [-335.007] -- 0:00:50
166000 -- (-335.734) (-339.125) [-336.569] (-337.227) * [-335.891] (-340.117) (-334.414) (-338.966) -- 0:00:50
166500 -- (-335.612) [-335.072] (-336.596) (-339.213) * [-336.056] (-342.156) (-334.408) (-335.286) -- 0:00:50
167000 -- (-336.820) [-338.020] (-334.197) (-338.973) * (-335.943) [-336.423] (-337.670) (-335.779) -- 0:00:49
167500 -- [-335.755] (-334.904) (-336.361) (-337.987) * (-334.327) (-334.244) (-340.270) [-334.257] -- 0:00:49
168000 -- [-334.211] (-335.013) (-334.754) (-339.016) * (-334.841) (-336.350) [-336.393] (-337.360) -- 0:00:49
168500 -- (-337.565) (-335.683) (-336.416) [-340.251] * (-335.781) (-336.177) (-334.499) [-339.224] -- 0:00:49
169000 -- (-334.789) [-334.791] (-334.499) (-337.850) * [-334.621] (-334.329) (-333.918) (-338.046) -- 0:00:49
169500 -- (-334.890) (-335.250) (-334.503) [-335.795] * (-335.504) [-334.335] (-336.385) (-335.271) -- 0:00:48
170000 -- (-335.662) (-334.434) (-335.822) [-334.871] * (-334.978) (-339.611) [-334.464] (-336.424) -- 0:00:48
Average standard deviation of split frequencies: 0.021225
170500 -- [-335.046] (-334.166) (-337.992) (-336.585) * [-341.699] (-336.127) (-335.995) (-334.458) -- 0:00:48
171000 -- [-333.909] (-337.392) (-335.764) (-337.640) * (-337.967) (-333.772) [-338.901] (-337.384) -- 0:00:48
171500 -- (-335.235) (-334.466) (-335.870) [-337.302] * (-334.481) (-337.139) (-336.114) [-335.941] -- 0:00:48
172000 -- (-334.423) (-334.226) (-340.815) [-336.217] * (-338.093) (-339.691) [-337.090] (-335.177) -- 0:00:52
172500 -- [-336.664] (-336.306) (-341.455) (-336.837) * [-335.972] (-336.749) (-340.268) (-335.585) -- 0:00:52
173000 -- (-334.641) (-337.459) [-338.596] (-334.570) * (-334.950) (-338.027) [-335.194] (-335.401) -- 0:00:52
173500 -- [-335.375] (-335.547) (-335.736) (-336.897) * [-337.997] (-336.973) (-336.021) (-338.181) -- 0:00:52
174000 -- (-337.278) (-335.756) (-336.726) [-335.509] * [-336.507] (-335.585) (-337.353) (-342.540) -- 0:00:52
174500 -- (-334.646) [-334.947] (-337.294) (-335.247) * [-335.137] (-336.229) (-334.877) (-344.656) -- 0:00:52
175000 -- (-335.202) (-335.931) [-335.452] (-337.779) * [-336.238] (-334.874) (-340.609) (-339.925) -- 0:00:51
Average standard deviation of split frequencies: 0.021874
175500 -- (-335.186) (-337.475) (-336.825) [-337.480] * (-334.319) (-334.323) [-342.507] (-339.099) -- 0:00:51
176000 -- (-335.968) (-340.152) (-337.456) [-334.641] * (-336.576) (-334.634) (-336.335) [-339.679] -- 0:00:51
176500 -- (-337.504) (-339.573) (-336.084) [-339.287] * [-337.105] (-338.278) (-334.715) (-339.512) -- 0:00:51
177000 -- (-342.017) [-337.696] (-337.207) (-336.443) * (-339.488) (-335.543) (-334.878) [-334.762] -- 0:00:51
177500 -- (-334.748) (-335.070) (-340.819) [-336.824] * (-337.419) (-335.199) [-337.252] (-334.374) -- 0:00:50
178000 -- (-334.363) (-336.951) (-336.497) [-335.461] * (-337.633) (-335.179) (-337.469) [-335.039] -- 0:00:50
178500 -- (-335.351) [-337.156] (-337.732) (-334.922) * (-337.754) [-338.883] (-338.321) (-336.849) -- 0:00:50
179000 -- (-339.886) [-334.332] (-339.240) (-334.479) * (-337.886) [-335.889] (-337.804) (-336.063) -- 0:00:50
179500 -- (-338.039) [-334.651] (-334.396) (-335.127) * (-335.217) (-335.047) [-336.842] (-336.584) -- 0:00:50
180000 -- [-336.356] (-334.645) (-335.461) (-335.613) * [-338.072] (-335.301) (-334.415) (-342.640) -- 0:00:50
Average standard deviation of split frequencies: 0.021795
180500 -- [-335.055] (-334.669) (-334.800) (-338.285) * (-334.893) [-336.228] (-341.816) (-335.599) -- 0:00:49
181000 -- (-334.172) (-336.400) [-334.190] (-335.571) * (-339.111) [-337.129] (-338.883) (-335.717) -- 0:00:49
181500 -- (-334.604) (-334.620) [-335.293] (-338.593) * (-339.818) (-336.527) [-337.577] (-336.777) -- 0:00:49
182000 -- [-335.080] (-336.483) (-335.409) (-336.486) * (-338.148) [-334.683] (-334.644) (-338.994) -- 0:00:49
182500 -- (-334.402) [-335.213] (-333.973) (-338.090) * (-340.575) (-335.696) (-337.645) [-334.254] -- 0:00:49
183000 -- (-342.168) (-334.797) (-335.848) [-336.007] * (-335.597) (-336.438) [-337.465] (-335.005) -- 0:00:49
183500 -- (-340.488) (-339.060) (-336.250) [-337.284] * (-336.558) (-336.399) (-342.855) [-336.217] -- 0:00:48
184000 -- [-335.492] (-335.412) (-334.738) (-335.501) * (-335.809) [-334.171] (-336.958) (-337.729) -- 0:00:48
184500 -- (-335.422) (-335.744) [-338.386] (-336.375) * [-334.606] (-337.854) (-335.067) (-338.078) -- 0:00:48
185000 -- (-334.360) (-335.303) (-333.766) [-335.990] * (-333.995) (-333.973) (-334.066) [-335.831] -- 0:00:48
Average standard deviation of split frequencies: 0.017994
185500 -- [-336.209] (-336.939) (-334.910) (-338.058) * (-336.812) (-334.437) (-337.691) [-335.195] -- 0:00:48
186000 -- [-336.303] (-336.768) (-337.170) (-335.711) * (-338.111) (-338.431) (-338.160) [-336.092] -- 0:00:48
186500 -- (-335.937) [-336.243] (-334.728) (-334.199) * [-337.672] (-336.308) (-342.024) (-336.476) -- 0:00:47
187000 -- (-340.417) (-338.397) [-334.969] (-336.189) * (-336.204) [-336.952] (-338.106) (-335.434) -- 0:00:52
187500 -- (-335.623) (-335.027) [-337.216] (-335.094) * [-334.739] (-334.717) (-336.637) (-336.487) -- 0:00:52
188000 -- (-336.222) (-334.105) (-335.368) [-336.297] * (-335.902) (-340.829) (-335.023) [-336.830] -- 0:00:51
188500 -- (-335.949) (-338.305) (-342.823) [-334.697] * (-338.453) (-336.846) (-344.099) [-336.585] -- 0:00:51
189000 -- (-335.780) (-335.031) (-343.666) [-334.118] * (-335.874) (-334.688) [-338.324] (-336.946) -- 0:00:51
189500 -- [-335.693] (-334.621) (-336.964) (-335.283) * (-335.154) (-336.159) [-336.080] (-337.938) -- 0:00:51
190000 -- (-340.567) (-334.696) (-337.383) [-334.207] * (-334.810) (-334.486) [-336.979] (-334.732) -- 0:00:51
Average standard deviation of split frequencies: 0.017697
190500 -- (-334.775) (-336.570) [-335.661] (-336.803) * (-334.466) [-334.197] (-334.098) (-334.929) -- 0:00:50
191000 -- (-340.665) (-334.647) (-335.436) [-337.067] * (-335.002) (-334.069) (-335.916) [-335.769] -- 0:00:50
191500 -- (-335.815) (-334.282) (-337.983) [-334.236] * (-333.783) (-334.884) [-335.308] (-336.906) -- 0:00:50
192000 -- (-337.476) (-334.850) (-335.473) [-338.051] * (-336.412) (-336.152) (-335.973) [-337.943] -- 0:00:50
192500 -- [-337.968] (-336.824) (-334.468) (-339.206) * (-337.949) (-334.330) [-334.972] (-337.228) -- 0:00:50
193000 -- (-338.009) (-335.513) [-334.291] (-334.702) * [-334.919] (-338.396) (-335.110) (-338.849) -- 0:00:50
193500 -- [-339.663] (-335.800) (-339.607) (-337.292) * (-335.880) (-335.793) (-335.177) [-337.860] -- 0:00:50
194000 -- (-337.328) (-337.143) [-335.568] (-336.126) * (-336.738) (-338.627) [-334.204] (-335.287) -- 0:00:49
194500 -- (-336.265) [-339.776] (-334.465) (-335.788) * (-335.830) (-336.441) [-335.529] (-334.723) -- 0:00:49
195000 -- (-342.245) (-343.139) [-336.556] (-337.858) * (-336.777) [-337.619] (-333.955) (-334.636) -- 0:00:49
Average standard deviation of split frequencies: 0.017237
195500 -- (-337.056) (-336.784) (-335.248) [-335.756] * [-335.573] (-335.399) (-334.879) (-338.542) -- 0:00:49
196000 -- [-336.924] (-337.040) (-336.106) (-335.431) * (-335.805) [-335.756] (-335.614) (-339.014) -- 0:00:49
196500 -- (-341.337) (-336.146) (-334.483) [-334.974] * [-335.104] (-334.360) (-335.748) (-338.449) -- 0:00:49
197000 -- (-337.940) [-335.702] (-335.508) (-334.951) * [-336.583] (-336.020) (-337.201) (-338.318) -- 0:00:48
197500 -- (-336.169) (-336.501) (-334.200) [-335.463] * (-340.505) (-335.986) (-339.026) [-335.309] -- 0:00:48
198000 -- [-338.391] (-338.481) (-333.899) (-337.728) * [-338.618] (-335.083) (-341.299) (-336.104) -- 0:00:48
198500 -- (-338.107) (-339.932) [-335.709] (-336.998) * (-335.351) (-335.016) (-337.914) [-337.656] -- 0:00:48
199000 -- (-335.878) [-335.849] (-337.122) (-335.556) * (-336.551) (-337.652) (-337.578) [-336.146] -- 0:00:48
199500 -- (-336.041) [-336.076] (-338.259) (-334.579) * (-336.672) (-337.689) [-337.106] (-336.121) -- 0:00:48
200000 -- (-334.582) (-340.816) [-334.474] (-335.289) * (-336.104) (-335.390) (-337.911) [-334.880] -- 0:00:48
Average standard deviation of split frequencies: 0.016575
200500 -- (-334.791) [-337.457] (-337.050) (-335.328) * (-334.431) (-337.119) [-334.231] (-336.182) -- 0:00:47
201000 -- (-335.253) (-336.869) (-335.468) [-335.969] * [-335.559] (-336.412) (-342.645) (-336.710) -- 0:00:47
201500 -- (-343.716) (-334.951) [-334.351] (-340.748) * (-335.085) (-338.817) (-336.961) [-335.108] -- 0:00:47
202000 -- (-336.060) (-337.696) [-335.999] (-335.578) * (-334.631) (-339.044) (-335.268) [-336.162] -- 0:00:47
202500 -- (-338.918) (-335.158) [-335.595] (-335.118) * (-335.265) (-337.534) (-334.985) [-335.638] -- 0:00:47
203000 -- [-334.308] (-335.865) (-336.102) (-335.808) * (-335.561) [-337.115] (-336.377) (-340.561) -- 0:00:47
203500 -- (-336.456) [-335.571] (-337.423) (-335.396) * (-337.155) [-339.370] (-340.250) (-335.865) -- 0:00:46
204000 -- (-337.844) [-336.227] (-340.737) (-337.861) * (-335.952) (-339.344) (-337.896) [-336.194] -- 0:00:50
204500 -- (-335.761) [-335.052] (-340.844) (-337.767) * (-335.095) [-334.995] (-337.847) (-336.834) -- 0:00:50
205000 -- [-334.430] (-335.728) (-335.387) (-335.688) * (-334.422) (-339.491) (-336.264) [-335.185] -- 0:00:50
Average standard deviation of split frequencies: 0.016781
205500 -- (-336.573) (-334.627) [-337.007] (-337.765) * (-335.142) (-335.319) [-336.609] (-334.438) -- 0:00:50
206000 -- (-341.609) [-334.185] (-337.057) (-336.570) * (-335.520) [-334.666] (-334.910) (-341.781) -- 0:00:50
206500 -- (-336.240) [-334.503] (-335.570) (-334.907) * (-336.314) [-337.836] (-335.435) (-336.202) -- 0:00:49
207000 -- (-336.762) (-336.090) (-336.803) [-335.503] * (-335.264) (-337.463) [-335.523] (-335.712) -- 0:00:49
207500 -- (-335.366) (-337.749) [-333.885] (-334.386) * (-336.478) (-334.833) (-334.811) [-336.557] -- 0:00:49
208000 -- (-341.309) (-337.355) [-337.540] (-338.903) * (-336.375) (-340.526) [-335.119] (-335.519) -- 0:00:49
208500 -- [-338.003] (-337.613) (-334.307) (-336.845) * (-335.433) [-336.996] (-335.245) (-336.424) -- 0:00:49
209000 -- [-334.177] (-340.216) (-337.241) (-336.962) * [-336.941] (-339.438) (-335.280) (-337.958) -- 0:00:49
209500 -- (-335.403) (-335.116) [-335.000] (-337.797) * (-337.221) [-337.387] (-338.055) (-334.459) -- 0:00:49
210000 -- (-338.908) (-339.015) [-337.618] (-338.116) * (-338.038) (-336.867) [-335.829] (-334.064) -- 0:00:48
Average standard deviation of split frequencies: 0.014347
210500 -- (-336.707) (-337.553) [-334.819] (-337.415) * (-337.129) [-337.101] (-336.896) (-334.993) -- 0:00:48
211000 -- (-340.098) (-335.431) (-336.609) [-335.550] * (-336.828) [-336.154] (-340.332) (-337.957) -- 0:00:48
211500 -- (-338.950) [-334.286] (-337.268) (-335.444) * (-336.610) (-337.145) [-343.310] (-334.639) -- 0:00:48
212000 -- (-335.069) (-334.776) (-334.276) [-336.650] * [-336.215] (-335.958) (-335.853) (-335.953) -- 0:00:48
212500 -- (-334.413) (-335.936) (-337.951) [-339.146] * (-337.193) [-338.074] (-334.636) (-335.934) -- 0:00:48
213000 -- (-337.101) (-335.429) [-334.995] (-334.712) * (-337.077) [-339.817] (-334.893) (-337.121) -- 0:00:48
213500 -- [-338.943] (-335.794) (-336.815) (-336.032) * (-335.733) (-337.968) (-338.395) [-338.306] -- 0:00:47
214000 -- (-336.034) [-335.456] (-336.627) (-335.811) * [-338.685] (-334.411) (-338.124) (-335.813) -- 0:00:47
214500 -- (-338.104) (-334.735) (-334.862) [-335.470] * (-338.948) [-336.266] (-339.794) (-338.595) -- 0:00:47
215000 -- (-340.376) (-336.363) (-335.901) [-334.246] * [-341.179] (-335.471) (-342.123) (-335.790) -- 0:00:47
Average standard deviation of split frequencies: 0.014378
215500 -- (-344.286) (-338.427) [-333.999] (-336.032) * [-334.636] (-334.694) (-336.960) (-340.011) -- 0:00:47
216000 -- (-339.076) [-337.709] (-336.162) (-337.437) * (-336.974) (-336.690) [-333.797] (-339.031) -- 0:00:47
216500 -- (-335.764) (-334.767) [-336.710] (-335.609) * (-335.027) [-335.356] (-336.081) (-337.652) -- 0:00:47
217000 -- [-335.510] (-336.138) (-336.674) (-335.162) * (-336.655) (-334.991) [-335.234] (-340.946) -- 0:00:46
217500 -- [-335.550] (-335.709) (-336.008) (-337.690) * (-335.591) (-335.808) (-335.066) [-336.896] -- 0:00:46
218000 -- (-337.955) (-336.071) (-335.670) [-339.271] * (-335.437) [-336.187] (-337.929) (-335.973) -- 0:00:46
218500 -- (-337.263) (-336.406) [-337.002] (-337.068) * (-334.573) (-339.096) [-334.650] (-336.066) -- 0:00:46
219000 -- (-335.143) (-336.781) (-338.463) [-334.363] * (-335.325) (-336.121) (-334.407) [-339.124] -- 0:00:46
219500 -- (-335.839) [-336.664] (-333.948) (-336.458) * (-336.894) (-336.072) (-335.184) [-335.781] -- 0:00:46
220000 -- (-335.812) (-335.242) (-334.624) [-335.532] * (-336.673) (-337.043) [-337.424] (-335.149) -- 0:00:46
Average standard deviation of split frequencies: 0.015834
220500 -- (-334.136) [-334.928] (-334.607) (-337.065) * (-336.665) (-334.570) (-336.281) [-337.320] -- 0:00:45
221000 -- [-333.930] (-336.769) (-334.410) (-335.818) * (-339.588) (-336.697) [-335.382] (-337.469) -- 0:00:45
221500 -- (-334.434) (-339.771) [-335.331] (-337.156) * (-339.994) (-334.577) (-339.774) [-335.710] -- 0:00:49
222000 -- (-335.953) [-335.394] (-335.059) (-336.075) * (-338.303) (-336.408) (-335.740) [-335.737] -- 0:00:49
222500 -- (-338.168) [-334.178] (-346.559) (-334.760) * [-334.969] (-335.838) (-335.291) (-336.928) -- 0:00:48
223000 -- (-337.043) [-337.597] (-344.303) (-336.495) * (-336.045) (-336.326) (-335.253) [-335.851] -- 0:00:48
223500 -- (-337.764) (-334.136) [-341.913] (-338.541) * (-338.262) [-336.248] (-334.273) (-336.084) -- 0:00:48
224000 -- (-335.765) (-338.190) [-334.926] (-336.639) * (-334.878) [-336.330] (-337.434) (-337.284) -- 0:00:48
224500 -- (-335.641) (-335.692) (-334.407) [-335.485] * (-339.135) (-335.149) (-336.422) [-339.595] -- 0:00:48
225000 -- (-335.220) [-339.236] (-340.761) (-336.931) * (-337.115) (-336.825) (-335.168) [-338.667] -- 0:00:48
Average standard deviation of split frequencies: 0.015092
225500 -- [-335.649] (-338.733) (-336.965) (-335.399) * (-334.596) (-337.463) [-336.422] (-339.092) -- 0:00:48
226000 -- (-336.993) (-335.369) (-334.956) [-335.552] * (-338.193) [-337.709] (-334.079) (-339.914) -- 0:00:47
226500 -- (-335.996) (-338.615) [-334.702] (-334.735) * (-339.107) (-335.478) (-335.193) [-339.292] -- 0:00:47
227000 -- [-336.102] (-339.088) (-336.105) (-336.266) * [-336.926] (-336.642) (-337.016) (-337.022) -- 0:00:47
227500 -- (-334.654) (-339.427) (-339.603) [-335.073] * (-334.946) [-337.382] (-337.306) (-337.865) -- 0:00:47
228000 -- (-337.168) (-339.111) (-337.025) [-336.478] * (-336.287) (-335.891) (-337.266) [-336.822] -- 0:00:47
228500 -- (-337.983) [-336.950] (-336.310) (-336.714) * (-337.203) (-335.070) [-338.120] (-336.931) -- 0:00:47
229000 -- [-336.034] (-334.965) (-335.079) (-341.562) * [-337.002] (-343.330) (-335.863) (-339.064) -- 0:00:47
229500 -- (-337.617) (-337.151) [-334.444] (-337.208) * (-336.430) [-334.366] (-338.905) (-335.867) -- 0:00:47
230000 -- (-335.583) (-336.607) (-336.022) [-338.364] * [-335.312] (-335.030) (-336.734) (-338.365) -- 0:00:46
Average standard deviation of split frequencies: 0.016109
230500 -- (-333.959) [-338.735] (-334.760) (-338.412) * (-334.255) [-335.225] (-337.524) (-338.945) -- 0:00:46
231000 -- (-338.342) (-338.756) (-335.571) [-335.538] * [-335.202] (-339.358) (-336.236) (-335.635) -- 0:00:46
231500 -- (-334.456) (-334.622) [-333.956] (-335.991) * (-335.458) (-334.211) (-336.098) [-336.540] -- 0:00:46
232000 -- (-334.454) (-335.206) (-337.050) [-340.597] * (-335.284) (-334.835) (-334.827) [-335.883] -- 0:00:46
232500 -- (-334.332) (-335.015) [-334.625] (-336.218) * (-338.309) [-335.179] (-335.409) (-337.358) -- 0:00:46
233000 -- (-335.002) (-334.501) (-335.945) [-334.785] * (-336.014) [-334.582] (-335.239) (-335.733) -- 0:00:46
233500 -- [-334.506] (-334.855) (-335.739) (-334.759) * (-334.819) [-334.077] (-338.605) (-336.143) -- 0:00:45
234000 -- [-335.650] (-335.746) (-338.200) (-337.954) * (-335.348) (-335.710) (-339.757) [-334.966] -- 0:00:45
234500 -- (-337.101) (-334.225) [-336.282] (-336.646) * (-335.684) [-334.894] (-339.372) (-335.358) -- 0:00:45
235000 -- [-334.815] (-334.574) (-335.822) (-335.918) * [-337.381] (-335.330) (-336.249) (-337.144) -- 0:00:45
Average standard deviation of split frequencies: 0.017272
235500 -- (-335.768) [-334.594] (-338.536) (-339.329) * [-338.058] (-336.215) (-336.801) (-335.585) -- 0:00:45
236000 -- (-338.202) [-336.672] (-335.086) (-335.277) * (-334.208) [-336.435] (-339.048) (-334.913) -- 0:00:45
236500 -- (-335.352) (-337.416) (-337.143) [-336.049] * (-336.348) (-334.482) (-337.304) [-339.010] -- 0:00:45
237000 -- [-335.522] (-334.555) (-334.683) (-335.097) * (-335.622) [-335.201] (-335.179) (-334.569) -- 0:00:45
237500 -- (-338.543) (-336.605) (-335.077) [-339.036] * (-338.805) (-334.555) [-337.865] (-338.929) -- 0:00:44
238000 -- (-335.021) (-336.748) (-338.105) [-337.428] * (-340.970) (-337.886) [-337.871] (-334.141) -- 0:00:44
238500 -- [-334.887] (-340.069) (-335.832) (-335.129) * (-335.806) (-336.795) [-336.747] (-335.839) -- 0:00:44
239000 -- (-335.580) (-339.355) [-335.641] (-337.120) * (-340.002) (-337.675) (-336.137) [-335.991] -- 0:00:47
239500 -- (-336.964) (-335.397) (-337.660) [-336.314] * [-334.889] (-340.270) (-334.880) (-335.644) -- 0:00:47
240000 -- [-336.778] (-337.119) (-338.673) (-338.833) * (-338.256) (-335.415) [-335.144] (-334.392) -- 0:00:47
Average standard deviation of split frequencies: 0.016361
240500 -- [-335.868] (-340.687) (-336.858) (-335.617) * (-336.257) (-334.682) [-337.756] (-334.136) -- 0:00:47
241000 -- (-335.231) (-339.025) [-337.194] (-335.262) * (-340.522) (-334.167) (-337.244) [-335.345] -- 0:00:47
241500 -- (-335.988) [-335.080] (-336.724) (-336.873) * (-340.654) (-337.399) [-335.156] (-347.994) -- 0:00:47
242000 -- (-339.001) (-338.986) (-337.372) [-335.521] * (-341.979) [-335.284] (-344.199) (-339.631) -- 0:00:46
242500 -- (-335.700) (-336.267) [-334.397] (-336.044) * (-344.160) (-335.956) (-338.909) [-335.199] -- 0:00:46
243000 -- (-336.105) (-338.834) (-334.945) [-337.181] * (-336.409) (-335.678) [-336.228] (-338.081) -- 0:00:46
243500 -- (-335.802) [-340.193] (-337.064) (-339.050) * (-337.025) [-334.567] (-336.283) (-334.744) -- 0:00:46
244000 -- (-335.328) (-336.374) [-336.181] (-336.668) * (-335.459) [-339.506] (-335.062) (-337.485) -- 0:00:46
244500 -- (-333.895) [-334.721] (-334.222) (-335.475) * (-334.963) (-338.767) [-338.110] (-338.536) -- 0:00:46
245000 -- (-336.950) (-336.141) [-334.589] (-336.277) * [-335.209] (-336.744) (-336.028) (-337.039) -- 0:00:46
Average standard deviation of split frequencies: 0.015969
245500 -- (-335.146) [-335.151] (-336.135) (-336.122) * (-336.728) (-337.296) [-335.610] (-335.628) -- 0:00:46
246000 -- [-334.609] (-335.496) (-337.445) (-335.914) * [-336.400] (-336.753) (-335.971) (-337.891) -- 0:00:45
246500 -- (-334.542) (-334.815) [-334.912] (-335.033) * (-335.071) [-338.128] (-342.222) (-336.843) -- 0:00:45
247000 -- (-336.144) (-337.382) [-337.853] (-335.173) * (-335.028) [-338.622] (-335.634) (-340.849) -- 0:00:45
247500 -- (-334.581) (-340.224) [-335.600] (-336.048) * (-336.813) (-335.655) [-336.691] (-339.667) -- 0:00:45
248000 -- (-337.014) (-337.558) [-336.867] (-336.810) * (-334.331) [-335.390] (-334.647) (-335.955) -- 0:00:45
248500 -- (-334.559) [-336.684] (-335.936) (-343.130) * (-335.087) (-335.010) (-335.188) [-335.662] -- 0:00:45
249000 -- (-334.525) (-337.284) [-335.324] (-339.826) * [-336.637] (-335.172) (-335.504) (-336.677) -- 0:00:45
249500 -- (-336.110) (-337.132) [-335.211] (-335.812) * (-334.409) (-339.587) [-335.722] (-336.520) -- 0:00:45
250000 -- [-334.941] (-342.639) (-334.652) (-335.466) * (-337.688) (-338.997) (-336.001) [-340.387] -- 0:00:45
Average standard deviation of split frequencies: 0.015155
250500 -- (-334.878) (-338.502) (-336.013) [-334.736] * (-335.554) [-336.322] (-336.551) (-342.706) -- 0:00:44
251000 -- (-334.307) (-337.370) (-334.387) [-334.657] * [-334.304] (-335.067) (-337.148) (-335.832) -- 0:00:44
251500 -- (-337.419) (-335.529) [-335.902] (-335.216) * [-334.066] (-334.893) (-335.487) (-334.976) -- 0:00:44
252000 -- (-336.306) [-336.739] (-337.165) (-337.443) * [-336.473] (-334.666) (-335.822) (-338.745) -- 0:00:44
252500 -- (-336.459) (-337.143) [-343.537] (-335.679) * (-338.343) (-335.037) [-335.869] (-337.707) -- 0:00:44
253000 -- (-340.135) [-336.180] (-339.730) (-335.267) * (-336.088) (-334.351) (-337.400) [-335.229] -- 0:00:44
253500 -- [-336.080] (-337.237) (-336.945) (-334.925) * [-334.209] (-336.626) (-335.798) (-338.487) -- 0:00:44
254000 -- [-336.118] (-336.193) (-343.041) (-340.172) * (-338.296) (-334.449) (-337.621) [-336.460] -- 0:00:44
254500 -- (-336.892) (-335.795) [-337.944] (-335.096) * (-335.012) [-336.304] (-337.654) (-334.298) -- 0:00:43
255000 -- (-335.920) [-337.087] (-335.449) (-338.409) * (-338.834) [-334.511] (-338.154) (-335.594) -- 0:00:43
Average standard deviation of split frequencies: 0.014538
255500 -- (-336.688) (-339.155) [-336.687] (-336.052) * [-334.708] (-336.252) (-338.258) (-336.256) -- 0:00:43
256000 -- [-335.105] (-337.824) (-335.877) (-339.297) * [-335.312] (-339.637) (-335.889) (-342.604) -- 0:00:46
256500 -- (-335.367) (-340.989) [-335.561] (-343.631) * [-340.410] (-337.361) (-334.917) (-339.899) -- 0:00:46
257000 -- (-335.056) (-335.798) (-334.141) [-337.263] * (-337.464) (-339.218) [-334.521] (-334.957) -- 0:00:46
257500 -- (-336.628) (-335.912) (-336.415) [-337.579] * (-336.203) (-334.328) (-335.475) [-334.960] -- 0:00:46
258000 -- [-340.213] (-335.090) (-334.806) (-335.617) * [-337.193] (-337.308) (-336.324) (-336.004) -- 0:00:46
258500 -- (-336.082) [-334.278] (-337.824) (-336.278) * (-336.549) (-338.329) (-336.656) [-335.626] -- 0:00:45
259000 -- (-343.274) (-336.385) [-334.569] (-335.176) * [-334.947] (-340.359) (-334.581) (-335.318) -- 0:00:45
259500 -- (-337.876) (-336.530) [-335.803] (-336.288) * (-338.424) [-336.942] (-335.699) (-334.413) -- 0:00:45
260000 -- [-337.490] (-337.087) (-336.438) (-338.305) * (-338.832) (-336.471) [-335.156] (-337.162) -- 0:00:45
Average standard deviation of split frequencies: 0.014468
260500 -- (-339.418) (-341.074) [-334.644] (-334.596) * [-342.466] (-338.944) (-334.959) (-335.666) -- 0:00:45
261000 -- (-337.939) (-338.669) [-334.450] (-335.053) * (-340.317) [-337.921] (-338.260) (-336.602) -- 0:00:45
261500 -- (-337.667) (-337.058) [-337.928] (-337.725) * (-337.864) [-337.637] (-335.915) (-337.344) -- 0:00:45
262000 -- (-339.960) [-336.395] (-336.632) (-335.692) * (-337.813) [-336.145] (-336.113) (-335.272) -- 0:00:45
262500 -- [-335.794] (-334.755) (-336.627) (-336.811) * [-343.337] (-337.924) (-339.623) (-335.978) -- 0:00:44
263000 -- (-334.513) (-337.219) [-334.739] (-336.592) * (-336.414) (-334.642) [-335.581] (-335.897) -- 0:00:44
263500 -- [-337.394] (-334.958) (-340.023) (-335.202) * [-334.774] (-335.417) (-335.781) (-336.062) -- 0:00:44
264000 -- (-343.467) [-337.807] (-335.113) (-337.990) * (-337.689) (-335.560) [-335.362] (-335.429) -- 0:00:44
264500 -- [-335.239] (-335.051) (-336.181) (-337.237) * (-338.754) (-334.774) (-336.705) [-334.067] -- 0:00:44
265000 -- (-335.470) [-334.664] (-335.743) (-338.114) * (-337.813) (-335.034) (-337.313) [-334.662] -- 0:00:44
Average standard deviation of split frequencies: 0.014867
265500 -- (-334.757) (-336.302) [-336.042] (-337.101) * (-335.651) (-338.531) (-340.374) [-338.645] -- 0:00:44
266000 -- (-337.970) [-336.349] (-335.838) (-340.431) * (-339.061) (-334.908) (-337.373) [-336.032] -- 0:00:44
266500 -- [-334.061] (-339.226) (-335.741) (-338.611) * (-338.368) (-334.205) (-337.377) [-338.253] -- 0:00:44
267000 -- (-335.626) (-334.831) (-335.798) [-336.001] * (-336.632) (-336.536) [-337.303] (-337.915) -- 0:00:43
267500 -- (-336.336) [-335.438] (-335.639) (-338.349) * (-335.021) (-337.145) [-335.595] (-335.986) -- 0:00:43
268000 -- [-336.959] (-334.691) (-335.601) (-338.228) * (-335.132) (-336.119) (-338.010) [-334.385] -- 0:00:43
268500 -- (-336.928) [-340.100] (-335.457) (-337.373) * (-336.514) [-334.275] (-336.171) (-334.416) -- 0:00:43
269000 -- (-341.002) [-337.137] (-334.287) (-337.506) * (-334.698) (-336.621) [-337.481] (-335.193) -- 0:00:43
269500 -- (-335.846) (-335.957) [-334.941] (-336.429) * (-336.453) [-337.238] (-339.263) (-335.250) -- 0:00:43
270000 -- (-335.598) [-336.624] (-337.819) (-336.572) * (-335.597) (-338.228) (-337.200) [-334.074] -- 0:00:43
Average standard deviation of split frequencies: 0.015784
270500 -- (-338.672) (-335.127) [-337.456] (-337.377) * (-335.124) (-336.577) [-334.348] (-338.868) -- 0:00:43
271000 -- [-334.980] (-335.295) (-338.392) (-338.186) * [-338.731] (-337.217) (-338.416) (-336.434) -- 0:00:43
271500 -- (-336.474) (-335.397) (-335.781) [-341.756] * (-338.043) [-336.044] (-338.782) (-334.847) -- 0:00:42
272000 -- [-335.083] (-335.153) (-336.312) (-339.414) * (-336.392) [-336.394] (-335.698) (-334.594) -- 0:00:42
272500 -- (-336.326) [-334.456] (-335.184) (-339.999) * (-335.256) [-335.240] (-335.501) (-337.025) -- 0:00:42
273000 -- (-338.835) (-335.926) (-335.946) [-339.225] * (-334.705) [-337.183] (-334.097) (-339.595) -- 0:00:42
273500 -- (-335.193) (-334.633) [-335.101] (-337.490) * (-336.711) [-335.983] (-336.122) (-338.684) -- 0:00:45
274000 -- (-335.496) [-336.526] (-336.705) (-340.223) * [-335.385] (-338.391) (-335.887) (-341.818) -- 0:00:45
274500 -- (-338.387) [-336.624] (-335.808) (-338.765) * (-335.790) [-334.778] (-339.918) (-335.832) -- 0:00:44
275000 -- (-336.605) (-337.293) (-335.970) [-336.936] * (-338.395) [-335.807] (-335.342) (-335.257) -- 0:00:44
Average standard deviation of split frequencies: 0.016119
275500 -- (-338.189) [-338.242] (-336.074) (-334.426) * (-335.574) (-334.505) [-337.179] (-335.555) -- 0:00:44
276000 -- [-336.212] (-334.839) (-336.895) (-334.541) * [-334.506] (-335.275) (-337.198) (-335.469) -- 0:00:44
276500 -- (-339.452) [-339.118] (-336.006) (-335.298) * (-335.361) [-334.355] (-337.516) (-337.498) -- 0:00:44
277000 -- (-337.973) [-334.516] (-335.628) (-335.039) * [-338.268] (-335.797) (-334.917) (-337.150) -- 0:00:44
277500 -- (-335.668) [-342.421] (-339.489) (-334.950) * (-338.299) (-336.544) [-334.998] (-334.124) -- 0:00:44
278000 -- [-336.534] (-335.624) (-335.138) (-336.584) * (-336.183) (-340.121) [-340.405] (-335.151) -- 0:00:44
278500 -- (-335.802) (-336.733) [-336.652] (-336.091) * (-335.193) (-337.284) (-339.690) [-335.808] -- 0:00:44
279000 -- (-336.961) [-335.696] (-335.143) (-338.230) * [-334.473] (-337.835) (-337.385) (-335.782) -- 0:00:43
279500 -- [-339.086] (-334.680) (-338.162) (-338.215) * (-335.342) (-340.273) [-335.487] (-337.233) -- 0:00:43
280000 -- (-337.543) (-338.679) (-338.233) [-335.642] * (-336.395) (-336.558) [-335.243] (-336.951) -- 0:00:43
Average standard deviation of split frequencies: 0.015808
280500 -- (-338.632) (-335.241) [-334.636] (-334.337) * (-335.801) (-336.649) (-337.000) [-338.834] -- 0:00:43
281000 -- (-338.360) (-336.296) (-334.707) [-338.541] * [-335.342] (-336.168) (-334.438) (-340.092) -- 0:00:43
281500 -- (-336.125) (-335.637) (-337.575) [-339.114] * (-337.239) [-334.525] (-335.504) (-338.213) -- 0:00:43
282000 -- (-338.119) (-338.193) [-337.079] (-340.677) * (-334.819) (-334.093) (-334.986) [-336.436] -- 0:00:43
282500 -- (-336.617) (-335.570) (-336.595) [-335.323] * (-335.194) (-336.961) [-334.697] (-336.853) -- 0:00:43
283000 -- (-334.774) (-336.660) [-336.582] (-336.067) * (-334.511) (-339.280) [-337.730] (-338.466) -- 0:00:43
283500 -- [-338.677] (-338.119) (-337.804) (-335.925) * (-334.365) (-339.239) (-335.357) [-337.338] -- 0:00:42
284000 -- (-341.910) (-337.041) (-340.532) [-336.536] * (-338.097) [-337.288] (-335.708) (-336.294) -- 0:00:42
284500 -- [-336.267] (-334.837) (-337.099) (-336.961) * (-336.400) (-336.354) [-338.648] (-335.447) -- 0:00:42
285000 -- (-335.071) (-335.554) [-338.816] (-334.736) * (-334.965) [-335.409] (-335.310) (-337.059) -- 0:00:42
Average standard deviation of split frequencies: 0.016025
285500 -- [-334.775] (-335.652) (-337.474) (-336.261) * (-336.501) (-334.769) (-335.937) [-334.953] -- 0:00:42
286000 -- (-336.519) (-335.551) (-342.624) [-334.681] * (-336.091) (-335.146) [-335.458] (-334.809) -- 0:00:42
286500 -- (-336.126) [-335.672] (-334.609) (-336.860) * (-334.871) (-338.036) [-337.702] (-341.091) -- 0:00:42
287000 -- [-338.014] (-338.918) (-338.118) (-338.402) * (-338.064) (-337.263) [-335.087] (-341.767) -- 0:00:42
287500 -- (-336.614) [-339.181] (-335.947) (-335.029) * (-334.879) [-340.082] (-334.829) (-334.699) -- 0:00:42
288000 -- [-336.319] (-334.243) (-336.064) (-335.637) * (-334.902) (-345.271) (-335.052) [-334.635] -- 0:00:42
288500 -- (-336.344) [-335.326] (-336.259) (-334.777) * [-334.699] (-335.025) (-338.578) (-336.812) -- 0:00:41
289000 -- (-337.261) [-339.546] (-337.608) (-337.407) * (-334.845) (-337.021) [-341.360] (-334.447) -- 0:00:41
289500 -- (-336.903) (-336.714) [-334.215] (-337.169) * [-334.790] (-337.260) (-343.064) (-335.746) -- 0:00:41
290000 -- (-340.110) (-335.368) [-334.949] (-335.767) * (-335.762) (-333.993) (-335.849) [-336.644] -- 0:00:41
Average standard deviation of split frequencies: 0.017584
290500 -- (-338.310) (-342.509) [-335.078] (-334.143) * (-337.084) (-339.027) (-334.897) [-337.220] -- 0:00:43
291000 -- [-335.321] (-338.052) (-334.798) (-336.985) * (-339.486) (-334.476) [-337.065] (-335.844) -- 0:00:43
291500 -- [-337.402] (-334.902) (-338.909) (-337.075) * (-337.227) (-337.904) (-334.498) [-336.923] -- 0:00:43
292000 -- (-334.659) [-335.155] (-336.134) (-337.320) * (-335.065) (-338.760) [-335.913] (-338.071) -- 0:00:43
292500 -- [-336.460] (-335.199) (-334.103) (-335.436) * (-335.512) [-336.882] (-336.264) (-335.171) -- 0:00:43
293000 -- (-337.100) [-334.690] (-336.173) (-334.681) * [-335.842] (-337.330) (-337.769) (-335.752) -- 0:00:43
293500 -- (-334.980) (-334.583) [-335.461] (-335.652) * (-334.464) (-336.950) [-336.948] (-340.969) -- 0:00:43
294000 -- (-336.462) (-337.381) [-334.820] (-338.437) * (-334.539) (-336.694) [-335.577] (-335.697) -- 0:00:43
294500 -- [-336.025] (-336.031) (-337.613) (-338.435) * [-334.793] (-337.159) (-341.472) (-336.807) -- 0:00:43
295000 -- [-337.672] (-334.161) (-341.680) (-335.039) * [-336.088] (-336.962) (-337.420) (-334.725) -- 0:00:43
Average standard deviation of split frequencies: 0.016280
295500 -- (-341.368) [-336.844] (-341.506) (-335.456) * (-338.579) [-336.062] (-337.289) (-339.025) -- 0:00:42
296000 -- (-338.202) [-336.017] (-337.558) (-337.260) * (-336.679) [-337.535] (-334.931) (-338.932) -- 0:00:42
296500 -- (-336.902) (-335.241) [-340.917] (-338.993) * (-336.659) (-340.087) [-335.387] (-336.860) -- 0:00:42
297000 -- (-338.547) (-334.600) [-335.220] (-339.711) * (-335.036) [-339.605] (-334.372) (-338.608) -- 0:00:42
297500 -- (-337.098) (-334.542) [-334.491] (-335.610) * (-334.797) (-336.289) [-335.280] (-336.072) -- 0:00:42
298000 -- [-336.430] (-334.814) (-334.875) (-335.029) * [-334.633] (-335.030) (-336.757) (-334.382) -- 0:00:42
298500 -- (-334.476) [-338.443] (-337.880) (-339.082) * [-335.632] (-336.708) (-335.412) (-335.101) -- 0:00:42
299000 -- (-337.943) [-335.680] (-336.678) (-334.668) * (-339.238) (-336.729) [-335.877] (-336.372) -- 0:00:42
299500 -- (-336.018) (-336.599) [-335.637] (-336.050) * (-339.563) (-337.172) [-335.543] (-338.389) -- 0:00:42
300000 -- (-337.191) [-334.657] (-337.359) (-337.426) * [-338.131] (-336.505) (-335.473) (-338.260) -- 0:00:42
Average standard deviation of split frequencies: 0.015766
300500 -- (-336.894) (-334.532) (-338.901) [-339.538] * (-335.850) [-337.077] (-334.923) (-335.484) -- 0:00:41
301000 -- [-336.430] (-336.820) (-338.161) (-340.441) * (-334.969) (-336.960) (-337.631) [-335.136] -- 0:00:41
301500 -- (-334.793) (-335.108) [-335.016] (-339.383) * [-334.575] (-343.419) (-337.308) (-337.761) -- 0:00:41
302000 -- (-335.852) (-341.109) [-336.142] (-338.356) * (-334.669) [-338.310] (-336.721) (-337.092) -- 0:00:41
302500 -- (-338.193) (-335.151) (-334.613) [-341.355] * (-334.884) [-336.121] (-336.356) (-336.033) -- 0:00:41
303000 -- (-334.960) (-336.254) [-336.379] (-335.417) * (-341.341) (-334.134) (-340.479) [-336.713] -- 0:00:41
303500 -- (-334.944) (-335.004) (-336.208) [-334.460] * (-335.598) [-334.321] (-335.314) (-335.451) -- 0:00:41
304000 -- (-338.555) (-335.452) (-336.229) [-334.938] * (-335.175) (-337.145) [-335.857] (-338.054) -- 0:00:41
304500 -- (-335.957) [-336.456] (-337.893) (-341.162) * (-336.814) (-334.910) [-334.503] (-336.154) -- 0:00:41
305000 -- [-339.055] (-336.091) (-338.214) (-337.785) * (-340.598) (-336.172) (-335.915) [-336.817] -- 0:00:41
Average standard deviation of split frequencies: 0.014757
305500 -- (-335.602) (-336.184) (-335.980) [-335.652] * [-337.133] (-335.891) (-335.758) (-336.312) -- 0:00:40
306000 -- [-337.883] (-334.226) (-334.951) (-340.656) * (-335.948) [-335.557] (-335.794) (-336.316) -- 0:00:40
306500 -- [-336.845] (-335.494) (-335.219) (-340.129) * (-334.495) (-336.471) [-335.869] (-336.359) -- 0:00:40
307000 -- (-337.752) (-337.378) (-339.120) [-337.264] * (-335.491) (-338.427) (-337.555) [-337.024] -- 0:00:40
307500 -- (-334.865) (-336.037) (-337.812) [-336.009] * (-334.842) (-334.434) (-336.072) [-336.962] -- 0:00:42
308000 -- [-335.091] (-338.438) (-336.186) (-334.683) * (-339.916) (-335.305) (-334.609) [-338.880] -- 0:00:42
308500 -- (-335.319) [-335.121] (-338.198) (-337.027) * (-337.942) [-334.955] (-342.086) (-334.008) -- 0:00:42
309000 -- (-335.643) [-337.016] (-336.698) (-334.446) * (-336.605) (-338.803) (-335.843) [-335.873] -- 0:00:42
309500 -- (-337.094) (-336.247) [-337.344] (-337.314) * (-339.595) (-337.929) (-337.423) [-338.281] -- 0:00:42
310000 -- (-338.468) (-335.702) [-335.303] (-339.038) * (-335.058) [-336.817] (-335.999) (-340.351) -- 0:00:42
Average standard deviation of split frequencies: 0.016771
310500 -- (-335.512) (-336.789) (-334.324) [-340.226] * (-337.301) (-336.922) [-336.840] (-341.888) -- 0:00:42
311000 -- [-334.474] (-337.054) (-339.559) (-335.780) * (-336.478) [-336.116] (-337.722) (-338.838) -- 0:00:42
311500 -- [-335.151] (-334.598) (-335.506) (-334.792) * (-335.721) [-335.477] (-340.026) (-337.951) -- 0:00:41
312000 -- [-334.948] (-334.106) (-334.940) (-334.582) * (-335.733) (-335.861) (-336.363) [-337.407] -- 0:00:41
312500 -- (-334.612) [-335.268] (-336.428) (-339.356) * (-337.314) (-335.956) [-335.751] (-337.149) -- 0:00:41
313000 -- (-337.179) (-334.716) (-334.413) [-336.063] * (-337.148) (-335.377) [-336.019] (-336.709) -- 0:00:41
313500 -- (-345.795) (-335.626) (-337.550) [-342.914] * (-338.995) (-341.461) (-335.562) [-338.214] -- 0:00:41
314000 -- [-336.281] (-335.806) (-335.485) (-340.065) * (-338.316) [-334.362] (-335.567) (-335.577) -- 0:00:41
314500 -- [-336.470] (-335.239) (-337.986) (-338.080) * (-336.594) (-338.259) (-338.143) [-336.428] -- 0:00:41
315000 -- [-334.775] (-337.313) (-337.829) (-337.810) * (-340.036) (-335.018) (-334.741) [-335.591] -- 0:00:41
Average standard deviation of split frequencies: 0.016078
315500 -- [-333.982] (-336.986) (-334.768) (-335.843) * [-335.182] (-336.250) (-337.487) (-339.369) -- 0:00:41
316000 -- (-336.850) [-336.885] (-334.869) (-337.264) * [-336.807] (-340.424) (-334.731) (-334.531) -- 0:00:41
316500 -- [-335.244] (-336.020) (-336.519) (-336.658) * (-337.023) (-334.981) [-334.719] (-338.140) -- 0:00:41
317000 -- (-337.086) [-338.065] (-338.862) (-335.895) * (-338.427) (-336.524) (-336.109) [-338.552] -- 0:00:40
317500 -- (-336.378) [-335.912] (-335.137) (-335.200) * (-337.484) (-336.474) (-335.133) [-335.412] -- 0:00:40
318000 -- (-339.464) (-335.050) [-334.042] (-336.719) * (-336.086) (-336.450) (-337.911) [-337.704] -- 0:00:40
318500 -- (-337.303) (-336.356) [-334.499] (-334.774) * (-336.494) (-336.068) (-337.439) [-336.793] -- 0:00:40
319000 -- (-336.898) (-335.537) [-335.264] (-334.477) * (-336.428) [-334.733] (-336.385) (-336.487) -- 0:00:40
319500 -- [-337.411] (-341.103) (-336.542) (-335.186) * (-335.185) (-334.090) [-335.005] (-337.147) -- 0:00:40
320000 -- (-336.931) (-335.283) [-334.327] (-339.391) * [-335.985] (-334.728) (-335.940) (-339.411) -- 0:00:40
Average standard deviation of split frequencies: 0.015397
320500 -- (-340.022) (-337.859) [-335.046] (-336.572) * (-335.172) (-337.079) (-337.723) [-335.620] -- 0:00:40
321000 -- [-335.857] (-342.356) (-335.461) (-338.028) * [-336.494] (-337.746) (-342.160) (-335.355) -- 0:00:40
321500 -- (-337.470) [-335.439] (-336.217) (-335.598) * (-334.736) [-338.856] (-341.858) (-335.874) -- 0:00:40
322000 -- (-336.326) [-335.692] (-338.492) (-338.354) * (-335.272) (-339.942) [-336.593] (-334.767) -- 0:00:40
322500 -- (-334.916) (-336.213) [-335.808] (-336.759) * (-335.062) [-340.046] (-334.431) (-336.179) -- 0:00:39
323000 -- (-334.667) (-334.307) (-337.162) [-338.599] * (-335.767) (-338.593) (-335.220) [-335.805] -- 0:00:39
323500 -- (-337.189) (-336.447) [-334.619] (-336.576) * [-335.109] (-339.912) (-335.923) (-336.196) -- 0:00:39
324000 -- (-334.668) [-334.050] (-334.075) (-336.847) * (-334.377) (-335.599) (-335.776) [-335.526] -- 0:00:39
324500 -- (-337.382) (-336.367) (-335.584) [-336.420] * (-334.750) (-335.387) (-337.078) [-335.223] -- 0:00:41
325000 -- (-336.310) [-335.390] (-337.484) (-337.371) * [-334.306] (-334.824) (-334.491) (-334.699) -- 0:00:41
Average standard deviation of split frequencies: 0.016591
325500 -- (-334.478) (-335.626) [-335.507] (-337.087) * [-334.954] (-335.882) (-337.671) (-337.073) -- 0:00:41
326000 -- (-335.843) [-334.145] (-336.658) (-337.683) * (-336.797) [-334.644] (-340.926) (-337.002) -- 0:00:41
326500 -- (-334.453) [-335.447] (-336.520) (-334.285) * (-336.441) (-335.309) (-337.684) [-334.615] -- 0:00:41
327000 -- (-334.593) (-335.989) (-343.762) [-338.173] * (-334.831) [-335.946] (-335.894) (-336.604) -- 0:00:41
327500 -- (-334.843) (-340.306) [-336.977] (-336.332) * (-336.159) [-335.538] (-334.198) (-335.455) -- 0:00:41
328000 -- (-333.878) (-336.449) [-336.221] (-335.173) * (-334.391) (-336.560) [-337.014] (-340.157) -- 0:00:40
328500 -- (-334.011) (-338.938) [-334.634] (-336.679) * [-337.520] (-338.031) (-336.973) (-337.001) -- 0:00:40
329000 -- (-334.454) (-334.780) [-335.713] (-335.765) * (-336.111) [-337.994] (-337.033) (-337.895) -- 0:00:40
329500 -- (-335.964) [-337.138] (-334.816) (-335.355) * (-337.959) (-341.437) (-336.089) [-334.362] -- 0:00:40
330000 -- [-335.440] (-336.629) (-335.791) (-335.331) * (-338.150) (-339.400) (-337.315) [-335.002] -- 0:00:40
Average standard deviation of split frequencies: 0.016882
330500 -- (-337.805) [-335.777] (-336.577) (-336.242) * (-338.320) (-338.293) (-339.963) [-335.917] -- 0:00:40
331000 -- (-338.403) (-339.249) [-334.509] (-334.377) * (-339.908) (-339.731) (-335.287) [-336.553] -- 0:00:40
331500 -- (-335.613) (-339.326) [-335.241] (-335.428) * (-337.515) (-344.281) (-337.778) [-334.548] -- 0:00:40
332000 -- (-335.418) [-341.211] (-338.229) (-339.887) * (-334.474) (-334.725) (-335.853) [-336.137] -- 0:00:40
332500 -- [-334.892] (-337.446) (-335.759) (-334.358) * [-335.426] (-337.620) (-336.679) (-335.016) -- 0:00:40
333000 -- [-334.834] (-335.173) (-335.287) (-334.479) * (-335.877) (-335.578) (-334.277) [-336.407] -- 0:00:40
333500 -- (-336.540) [-335.949] (-336.246) (-336.237) * [-335.496] (-338.545) (-336.763) (-335.882) -- 0:00:39
334000 -- (-339.680) (-336.454) [-334.803] (-335.024) * (-334.287) (-336.007) [-336.721] (-336.868) -- 0:00:39
334500 -- (-335.829) [-336.088] (-335.928) (-339.058) * (-337.603) (-335.448) [-338.192] (-336.088) -- 0:00:39
335000 -- [-336.478] (-336.842) (-340.632) (-339.929) * (-338.127) (-335.790) (-335.328) [-336.293] -- 0:00:39
Average standard deviation of split frequencies: 0.016393
335500 -- (-337.168) [-339.850] (-337.603) (-341.024) * (-336.072) (-334.675) [-335.591] (-336.344) -- 0:00:39
336000 -- (-337.992) (-338.751) [-335.839] (-338.291) * (-339.356) (-341.598) (-338.114) [-334.664] -- 0:00:39
336500 -- (-336.142) (-335.127) [-334.634] (-335.659) * (-335.775) (-334.249) (-339.598) [-334.414] -- 0:00:39
337000 -- (-339.515) [-334.886] (-335.195) (-336.170) * (-342.990) (-335.949) (-335.580) [-336.924] -- 0:00:39
337500 -- (-338.618) [-335.611] (-335.784) (-335.737) * (-336.742) (-340.089) [-337.873] (-335.492) -- 0:00:39
338000 -- (-337.440) (-335.649) [-335.533] (-335.645) * (-334.488) (-339.803) [-334.332] (-334.664) -- 0:00:39
338500 -- (-337.384) [-337.840] (-337.267) (-335.511) * (-338.374) [-335.155] (-334.804) (-335.684) -- 0:00:39
339000 -- [-336.779] (-335.577) (-335.035) (-334.622) * (-337.529) (-335.344) [-336.392] (-336.530) -- 0:00:38
339500 -- (-339.073) (-335.328) (-335.341) [-334.823] * (-337.891) (-334.691) [-336.161] (-335.797) -- 0:00:38
340000 -- (-337.953) [-337.014] (-334.055) (-336.143) * (-335.627) [-335.703] (-336.045) (-336.277) -- 0:00:38
Average standard deviation of split frequencies: 0.017552
340500 -- (-335.688) (-337.792) (-338.734) [-334.140] * (-334.738) (-337.619) [-335.700] (-337.794) -- 0:00:38
341000 -- [-335.915] (-335.102) (-334.429) (-342.816) * (-335.869) [-338.369] (-337.481) (-335.064) -- 0:00:38
341500 -- [-337.061] (-337.004) (-335.901) (-339.700) * (-339.571) (-337.746) [-337.558] (-334.868) -- 0:00:40
342000 -- (-335.487) (-335.353) [-334.317] (-337.876) * (-337.553) [-334.710] (-335.527) (-335.892) -- 0:00:40
342500 -- (-334.773) [-334.325] (-334.977) (-336.277) * (-335.516) (-338.144) (-339.915) [-337.586] -- 0:00:40
343000 -- (-334.837) [-336.073] (-334.863) (-335.977) * (-335.054) (-338.143) (-336.967) [-337.121] -- 0:00:40
343500 -- (-335.551) (-335.656) (-335.695) [-334.273] * (-335.892) (-337.575) (-334.343) [-334.936] -- 0:00:40
344000 -- (-338.409) [-335.727] (-335.886) (-337.402) * (-336.509) (-335.511) (-335.993) [-337.617] -- 0:00:40
344500 -- [-337.159] (-335.925) (-336.019) (-340.221) * (-335.912) [-338.363] (-336.655) (-335.714) -- 0:00:39
345000 -- (-336.396) (-337.551) (-336.244) [-336.409] * (-337.634) (-335.591) (-335.371) [-341.634] -- 0:00:39
Average standard deviation of split frequencies: 0.017783
345500 -- (-337.418) (-335.425) (-337.513) [-336.159] * (-334.696) (-336.909) (-335.068) [-337.420] -- 0:00:39
346000 -- (-335.489) (-337.012) [-339.501] (-334.869) * (-339.643) (-336.203) [-338.765] (-337.546) -- 0:00:39
346500 -- (-337.695) [-335.009] (-338.894) (-338.132) * [-341.382] (-336.799) (-335.121) (-334.387) -- 0:00:39
347000 -- (-337.075) [-339.716] (-336.122) (-337.883) * (-343.468) (-338.414) (-340.470) [-337.631] -- 0:00:39
347500 -- (-338.682) [-335.076] (-337.811) (-336.298) * (-339.353) [-337.755] (-334.128) (-341.838) -- 0:00:39
348000 -- (-335.347) (-340.593) (-335.512) [-338.723] * (-340.370) [-334.978] (-342.013) (-334.858) -- 0:00:39
348500 -- (-336.921) (-343.538) (-335.274) [-334.665] * (-338.366) (-337.138) (-336.596) [-334.769] -- 0:00:39
349000 -- [-334.267] (-337.358) (-335.506) (-335.397) * (-335.291) (-339.976) (-336.710) [-334.884] -- 0:00:39
349500 -- (-335.740) (-342.793) (-336.171) [-335.739] * [-335.271] (-338.961) (-334.941) (-337.348) -- 0:00:39
350000 -- [-336.530] (-339.522) (-334.178) (-335.057) * (-337.544) (-334.891) [-335.530] (-335.116) -- 0:00:39
Average standard deviation of split frequencies: 0.016768
350500 -- (-336.263) (-338.773) (-335.623) [-335.417] * [-334.378] (-336.897) (-339.017) (-337.162) -- 0:00:38
351000 -- (-335.712) [-339.740] (-339.027) (-338.385) * [-334.672] (-334.551) (-345.989) (-336.804) -- 0:00:38
351500 -- (-335.549) (-337.195) [-335.340] (-334.493) * (-335.936) (-334.673) (-338.675) [-337.843] -- 0:00:38
352000 -- [-336.689] (-335.563) (-335.486) (-335.244) * [-334.414] (-335.915) (-335.246) (-336.378) -- 0:00:38
352500 -- (-336.250) (-337.802) [-335.383] (-335.270) * (-341.146) (-337.432) [-335.531] (-339.120) -- 0:00:38
353000 -- [-335.564] (-337.315) (-337.352) (-335.484) * [-334.416] (-338.605) (-334.390) (-336.952) -- 0:00:38
353500 -- [-335.131] (-335.770) (-338.015) (-339.868) * (-338.887) [-334.751] (-335.060) (-336.456) -- 0:00:38
354000 -- (-337.950) [-334.729] (-337.881) (-337.028) * (-340.127) [-336.213] (-337.635) (-335.517) -- 0:00:38
354500 -- (-336.092) [-334.253] (-336.263) (-336.167) * (-335.490) (-338.241) (-338.315) [-336.182] -- 0:00:38
355000 -- (-334.650) [-336.384] (-335.013) (-337.209) * [-335.278] (-337.469) (-336.770) (-340.866) -- 0:00:38
Average standard deviation of split frequencies: 0.017214
355500 -- [-334.963] (-336.856) (-336.890) (-338.210) * (-335.785) (-337.037) (-339.871) [-333.980] -- 0:00:38
356000 -- (-340.288) [-335.190] (-335.004) (-339.501) * (-335.970) (-334.792) (-335.453) [-334.439] -- 0:00:37
356500 -- (-335.043) (-335.053) (-335.748) [-341.139] * (-335.493) [-334.795] (-335.909) (-334.875) -- 0:00:37
357000 -- (-334.763) (-337.804) [-335.619] (-341.295) * (-336.374) (-336.599) (-339.133) [-336.130] -- 0:00:37
357500 -- [-334.670] (-338.796) (-335.821) (-336.233) * (-336.368) (-337.747) (-334.292) [-336.866] -- 0:00:37
358000 -- (-334.083) [-337.347] (-336.762) (-335.127) * (-336.333) [-337.937] (-335.604) (-337.949) -- 0:00:37
358500 -- (-335.210) (-334.615) (-337.005) [-335.165] * (-337.041) (-337.301) [-335.150] (-336.018) -- 0:00:37
359000 -- [-334.816] (-334.930) (-336.540) (-335.209) * [-335.451] (-336.067) (-336.337) (-334.279) -- 0:00:39
359500 -- (-336.799) (-336.285) (-335.955) [-334.132] * (-337.563) (-336.579) (-338.140) [-335.728] -- 0:00:39
360000 -- (-337.598) (-340.318) [-334.624] (-335.942) * (-336.906) (-334.203) [-335.315] (-335.448) -- 0:00:39
Average standard deviation of split frequencies: 0.017935
360500 -- (-336.448) (-336.028) [-334.687] (-335.989) * (-334.656) [-336.991] (-340.966) (-337.566) -- 0:00:39
361000 -- (-335.249) [-335.533] (-338.978) (-336.276) * (-335.394) [-336.214] (-340.727) (-335.003) -- 0:00:38
361500 -- (-335.335) (-334.743) [-341.250] (-336.358) * [-336.680] (-337.368) (-334.889) (-337.640) -- 0:00:38
362000 -- [-334.724] (-336.741) (-336.136) (-337.161) * (-336.115) [-335.538] (-334.958) (-335.029) -- 0:00:38
362500 -- [-335.533] (-335.282) (-336.254) (-336.330) * (-335.891) (-340.203) (-334.541) [-335.590] -- 0:00:38
363000 -- (-334.590) [-338.241] (-334.982) (-336.331) * (-337.252) (-338.584) (-336.237) [-335.676] -- 0:00:38
363500 -- (-337.946) [-341.298] (-336.515) (-335.728) * (-335.178) (-335.972) (-334.583) [-335.289] -- 0:00:38
364000 -- (-339.026) [-336.603] (-334.837) (-335.693) * (-334.832) (-335.260) [-335.572] (-334.975) -- 0:00:38
364500 -- (-341.604) (-335.228) [-335.624] (-336.788) * (-333.861) [-336.281] (-336.761) (-334.989) -- 0:00:38
365000 -- (-341.102) (-337.015) (-335.610) [-335.131] * (-335.226) (-334.497) (-335.258) [-335.617] -- 0:00:38
Average standard deviation of split frequencies: 0.017388
365500 -- (-334.702) [-336.177] (-338.235) (-338.732) * [-340.804] (-335.548) (-335.873) (-334.584) -- 0:00:38
366000 -- (-334.832) [-336.126] (-337.067) (-338.016) * (-338.751) (-336.265) [-334.541] (-338.348) -- 0:00:38
366500 -- (-336.805) (-334.905) [-337.266] (-334.757) * (-340.603) (-335.899) [-337.711] (-338.716) -- 0:00:38
367000 -- [-335.436] (-339.594) (-336.514) (-334.324) * (-336.695) [-334.749] (-337.310) (-335.907) -- 0:00:37
367500 -- (-337.067) (-335.721) (-337.235) [-333.909] * (-336.658) [-334.356] (-337.112) (-334.412) -- 0:00:37
368000 -- [-337.621] (-340.409) (-334.432) (-334.955) * (-335.748) (-334.938) [-337.364] (-336.439) -- 0:00:37
368500 -- (-334.968) (-335.559) (-336.342) [-334.844] * [-334.581] (-337.242) (-336.199) (-336.853) -- 0:00:37
369000 -- (-336.551) [-335.487] (-338.604) (-338.255) * [-335.011] (-335.576) (-336.733) (-336.398) -- 0:00:37
369500 -- (-335.276) (-337.025) [-336.589] (-340.529) * (-342.422) (-339.393) (-336.332) [-336.685] -- 0:00:37
370000 -- (-335.557) (-335.363) (-338.631) [-338.057] * [-335.392] (-339.272) (-335.175) (-338.889) -- 0:00:37
Average standard deviation of split frequencies: 0.017028
370500 -- [-336.054] (-335.279) (-335.820) (-335.875) * (-334.188) (-335.541) (-334.610) [-338.184] -- 0:00:37
371000 -- (-339.523) (-336.167) (-340.797) [-336.150] * (-336.931) (-335.943) (-336.938) [-336.129] -- 0:00:37
371500 -- (-337.382) [-337.218] (-335.739) (-334.255) * (-336.944) (-334.729) [-334.253] (-336.061) -- 0:00:37
372000 -- (-340.598) (-338.671) (-335.995) [-335.482] * (-344.398) [-339.168] (-334.367) (-336.549) -- 0:00:37
372500 -- (-335.300) [-335.705] (-335.433) (-339.988) * (-339.724) (-334.546) [-334.760] (-335.422) -- 0:00:37
373000 -- (-335.119) (-337.089) (-336.584) [-336.051] * (-336.078) (-337.461) (-335.570) [-336.385] -- 0:00:36
373500 -- (-336.629) (-337.494) (-338.093) [-335.571] * (-335.871) [-334.193] (-335.998) (-336.559) -- 0:00:36
374000 -- (-335.200) [-334.249] (-337.207) (-336.191) * (-334.628) [-336.458] (-335.714) (-337.197) -- 0:00:36
374500 -- (-335.088) (-335.598) (-338.351) [-335.706] * (-334.600) (-335.243) [-339.356] (-335.063) -- 0:00:36
375000 -- [-334.766] (-337.466) (-336.879) (-335.719) * (-335.280) (-334.471) (-338.300) [-337.844] -- 0:00:36
Average standard deviation of split frequencies: 0.016889
375500 -- [-336.124] (-335.115) (-338.054) (-339.232) * [-337.031] (-334.718) (-335.785) (-336.470) -- 0:00:36
376000 -- (-338.901) (-335.898) [-336.240] (-335.646) * (-336.355) (-334.499) (-335.736) [-336.595] -- 0:00:38
376500 -- (-336.301) (-335.614) [-336.576] (-335.135) * (-336.946) [-336.104] (-337.658) (-338.970) -- 0:00:38
377000 -- (-337.310) (-340.196) (-334.388) [-334.992] * (-337.943) [-336.176] (-336.455) (-334.419) -- 0:00:38
377500 -- (-336.292) (-335.366) [-335.265] (-338.736) * [-335.056] (-335.689) (-334.468) (-336.433) -- 0:00:37
378000 -- (-336.376) (-336.046) (-339.710) [-338.484] * (-338.314) [-337.879] (-338.390) (-335.393) -- 0:00:37
378500 -- (-334.705) (-338.563) [-337.453] (-336.589) * (-336.201) (-337.681) [-337.280] (-337.864) -- 0:00:37
379000 -- (-337.661) [-335.969] (-334.502) (-336.333) * (-337.116) (-342.853) [-336.607] (-336.772) -- 0:00:37
379500 -- [-336.891] (-336.414) (-334.710) (-334.813) * (-339.199) (-335.950) [-336.639] (-335.978) -- 0:00:37
380000 -- (-335.217) (-339.161) [-334.552] (-335.711) * [-336.546] (-336.567) (-334.629) (-339.066) -- 0:00:37
Average standard deviation of split frequencies: 0.017062
380500 -- [-335.165] (-335.210) (-336.637) (-336.166) * (-336.424) (-340.651) [-338.191] (-340.361) -- 0:00:37
381000 -- (-336.601) (-338.391) [-335.966] (-338.044) * [-338.523] (-339.133) (-336.358) (-337.191) -- 0:00:37
381500 -- (-335.632) (-335.784) [-340.437] (-334.495) * (-335.003) (-337.343) [-334.757] (-335.256) -- 0:00:37
382000 -- (-336.576) [-338.918] (-337.138) (-334.010) * (-337.625) (-338.706) (-335.154) [-337.190] -- 0:00:37
382500 -- (-339.065) [-334.991] (-334.293) (-336.113) * (-338.562) (-342.214) (-336.018) [-335.696] -- 0:00:37
383000 -- (-336.885) [-336.821] (-337.271) (-338.684) * (-341.438) [-337.978] (-335.725) (-335.469) -- 0:00:37
383500 -- (-335.725) (-336.071) (-337.309) [-335.264] * (-336.615) (-337.357) [-335.456] (-334.937) -- 0:00:36
384000 -- (-335.266) (-337.704) [-336.873] (-334.998) * (-336.418) [-335.458] (-338.070) (-335.465) -- 0:00:36
384500 -- (-337.575) [-335.758] (-336.137) (-334.762) * (-337.632) [-335.414] (-335.747) (-335.121) -- 0:00:36
385000 -- (-335.235) (-336.299) (-334.590) [-337.324] * [-335.250] (-335.095) (-337.233) (-336.551) -- 0:00:36
Average standard deviation of split frequencies: 0.016148
385500 -- (-335.834) (-339.003) [-334.505] (-336.485) * (-336.544) (-334.225) (-335.361) [-334.637] -- 0:00:36
386000 -- (-334.417) (-335.337) (-334.578) [-336.344] * (-334.249) (-334.835) (-335.796) [-336.232] -- 0:00:36
386500 -- [-334.194] (-336.841) (-335.656) (-336.317) * [-337.011] (-336.191) (-336.613) (-337.249) -- 0:00:36
387000 -- (-338.384) [-337.888] (-338.795) (-334.983) * (-334.338) (-335.553) (-335.827) [-337.404] -- 0:00:36
387500 -- (-340.848) (-334.423) (-335.972) [-335.146] * (-336.425) (-339.068) (-336.242) [-334.177] -- 0:00:36
388000 -- (-335.080) (-334.974) (-337.202) [-337.121] * (-336.098) (-334.205) (-335.770) [-336.699] -- 0:00:36
388500 -- [-338.911] (-334.549) (-338.716) (-334.235) * (-336.694) (-334.537) [-337.095] (-337.469) -- 0:00:36
389000 -- (-334.967) (-335.741) (-337.649) [-335.744] * [-334.983] (-334.685) (-337.378) (-336.609) -- 0:00:36
389500 -- (-339.442) (-335.763) (-334.437) [-336.395] * (-335.769) (-343.050) [-336.147] (-337.342) -- 0:00:36
390000 -- (-339.180) (-334.597) (-335.438) [-337.790] * (-334.714) (-338.003) (-336.866) [-334.749] -- 0:00:35
Average standard deviation of split frequencies: 0.015829
390500 -- (-335.358) [-335.088] (-337.191) (-340.173) * (-337.793) [-336.478] (-336.022) (-335.684) -- 0:00:35
391000 -- (-334.776) [-335.273] (-338.401) (-337.500) * [-337.533] (-337.231) (-337.875) (-336.695) -- 0:00:35
391500 -- (-335.567) (-335.428) (-336.360) [-335.876] * [-335.600] (-336.728) (-336.088) (-337.549) -- 0:00:35
392000 -- (-334.766) [-334.344] (-335.713) (-336.548) * (-334.951) (-338.557) [-339.563] (-336.460) -- 0:00:35
392500 -- (-335.773) (-334.208) (-336.157) [-335.899] * (-339.395) (-337.374) (-338.351) [-335.840] -- 0:00:35
393000 -- (-334.108) (-334.497) [-334.177] (-338.038) * (-336.691) (-338.655) (-337.025) [-335.900] -- 0:00:35
393500 -- (-337.931) (-336.506) [-336.533] (-338.159) * [-336.575] (-337.457) (-341.433) (-337.645) -- 0:00:36
394000 -- (-334.866) [-334.635] (-338.838) (-337.820) * [-337.609] (-338.685) (-337.926) (-334.301) -- 0:00:36
394500 -- (-334.902) [-337.030] (-336.977) (-333.986) * (-339.462) (-343.168) [-335.531] (-334.465) -- 0:00:36
395000 -- (-334.358) (-338.505) (-337.317) [-335.676] * (-334.346) (-335.243) [-335.420] (-339.787) -- 0:00:36
Average standard deviation of split frequencies: 0.015145
395500 -- [-335.702] (-338.589) (-338.933) (-337.205) * [-337.652] (-336.295) (-336.009) (-339.551) -- 0:00:36
396000 -- [-335.083] (-337.352) (-338.154) (-335.289) * (-336.643) (-335.292) (-334.637) [-337.713] -- 0:00:36
396500 -- (-334.312) (-336.424) [-336.446] (-335.355) * [-338.506] (-337.363) (-335.459) (-335.029) -- 0:00:36
397000 -- (-336.225) [-336.474] (-336.362) (-334.943) * [-336.618] (-335.735) (-336.003) (-335.043) -- 0:00:36
397500 -- (-335.788) [-336.177] (-335.520) (-335.353) * [-336.493] (-334.892) (-336.812) (-335.390) -- 0:00:36
398000 -- [-336.478] (-339.235) (-335.646) (-336.310) * (-335.055) [-336.116] (-336.181) (-340.703) -- 0:00:36
398500 -- [-334.829] (-338.588) (-334.317) (-335.783) * [-335.547] (-335.044) (-338.549) (-340.551) -- 0:00:36
399000 -- (-336.381) (-340.602) (-335.850) [-338.104] * [-335.001] (-333.962) (-334.919) (-339.643) -- 0:00:36
399500 -- (-335.302) [-337.537] (-334.888) (-337.910) * (-334.219) (-337.884) [-336.608] (-336.114) -- 0:00:36
400000 -- [-336.655] (-337.039) (-336.054) (-338.184) * (-335.043) [-336.703] (-335.956) (-335.767) -- 0:00:36
Average standard deviation of split frequencies: 0.015164
400500 -- (-334.636) [-337.882] (-340.322) (-334.554) * (-336.289) (-335.240) [-335.077] (-337.510) -- 0:00:35
401000 -- (-337.090) (-337.121) [-334.585] (-340.039) * (-338.008) (-336.967) (-334.597) [-336.308] -- 0:00:35
401500 -- (-336.626) (-339.119) [-334.850] (-334.321) * [-336.356] (-335.417) (-337.448) (-334.246) -- 0:00:35
402000 -- [-335.719] (-337.141) (-340.797) (-334.875) * [-333.960] (-334.912) (-341.227) (-335.231) -- 0:00:35
402500 -- (-334.359) (-335.257) [-336.347] (-335.198) * (-334.974) (-339.204) [-334.298] (-336.398) -- 0:00:35
403000 -- [-335.179] (-339.284) (-337.283) (-336.438) * (-335.733) [-337.854] (-334.960) (-337.052) -- 0:00:35
403500 -- (-335.560) (-337.046) [-335.992] (-337.472) * [-335.954] (-336.014) (-337.820) (-336.528) -- 0:00:35
404000 -- (-334.605) (-336.596) [-336.355] (-337.596) * [-337.353] (-337.735) (-340.828) (-335.224) -- 0:00:35
404500 -- (-336.081) [-338.164] (-336.681) (-337.488) * (-335.075) (-334.222) [-336.939] (-336.273) -- 0:00:35
405000 -- (-335.473) (-335.188) [-336.413] (-336.016) * (-334.211) [-334.514] (-335.966) (-340.854) -- 0:00:35
Average standard deviation of split frequencies: 0.015583
405500 -- (-334.561) [-335.554] (-335.833) (-336.464) * (-335.028) (-336.430) (-338.611) [-335.243] -- 0:00:35
406000 -- [-335.458] (-334.416) (-336.598) (-336.996) * (-335.455) (-335.380) [-336.198] (-334.555) -- 0:00:35
406500 -- [-334.069] (-336.361) (-337.049) (-340.101) * (-348.523) [-338.775] (-336.827) (-335.590) -- 0:00:35
407000 -- [-337.863] (-338.120) (-335.044) (-335.566) * (-339.835) [-336.862] (-341.222) (-336.642) -- 0:00:34
407500 -- (-335.498) [-334.422] (-335.390) (-336.888) * [-341.272] (-335.541) (-337.860) (-337.366) -- 0:00:34
408000 -- [-334.405] (-334.330) (-337.655) (-340.461) * (-335.529) (-336.602) [-338.053] (-337.331) -- 0:00:34
408500 -- [-335.308] (-334.696) (-334.563) (-338.726) * (-335.022) (-338.412) (-336.150) [-337.862] -- 0:00:34
409000 -- [-334.521] (-333.890) (-334.682) (-338.602) * (-335.519) (-335.781) [-335.569] (-335.087) -- 0:00:34
409500 -- [-335.520] (-333.991) (-336.448) (-335.930) * (-335.365) (-335.217) (-338.195) [-336.464] -- 0:00:34
410000 -- (-336.564) [-334.109] (-337.794) (-335.845) * [-336.600] (-335.390) (-338.563) (-335.623) -- 0:00:34
Average standard deviation of split frequencies: 0.014439
410500 -- [-334.464] (-334.450) (-337.488) (-335.300) * [-335.613] (-334.337) (-336.508) (-336.834) -- 0:00:35
411000 -- [-336.752] (-336.021) (-342.840) (-336.332) * (-334.655) (-335.248) (-338.065) [-336.985] -- 0:00:35
411500 -- (-336.982) (-334.193) [-336.477] (-335.796) * [-337.732] (-338.719) (-335.583) (-336.625) -- 0:00:35
412000 -- [-335.543] (-334.922) (-338.097) (-335.407) * (-336.072) [-336.879] (-336.503) (-336.360) -- 0:00:35
412500 -- (-338.033) (-336.880) (-339.025) [-338.369] * (-335.200) (-336.133) (-336.930) [-336.945] -- 0:00:35
413000 -- (-338.148) (-334.827) [-334.865] (-336.369) * [-334.926] (-335.897) (-337.403) (-341.634) -- 0:00:35
413500 -- (-335.146) [-334.862] (-338.915) (-334.728) * [-334.015] (-340.467) (-334.814) (-341.271) -- 0:00:35
414000 -- (-337.693) (-336.241) (-338.957) [-338.592] * (-337.003) (-335.972) (-334.800) [-334.050] -- 0:00:35
414500 -- (-335.047) [-335.286] (-335.330) (-340.759) * (-335.887) (-334.697) [-336.180] (-338.270) -- 0:00:35
415000 -- (-336.513) (-335.056) (-336.515) [-336.958] * (-336.133) (-339.392) [-335.046] (-337.062) -- 0:00:35
Average standard deviation of split frequencies: 0.014851
415500 -- (-334.684) (-335.575) [-335.862] (-336.803) * [-335.143] (-336.256) (-334.808) (-336.281) -- 0:00:35
416000 -- [-335.833] (-339.758) (-336.309) (-339.507) * (-337.656) (-335.354) (-337.822) [-334.913] -- 0:00:35
416500 -- [-335.600] (-336.899) (-335.860) (-343.447) * [-335.757] (-339.432) (-336.832) (-337.243) -- 0:00:35
417000 -- (-337.209) (-335.140) [-335.085] (-337.806) * (-338.663) (-334.070) (-335.504) [-337.344] -- 0:00:34
417500 -- (-337.872) (-336.343) (-345.154) [-334.979] * (-336.525) (-334.607) (-336.633) [-336.093] -- 0:00:34
418000 -- (-335.602) (-337.862) [-338.551] (-338.911) * (-336.612) [-334.722] (-338.567) (-341.594) -- 0:00:34
418500 -- (-335.459) [-340.204] (-334.963) (-336.744) * [-335.428] (-335.174) (-337.691) (-335.451) -- 0:00:34
419000 -- (-337.108) [-339.062] (-337.127) (-335.276) * (-334.288) (-336.390) [-336.579] (-339.721) -- 0:00:34
419500 -- (-335.667) [-336.474] (-337.323) (-334.877) * [-334.456] (-335.265) (-334.392) (-337.123) -- 0:00:34
420000 -- (-335.174) (-340.665) [-335.990] (-335.961) * (-342.198) (-335.510) (-335.494) [-335.151] -- 0:00:34
Average standard deviation of split frequencies: 0.013801
420500 -- [-339.405] (-339.065) (-334.824) (-338.329) * (-343.477) (-339.702) [-334.478] (-336.424) -- 0:00:34
421000 -- (-339.553) (-336.879) [-336.071] (-335.613) * (-336.842) [-334.705] (-336.768) (-341.500) -- 0:00:34
421500 -- (-342.829) (-340.177) [-334.730] (-334.818) * (-336.430) [-336.584] (-337.304) (-337.276) -- 0:00:34
422000 -- [-335.229] (-334.743) (-336.937) (-334.383) * (-338.404) [-337.122] (-339.792) (-334.733) -- 0:00:34
422500 -- [-336.972] (-334.125) (-336.579) (-340.120) * (-337.133) [-335.588] (-334.683) (-336.935) -- 0:00:34
423000 -- (-337.208) (-335.944) (-335.184) [-338.055] * [-337.226] (-336.112) (-336.164) (-334.095) -- 0:00:34
423500 -- (-336.999) (-338.475) [-334.646] (-338.000) * [-339.369] (-335.298) (-339.633) (-334.641) -- 0:00:34
424000 -- (-334.030) (-334.642) [-338.841] (-336.581) * (-336.230) [-335.232] (-336.516) (-335.447) -- 0:00:33
424500 -- (-340.105) [-335.735] (-338.569) (-337.424) * [-336.446] (-337.981) (-335.717) (-335.870) -- 0:00:33
425000 -- (-343.684) (-336.529) (-336.846) [-336.067] * (-336.227) (-335.734) (-335.084) [-336.345] -- 0:00:33
Average standard deviation of split frequencies: 0.013168
425500 -- (-335.735) [-335.027] (-337.873) (-338.607) * [-337.773] (-335.320) (-338.085) (-335.157) -- 0:00:33
426000 -- (-340.453) [-335.089] (-339.495) (-338.989) * [-336.735] (-337.796) (-341.540) (-335.676) -- 0:00:33
426500 -- (-336.532) [-337.397] (-335.059) (-335.170) * (-335.202) (-340.714) (-335.582) [-335.759] -- 0:00:33
427000 -- (-337.037) [-336.515] (-337.183) (-336.670) * (-336.604) (-337.794) (-335.625) [-334.411] -- 0:00:33
427500 -- (-338.308) [-335.848] (-334.206) (-338.955) * (-341.224) (-337.610) [-334.423] (-335.459) -- 0:00:34
428000 -- (-340.269) [-336.071] (-337.079) (-336.784) * (-337.227) [-336.935] (-336.663) (-339.736) -- 0:00:34
428500 -- [-339.267] (-335.004) (-337.174) (-334.573) * [-335.751] (-336.134) (-335.662) (-336.794) -- 0:00:34
429000 -- (-334.474) (-335.889) [-336.877] (-337.342) * (-335.710) (-336.513) [-336.834] (-336.261) -- 0:00:34
429500 -- (-335.247) [-334.563] (-338.918) (-342.623) * (-336.677) (-337.860) (-336.886) [-335.400] -- 0:00:34
430000 -- [-333.854] (-339.408) (-338.460) (-334.117) * [-335.304] (-338.854) (-336.949) (-340.381) -- 0:00:34
Average standard deviation of split frequencies: 0.012369
430500 -- (-335.551) (-336.462) (-335.420) [-336.467] * (-334.749) (-339.624) [-338.407] (-334.806) -- 0:00:34
431000 -- (-334.625) (-335.675) (-335.857) [-334.696] * [-336.193] (-339.589) (-344.405) (-337.528) -- 0:00:34
431500 -- [-335.218] (-336.172) (-337.709) (-339.836) * [-334.880] (-335.771) (-339.617) (-334.921) -- 0:00:34
432000 -- (-336.047) (-337.048) [-335.508] (-336.690) * (-337.100) (-335.198) [-337.388] (-340.298) -- 0:00:34
432500 -- [-338.182] (-337.673) (-335.241) (-335.281) * (-336.203) (-335.279) (-335.339) [-336.936] -- 0:00:34
433000 -- (-337.268) [-335.363] (-335.400) (-337.104) * (-334.713) [-335.887] (-336.595) (-335.201) -- 0:00:34
433500 -- [-335.371] (-343.386) (-335.505) (-334.995) * (-335.151) (-334.970) (-337.315) [-335.660] -- 0:00:33
434000 -- (-334.857) (-338.926) (-335.575) [-337.539] * (-337.008) (-334.846) [-335.286] (-338.453) -- 0:00:33
434500 -- (-337.215) (-338.429) [-335.993] (-338.353) * (-335.379) (-340.356) (-337.989) [-336.361] -- 0:00:33
435000 -- (-335.854) (-334.298) (-335.552) [-335.201] * (-338.065) (-337.359) [-335.155] (-339.340) -- 0:00:33
Average standard deviation of split frequencies: 0.011893
435500 -- [-334.739] (-336.192) (-335.923) (-337.334) * [-335.289] (-334.912) (-337.611) (-337.939) -- 0:00:33
436000 -- (-335.384) (-334.927) [-337.290] (-337.457) * (-337.756) (-335.847) (-338.159) [-335.048] -- 0:00:33
436500 -- (-335.631) [-336.433] (-336.308) (-338.201) * (-339.097) (-339.655) (-336.847) [-336.001] -- 0:00:33
437000 -- (-338.821) (-336.895) (-336.281) [-337.488] * (-337.486) [-339.157] (-335.804) (-334.792) -- 0:00:33
437500 -- (-336.679) [-336.751] (-339.490) (-335.358) * [-339.128] (-341.911) (-336.831) (-335.498) -- 0:00:33
438000 -- (-337.789) [-334.193] (-336.067) (-335.177) * (-338.428) (-335.940) [-335.261] (-342.901) -- 0:00:33
438500 -- (-337.176) (-334.199) [-334.743] (-336.695) * (-337.245) (-335.725) [-335.634] (-336.954) -- 0:00:33
439000 -- (-335.550) (-334.635) [-334.377] (-335.784) * [-336.838] (-336.762) (-337.120) (-336.001) -- 0:00:33
439500 -- [-334.551] (-338.148) (-334.640) (-334.863) * (-336.301) (-338.804) (-335.713) [-335.216] -- 0:00:33
440000 -- [-335.870] (-335.562) (-338.761) (-335.103) * (-334.258) (-336.657) (-336.579) [-335.335] -- 0:00:33
Average standard deviation of split frequencies: 0.011767
440500 -- [-334.767] (-336.857) (-335.051) (-334.794) * [-334.338] (-339.213) (-334.458) (-338.357) -- 0:00:33
441000 -- [-334.878] (-341.288) (-335.865) (-337.844) * (-334.537) [-335.196] (-335.607) (-336.911) -- 0:00:32
441500 -- (-334.987) (-336.240) [-337.750] (-342.681) * (-338.826) [-336.793] (-338.297) (-335.731) -- 0:00:32
442000 -- [-337.293] (-335.013) (-336.745) (-336.320) * (-337.590) [-340.996] (-334.759) (-335.798) -- 0:00:32
442500 -- [-335.462] (-334.929) (-335.415) (-336.509) * [-334.765] (-336.671) (-338.282) (-337.032) -- 0:00:32
443000 -- [-335.001] (-338.236) (-336.623) (-338.405) * (-334.560) (-337.960) (-344.073) [-337.088] -- 0:00:32
443500 -- (-337.167) [-335.097] (-335.555) (-339.529) * (-334.295) (-334.566) [-337.675] (-337.713) -- 0:00:32
444000 -- [-334.453] (-334.807) (-335.157) (-337.602) * (-334.405) (-335.093) (-335.716) [-337.278] -- 0:00:32
444500 -- (-338.971) (-335.424) [-337.692] (-336.912) * (-336.002) (-335.830) (-340.774) [-339.926] -- 0:00:33
445000 -- (-335.977) [-334.142] (-335.590) (-337.290) * (-335.977) (-337.256) [-334.834] (-335.515) -- 0:00:33
Average standard deviation of split frequencies: 0.011682
445500 -- (-336.595) (-333.816) (-336.407) [-338.676] * (-336.781) (-339.825) [-336.170] (-337.175) -- 0:00:33
446000 -- (-336.402) [-334.799] (-335.801) (-340.772) * (-336.463) (-339.833) [-338.355] (-336.483) -- 0:00:33
446500 -- (-336.069) [-334.523] (-335.882) (-339.925) * (-336.130) [-336.501] (-339.051) (-334.865) -- 0:00:33
447000 -- [-337.717] (-335.994) (-335.368) (-335.180) * (-338.943) (-340.525) (-335.086) [-335.234] -- 0:00:33
447500 -- (-335.220) (-336.573) [-336.297] (-334.541) * (-337.361) (-336.699) (-337.038) [-335.635] -- 0:00:33
448000 -- (-338.546) [-337.209] (-335.702) (-334.676) * (-334.311) (-341.858) [-338.764] (-335.885) -- 0:00:33
448500 -- (-334.509) (-336.263) (-337.648) [-334.628] * [-335.091] (-341.866) (-338.482) (-338.625) -- 0:00:33
449000 -- (-334.237) [-338.675] (-334.561) (-337.427) * [-336.934] (-335.891) (-338.137) (-336.830) -- 0:00:33
449500 -- [-335.351] (-335.693) (-336.262) (-334.772) * (-334.795) (-335.496) (-334.878) [-337.234] -- 0:00:33
450000 -- [-334.850] (-338.959) (-335.234) (-334.882) * (-335.970) [-334.580] (-335.450) (-334.826) -- 0:00:33
Average standard deviation of split frequencies: 0.011561
450500 -- (-335.214) [-340.738] (-338.104) (-339.149) * (-335.906) (-340.011) (-336.545) [-335.150] -- 0:00:32
451000 -- (-335.783) [-334.712] (-337.778) (-335.961) * (-335.313) (-339.651) (-336.337) [-335.515] -- 0:00:32
451500 -- (-339.320) (-337.076) [-336.332] (-334.453) * (-336.135) (-338.367) (-338.498) [-334.573] -- 0:00:32
452000 -- (-334.441) [-336.232] (-337.780) (-341.202) * (-334.338) [-335.254] (-335.777) (-343.213) -- 0:00:32
452500 -- (-336.509) (-338.789) (-335.223) [-337.488] * (-335.358) [-335.322] (-336.529) (-335.675) -- 0:00:32
453000 -- (-334.178) (-335.727) (-337.021) [-343.471] * (-336.181) [-338.590] (-335.990) (-337.564) -- 0:00:32
453500 -- (-335.448) [-334.916] (-336.940) (-336.488) * (-335.256) [-336.428] (-334.685) (-340.438) -- 0:00:32
454000 -- (-338.105) (-335.604) [-335.920] (-336.598) * (-335.401) (-334.846) (-335.260) [-334.704] -- 0:00:32
454500 -- [-337.800] (-335.045) (-339.653) (-335.801) * (-335.574) (-336.747) (-335.881) [-334.398] -- 0:00:32
455000 -- [-338.934] (-336.901) (-339.310) (-339.144) * (-340.916) (-337.101) (-335.925) [-334.932] -- 0:00:32
Average standard deviation of split frequencies: 0.011263
455500 -- (-335.124) (-339.829) (-336.182) [-336.550] * (-340.892) (-337.830) (-334.876) [-334.722] -- 0:00:32
456000 -- (-336.494) [-334.888] (-336.752) (-334.623) * (-338.335) [-339.652] (-338.864) (-337.583) -- 0:00:32
456500 -- (-336.841) [-336.108] (-336.702) (-334.452) * (-341.521) (-341.780) (-337.876) [-336.561] -- 0:00:32
457000 -- (-336.848) (-338.459) [-336.425] (-336.614) * [-338.902] (-337.090) (-338.689) (-336.734) -- 0:00:32
457500 -- [-336.358] (-338.360) (-340.963) (-336.589) * (-336.509) [-339.063] (-337.510) (-337.351) -- 0:00:32
458000 -- (-337.521) [-336.370] (-342.793) (-337.809) * (-345.834) (-337.859) (-343.633) [-338.588] -- 0:00:31
458500 -- (-335.211) (-336.562) [-336.969] (-336.498) * (-338.375) [-335.755] (-342.219) (-336.659) -- 0:00:31
459000 -- [-337.313] (-335.289) (-334.857) (-340.168) * (-337.370) (-338.065) [-338.605] (-340.483) -- 0:00:31
459500 -- (-335.942) [-340.387] (-334.086) (-336.108) * (-337.646) [-336.896] (-340.435) (-339.034) -- 0:00:31
460000 -- (-338.175) (-339.446) (-335.218) [-334.537] * (-337.529) (-335.057) (-335.746) [-336.526] -- 0:00:31
Average standard deviation of split frequencies: 0.010879
460500 -- (-336.006) (-335.639) (-335.382) [-333.982] * (-340.456) [-337.718] (-342.760) (-337.472) -- 0:00:31
461000 -- (-335.605) [-336.871] (-337.885) (-336.450) * (-337.739) (-336.071) (-338.610) [-336.192] -- 0:00:31
461500 -- (-334.474) (-336.711) [-338.905] (-337.961) * (-337.585) [-336.926] (-337.409) (-336.978) -- 0:00:31
462000 -- (-335.389) (-337.947) [-335.430] (-339.753) * [-337.591] (-338.256) (-336.230) (-335.886) -- 0:00:32
462500 -- (-336.337) (-341.620) (-340.731) [-337.777] * [-336.186] (-337.327) (-335.445) (-339.110) -- 0:00:32
463000 -- (-338.332) (-335.878) (-334.000) [-336.955] * (-336.128) [-339.706] (-337.388) (-342.010) -- 0:00:32
463500 -- [-336.611] (-337.323) (-335.220) (-336.275) * (-335.516) (-335.428) [-339.815] (-339.494) -- 0:00:32
464000 -- [-335.714] (-336.141) (-337.512) (-334.430) * (-335.435) (-336.021) [-336.087] (-337.361) -- 0:00:32
464500 -- (-338.344) (-336.611) (-334.294) [-339.471] * (-339.993) (-337.190) [-337.069] (-335.920) -- 0:00:32
465000 -- [-342.405] (-337.744) (-335.742) (-337.306) * (-338.526) (-337.050) (-334.573) [-335.068] -- 0:00:32
Average standard deviation of split frequencies: 0.011287
465500 -- (-338.310) (-334.719) (-335.504) [-338.833] * (-338.398) (-335.550) [-335.443] (-335.264) -- 0:00:32
466000 -- (-334.129) [-340.427] (-335.218) (-338.927) * (-336.509) (-334.521) [-335.865] (-336.242) -- 0:00:32
466500 -- (-336.949) [-341.116] (-334.543) (-337.871) * [-339.111] (-338.416) (-336.559) (-335.644) -- 0:00:32
467000 -- (-337.473) (-335.374) [-334.991] (-336.909) * [-336.794] (-334.211) (-335.672) (-337.330) -- 0:00:31
467500 -- (-337.123) (-334.369) [-337.512] (-335.543) * [-338.599] (-335.616) (-337.872) (-339.841) -- 0:00:31
468000 -- (-344.568) (-334.695) (-336.091) [-337.346] * (-335.475) (-335.670) [-336.398] (-340.309) -- 0:00:31
468500 -- [-336.845] (-337.050) (-336.460) (-340.276) * (-335.527) (-336.720) [-335.582] (-337.479) -- 0:00:31
469000 -- [-335.603] (-335.609) (-336.604) (-338.027) * (-335.052) (-336.999) (-334.921) [-337.528] -- 0:00:31
469500 -- (-337.991) (-335.870) [-338.053] (-338.761) * (-334.937) (-335.400) [-336.574] (-338.970) -- 0:00:31
470000 -- [-344.877] (-338.719) (-340.896) (-338.778) * [-336.479] (-337.580) (-337.028) (-338.701) -- 0:00:31
Average standard deviation of split frequencies: 0.011544
470500 -- (-335.941) (-334.695) [-339.455] (-338.427) * [-334.765] (-338.299) (-334.771) (-338.808) -- 0:00:31
471000 -- [-338.027] (-334.602) (-334.726) (-337.401) * [-335.741] (-338.101) (-345.525) (-337.569) -- 0:00:31
471500 -- (-338.172) (-338.520) (-336.222) [-335.306] * (-335.816) [-334.774] (-334.610) (-338.117) -- 0:00:31
472000 -- (-336.598) [-337.048] (-334.747) (-335.291) * (-337.432) (-338.322) (-335.144) [-335.467] -- 0:00:31
472500 -- (-336.036) (-335.395) (-336.934) [-336.807] * (-335.453) (-337.136) [-334.610] (-337.587) -- 0:00:31
473000 -- [-338.244] (-336.760) (-337.714) (-335.456) * [-339.757] (-336.425) (-337.092) (-335.416) -- 0:00:31
473500 -- (-334.443) (-339.479) (-335.107) [-338.245] * [-333.967] (-336.845) (-337.570) (-334.100) -- 0:00:31
474000 -- (-334.713) [-338.114] (-338.156) (-334.002) * (-337.526) (-339.249) [-335.128] (-336.180) -- 0:00:31
474500 -- (-338.662) (-339.974) [-337.290] (-335.091) * (-335.189) (-339.992) (-334.428) [-341.414] -- 0:00:31
475000 -- (-338.144) (-335.053) (-337.107) [-336.046] * (-337.311) (-335.562) (-335.673) [-335.639] -- 0:00:30
Average standard deviation of split frequencies: 0.010998
475500 -- (-334.805) [-335.886] (-336.687) (-337.804) * (-334.810) (-336.125) [-333.931] (-337.417) -- 0:00:30
476000 -- [-334.640] (-336.171) (-335.367) (-341.799) * [-337.460] (-334.038) (-334.873) (-334.753) -- 0:00:30
476500 -- (-337.730) [-341.896] (-336.357) (-341.856) * (-335.147) (-334.438) [-336.060] (-336.466) -- 0:00:30
477000 -- (-338.204) (-336.306) (-337.019) [-340.897] * [-334.593] (-337.653) (-337.076) (-336.662) -- 0:00:30
477500 -- (-339.029) (-335.652) (-337.470) [-336.614] * (-334.848) (-338.622) (-337.400) [-335.219] -- 0:00:30
478000 -- (-334.681) (-337.859) (-336.267) [-335.850] * (-334.683) (-334.120) (-338.253) [-335.636] -- 0:00:30
478500 -- (-334.514) [-334.370] (-335.071) (-335.569) * (-334.321) (-334.570) (-336.376) [-339.105] -- 0:00:30
479000 -- (-334.608) (-334.358) (-336.337) [-334.455] * (-337.149) (-336.496) [-334.994] (-337.658) -- 0:00:31
479500 -- (-337.140) (-335.373) (-335.468) [-335.552] * [-336.962] (-336.037) (-336.411) (-336.181) -- 0:00:31
480000 -- (-338.087) (-335.410) (-337.369) [-336.416] * (-335.206) (-336.625) (-335.881) [-336.968] -- 0:00:31
Average standard deviation of split frequencies: 0.010375
480500 -- (-336.402) (-335.772) [-335.335] (-340.589) * [-335.531] (-336.255) (-339.631) (-336.176) -- 0:00:31
481000 -- [-335.165] (-334.717) (-339.932) (-334.530) * (-335.246) (-334.403) (-337.313) [-334.288] -- 0:00:31
481500 -- (-335.047) [-337.462] (-334.535) (-334.713) * [-334.712] (-334.179) (-335.524) (-335.064) -- 0:00:31
482000 -- (-337.849) (-340.587) [-337.384] (-338.801) * (-338.800) (-336.593) [-334.599] (-338.038) -- 0:00:31
482500 -- (-337.112) [-338.325] (-334.825) (-341.239) * (-336.921) (-338.589) [-334.075] (-335.528) -- 0:00:31
483000 -- (-335.274) (-336.743) (-336.108) [-338.059] * (-335.389) (-335.231) [-334.940] (-335.497) -- 0:00:31
483500 -- (-337.995) [-334.789] (-336.198) (-335.206) * (-337.127) (-334.461) (-335.701) [-337.592] -- 0:00:30
484000 -- [-338.924] (-335.493) (-342.016) (-335.307) * (-339.209) (-335.328) [-333.982] (-334.723) -- 0:00:30
484500 -- [-336.666] (-336.412) (-335.971) (-336.389) * [-337.810] (-336.080) (-336.478) (-336.543) -- 0:00:30
485000 -- (-338.868) [-335.021] (-335.183) (-336.051) * (-340.012) (-337.403) (-339.829) [-336.447] -- 0:00:30
Average standard deviation of split frequencies: 0.010185
485500 -- (-335.304) [-334.441] (-339.554) (-337.567) * (-337.770) (-334.782) [-335.683] (-338.798) -- 0:00:30
486000 -- [-336.582] (-335.027) (-338.508) (-339.118) * (-338.408) [-334.572] (-335.422) (-335.968) -- 0:00:30
486500 -- (-334.985) (-335.789) [-335.336] (-339.419) * (-336.056) (-334.557) [-334.437] (-337.856) -- 0:00:30
487000 -- (-336.285) (-337.695) [-336.270] (-335.644) * (-339.039) (-336.349) (-335.137) [-337.454] -- 0:00:30
487500 -- [-336.073] (-337.911) (-336.437) (-336.159) * (-335.595) (-335.486) [-334.826] (-337.140) -- 0:00:30
488000 -- (-336.846) [-334.930] (-334.801) (-340.531) * (-335.939) [-334.021] (-335.456) (-337.293) -- 0:00:30
488500 -- (-335.949) (-342.588) (-336.099) [-337.650] * (-337.276) (-334.945) (-334.383) [-335.670] -- 0:00:30
489000 -- (-334.306) [-341.923] (-335.707) (-336.346) * (-336.465) (-337.630) (-334.217) [-335.459] -- 0:00:30
489500 -- (-339.320) (-334.173) [-335.436] (-335.031) * (-339.119) (-334.727) (-334.703) [-335.906] -- 0:00:30
490000 -- (-337.649) (-334.375) (-335.751) [-335.758] * (-338.091) [-336.092] (-337.344) (-336.533) -- 0:00:30
Average standard deviation of split frequencies: 0.009981
490500 -- (-337.515) (-334.569) [-334.880] (-340.350) * (-336.234) (-339.563) (-339.335) [-337.158] -- 0:00:30
491000 -- [-335.868] (-335.426) (-339.234) (-335.467) * (-334.854) (-336.124) [-334.730] (-334.487) -- 0:00:30
491500 -- [-340.379] (-337.215) (-336.047) (-337.254) * (-335.804) [-338.263] (-334.714) (-339.896) -- 0:00:30
492000 -- [-337.153] (-334.504) (-338.154) (-335.529) * (-337.011) (-336.833) (-335.525) [-338.096] -- 0:00:29
492500 -- (-335.013) (-339.335) (-334.945) [-337.495] * [-339.244] (-337.207) (-335.974) (-336.455) -- 0:00:29
493000 -- (-335.988) [-337.611] (-337.487) (-336.292) * (-336.129) [-334.540] (-334.578) (-335.536) -- 0:00:29
493500 -- [-334.958] (-339.012) (-336.933) (-335.834) * (-333.906) (-344.623) (-334.217) [-337.791] -- 0:00:29
494000 -- (-336.502) (-338.207) [-334.203] (-339.780) * (-334.975) [-336.892] (-335.333) (-335.311) -- 0:00:29
494500 -- [-335.295] (-338.044) (-334.993) (-339.646) * (-334.878) [-334.305] (-335.001) (-340.234) -- 0:00:29
495000 -- (-335.268) [-336.125] (-335.604) (-339.628) * (-337.649) [-336.526] (-337.121) (-337.461) -- 0:00:29
Average standard deviation of split frequencies: 0.009927
495500 -- [-336.358] (-335.550) (-336.035) (-337.622) * (-337.131) (-338.626) [-335.215] (-334.379) -- 0:00:29
496000 -- (-336.510) [-337.505] (-339.322) (-335.060) * [-337.309] (-335.417) (-338.349) (-336.054) -- 0:00:30
496500 -- [-334.124] (-336.336) (-336.128) (-338.834) * (-337.069) (-340.109) [-336.065] (-337.106) -- 0:00:30
497000 -- [-334.836] (-335.155) (-336.201) (-337.598) * [-336.301] (-336.074) (-338.328) (-338.199) -- 0:00:30
497500 -- (-335.304) (-335.253) (-335.126) [-334.882] * (-335.009) (-335.314) [-336.914] (-338.533) -- 0:00:30
498000 -- (-336.716) (-339.774) [-333.860] (-337.394) * [-336.761] (-334.709) (-336.562) (-340.196) -- 0:00:30
498500 -- (-337.416) (-334.288) [-334.334] (-334.024) * (-334.202) [-335.381] (-335.020) (-336.289) -- 0:00:30
499000 -- (-337.927) (-334.310) (-334.878) [-334.037] * (-336.668) (-334.960) (-337.199) [-334.686] -- 0:00:30
499500 -- (-337.579) (-335.716) [-336.246] (-335.515) * (-337.479) (-334.485) [-337.545] (-337.224) -- 0:00:30
500000 -- (-334.066) (-337.320) (-338.399) [-337.483] * (-336.174) [-335.410] (-335.256) (-336.229) -- 0:00:30
Average standard deviation of split frequencies: 0.009363
500500 -- (-335.238) (-338.201) (-340.321) [-337.367] * (-337.536) (-336.944) (-336.069) [-335.987] -- 0:00:29
501000 -- (-334.699) [-337.542] (-336.520) (-338.209) * (-337.511) [-336.646] (-336.043) (-339.164) -- 0:00:29
501500 -- [-335.227] (-336.127) (-335.001) (-339.443) * (-334.640) [-335.054] (-337.678) (-336.177) -- 0:00:29
502000 -- (-336.400) (-335.657) [-333.847] (-340.965) * [-335.628] (-335.904) (-338.998) (-336.847) -- 0:00:29
502500 -- [-335.188] (-335.975) (-334.717) (-338.609) * [-336.827] (-335.773) (-342.051) (-337.060) -- 0:00:29
503000 -- [-335.233] (-338.859) (-335.761) (-336.567) * [-336.378] (-336.933) (-333.912) (-334.333) -- 0:00:29
503500 -- (-337.670) [-338.408] (-342.683) (-336.421) * (-334.292) [-336.447] (-334.985) (-334.314) -- 0:00:29
504000 -- (-341.403) (-339.821) (-335.238) [-336.376] * [-335.212] (-334.811) (-336.049) (-336.539) -- 0:00:29
504500 -- (-342.181) (-336.201) (-336.347) [-336.595] * (-336.862) (-337.791) (-339.506) [-334.806] -- 0:00:29
505000 -- (-335.793) (-337.871) [-336.328] (-338.489) * [-336.891] (-339.315) (-336.890) (-334.688) -- 0:00:29
Average standard deviation of split frequencies: 0.009627
505500 -- (-339.090) (-337.112) (-335.376) [-335.522] * (-336.478) [-334.532] (-336.314) (-337.572) -- 0:00:29
506000 -- (-336.452) (-338.820) [-336.957] (-337.244) * (-334.747) [-336.295] (-335.063) (-339.521) -- 0:00:29
506500 -- (-337.363) (-337.454) (-336.965) [-335.934] * (-335.112) (-336.987) [-335.554] (-336.205) -- 0:00:29
507000 -- [-336.186] (-334.879) (-337.367) (-336.608) * [-334.733] (-339.108) (-337.141) (-339.663) -- 0:00:29
507500 -- (-335.446) [-336.076] (-336.365) (-338.418) * (-337.398) [-334.749] (-337.238) (-334.044) -- 0:00:29
508000 -- (-335.712) [-334.259] (-336.871) (-336.320) * [-338.410] (-338.516) (-335.599) (-334.413) -- 0:00:29
508500 -- (-336.058) [-335.382] (-335.418) (-335.634) * (-334.695) (-337.533) (-336.601) [-336.734] -- 0:00:28
509000 -- (-335.306) (-335.579) [-336.113] (-337.741) * (-336.256) (-336.674) (-335.156) [-337.457] -- 0:00:28
509500 -- (-339.320) (-335.795) [-335.082] (-336.295) * [-335.768] (-336.158) (-334.718) (-338.005) -- 0:00:28
510000 -- (-334.193) (-336.556) [-334.703] (-337.784) * [-334.456] (-337.081) (-335.757) (-335.014) -- 0:00:28
Average standard deviation of split frequencies: 0.008872
510500 -- (-337.206) (-337.493) (-336.178) [-335.513] * [-338.719] (-335.884) (-340.380) (-337.072) -- 0:00:28
511000 -- (-335.095) (-334.890) [-334.917] (-335.036) * (-337.194) (-334.893) (-337.249) [-340.124] -- 0:00:28
511500 -- [-338.501] (-335.473) (-339.015) (-335.372) * (-336.247) (-334.567) [-335.024] (-337.022) -- 0:00:28
512000 -- [-335.758] (-338.851) (-335.710) (-336.111) * (-334.444) (-336.299) [-337.739] (-336.913) -- 0:00:28
512500 -- (-337.369) [-337.096] (-335.003) (-341.129) * (-336.210) (-339.079) [-337.045] (-336.665) -- 0:00:28
513000 -- (-334.567) (-337.879) (-337.466) [-335.746] * (-340.018) (-336.153) (-336.608) [-334.320] -- 0:00:29
513500 -- (-336.378) (-338.422) [-335.841] (-335.848) * [-337.367] (-336.398) (-335.482) (-338.333) -- 0:00:29
514000 -- (-335.305) (-337.166) (-336.088) [-337.996] * [-338.593] (-335.107) (-336.252) (-337.223) -- 0:00:29
514500 -- (-335.346) (-337.393) [-339.233] (-334.128) * (-337.824) [-333.941] (-335.983) (-335.413) -- 0:00:29
515000 -- (-335.005) [-339.264] (-336.715) (-335.860) * (-337.383) (-334.302) (-342.265) [-334.693] -- 0:00:29
Average standard deviation of split frequencies: 0.008831
515500 -- (-335.195) (-334.059) (-335.974) [-334.663] * (-336.901) [-335.222] (-337.166) (-336.662) -- 0:00:29
516000 -- (-335.502) [-335.385] (-336.938) (-333.889) * [-336.528] (-336.668) (-335.765) (-338.963) -- 0:00:29
516500 -- (-334.430) [-335.032] (-336.507) (-337.709) * [-336.592] (-335.451) (-337.353) (-336.677) -- 0:00:29
517000 -- (-337.637) [-337.275] (-335.229) (-335.118) * (-337.874) (-334.147) (-336.345) [-334.878] -- 0:00:28
517500 -- (-338.636) [-336.250] (-335.901) (-334.541) * [-334.517] (-335.268) (-337.862) (-338.058) -- 0:00:28
518000 -- (-335.054) [-336.565] (-334.951) (-338.980) * (-336.358) (-336.954) [-336.150] (-335.103) -- 0:00:28
518500 -- (-335.766) (-338.031) [-339.291] (-336.306) * [-334.642] (-335.398) (-337.718) (-335.735) -- 0:00:28
519000 -- (-334.724) (-334.940) (-335.155) [-334.682] * (-340.600) [-337.603] (-339.269) (-335.071) -- 0:00:28
519500 -- (-337.036) [-336.690] (-340.325) (-335.749) * [-342.183] (-336.743) (-337.193) (-337.655) -- 0:00:28
520000 -- (-336.704) (-335.290) (-342.386) [-335.044] * (-340.771) (-338.719) [-336.764] (-337.008) -- 0:00:28
Average standard deviation of split frequencies: 0.009305
520500 -- (-336.434) (-334.435) (-335.691) [-336.786] * (-339.170) [-337.582] (-337.363) (-338.343) -- 0:00:28
521000 -- (-337.052) (-334.106) (-334.139) [-335.184] * [-334.877] (-340.076) (-337.718) (-344.270) -- 0:00:28
521500 -- (-335.213) [-335.544] (-337.092) (-335.581) * (-337.460) (-335.788) (-339.258) [-341.313] -- 0:00:28
522000 -- (-335.897) [-336.361] (-334.918) (-336.912) * [-335.867] (-339.753) (-338.859) (-337.766) -- 0:00:28
522500 -- (-335.509) (-336.554) [-335.167] (-338.425) * (-339.172) (-334.964) [-334.806] (-334.943) -- 0:00:28
523000 -- [-335.503] (-335.818) (-337.302) (-335.111) * (-337.843) [-334.957] (-335.718) (-336.810) -- 0:00:28
523500 -- (-333.926) (-336.901) (-338.886) [-335.506] * (-337.446) (-335.261) (-334.795) [-336.974] -- 0:00:28
524000 -- [-334.659] (-338.634) (-337.867) (-341.515) * [-337.430] (-335.503) (-334.533) (-336.738) -- 0:00:28
524500 -- [-336.239] (-337.761) (-335.963) (-344.827) * (-335.032) (-339.023) [-337.608] (-336.467) -- 0:00:28
525000 -- [-336.019] (-336.775) (-338.448) (-338.102) * [-335.212] (-336.852) (-334.242) (-337.975) -- 0:00:28
Average standard deviation of split frequencies: 0.009012
525500 -- (-337.904) (-337.671) [-335.830] (-344.525) * [-335.136] (-340.335) (-335.329) (-338.290) -- 0:00:27
526000 -- (-336.418) [-335.554] (-334.371) (-337.471) * (-335.137) (-339.385) (-336.315) [-338.482] -- 0:00:27
526500 -- [-336.417] (-337.643) (-336.980) (-334.965) * (-334.092) (-336.018) [-337.079] (-334.340) -- 0:00:27
527000 -- [-337.564] (-340.744) (-335.670) (-334.158) * [-335.372] (-334.982) (-338.316) (-334.389) -- 0:00:27
527500 -- (-335.016) (-338.440) [-335.731] (-337.661) * (-335.991) (-337.409) [-336.437] (-336.374) -- 0:00:27
528000 -- (-336.096) [-338.012] (-338.152) (-342.056) * (-335.928) (-337.344) (-337.229) [-337.281] -- 0:00:27
528500 -- (-338.441) (-339.190) [-338.979] (-338.139) * (-335.789) [-335.003] (-336.543) (-337.323) -- 0:00:27
529000 -- (-338.289) (-336.227) [-335.586] (-334.352) * (-335.821) (-337.846) [-335.107] (-335.709) -- 0:00:27
529500 -- (-338.550) (-336.328) (-334.273) [-336.126] * (-336.839) (-336.520) (-340.730) [-336.992] -- 0:00:27
530000 -- (-335.372) (-333.943) (-338.489) [-337.482] * (-338.092) [-335.824] (-337.218) (-337.353) -- 0:00:28
Average standard deviation of split frequencies: 0.008785
530500 -- (-334.971) (-335.648) (-339.719) [-334.499] * [-337.371] (-335.811) (-338.176) (-335.289) -- 0:00:28
531000 -- [-335.110] (-334.509) (-336.960) (-339.548) * [-335.924] (-335.969) (-336.463) (-341.492) -- 0:00:28
531500 -- (-336.192) [-336.908] (-338.254) (-335.335) * (-335.742) (-336.597) [-334.536] (-338.384) -- 0:00:28
532000 -- [-337.401] (-337.435) (-335.106) (-336.637) * (-336.278) (-334.832) [-335.877] (-338.747) -- 0:00:28
532500 -- (-336.363) [-334.998] (-335.839) (-336.133) * (-335.631) [-339.793] (-339.210) (-335.959) -- 0:00:28
533000 -- [-335.901] (-335.319) (-342.155) (-336.596) * [-335.499] (-335.957) (-336.456) (-337.492) -- 0:00:28
533500 -- (-334.785) (-339.424) (-338.517) [-336.630] * (-335.720) (-335.101) (-334.560) [-334.453] -- 0:00:27
534000 -- (-341.926) (-337.812) (-338.309) [-336.632] * (-337.789) (-338.091) (-335.593) [-334.412] -- 0:00:27
534500 -- (-337.039) (-335.595) (-338.083) [-337.467] * [-335.234] (-336.250) (-339.926) (-337.957) -- 0:00:27
535000 -- [-335.973] (-335.107) (-338.191) (-335.588) * [-336.968] (-335.537) (-339.917) (-335.587) -- 0:00:27
Average standard deviation of split frequencies: 0.008306
535500 -- (-337.107) (-336.233) [-337.188] (-335.488) * (-338.445) (-334.850) (-344.051) [-334.043] -- 0:00:27
536000 -- (-338.478) (-335.477) (-335.799) [-337.220] * [-335.970] (-339.671) (-338.497) (-334.969) -- 0:00:27
536500 -- [-339.179] (-334.530) (-335.233) (-337.523) * (-336.275) (-339.971) (-335.495) [-338.337] -- 0:00:27
537000 -- [-340.950] (-336.080) (-338.612) (-339.152) * (-335.704) (-339.486) [-336.007] (-341.126) -- 0:00:27
537500 -- (-336.827) [-336.105] (-338.960) (-335.813) * [-335.938] (-337.522) (-335.747) (-334.254) -- 0:00:27
538000 -- (-336.138) (-336.320) [-336.615] (-337.035) * (-336.549) (-338.624) (-337.939) [-334.477] -- 0:00:27
538500 -- [-336.011] (-336.055) (-335.267) (-336.063) * [-336.939] (-336.381) (-335.518) (-336.822) -- 0:00:27
539000 -- (-335.875) (-334.665) (-335.693) [-334.435] * (-337.400) (-339.559) (-335.955) [-334.258] -- 0:00:27
539500 -- (-338.721) (-334.769) [-335.924] (-336.575) * (-335.562) (-335.538) (-337.813) [-335.053] -- 0:00:27
540000 -- [-336.849] (-336.618) (-336.729) (-336.511) * (-339.912) (-335.357) [-336.097] (-334.664) -- 0:00:27
Average standard deviation of split frequencies: 0.008206
540500 -- [-338.473] (-334.770) (-338.453) (-338.600) * (-336.086) [-336.727] (-340.228) (-335.880) -- 0:00:27
541000 -- [-338.410] (-335.545) (-335.689) (-339.214) * (-335.119) (-340.103) (-334.236) [-336.228] -- 0:00:27
541500 -- (-335.178) [-335.401] (-336.210) (-335.180) * (-340.083) [-336.011] (-337.906) (-337.072) -- 0:00:27
542000 -- (-335.975) [-336.207] (-337.419) (-336.113) * (-336.404) (-335.231) (-336.212) [-335.450] -- 0:00:27
542500 -- (-334.749) (-338.222) (-333.986) [-336.965] * (-338.477) (-334.861) (-338.956) [-334.149] -- 0:00:26
543000 -- (-335.250) [-336.980] (-336.393) (-337.078) * (-337.229) [-334.155] (-334.832) (-334.782) -- 0:00:26
543500 -- [-335.766] (-335.134) (-336.051) (-339.898) * [-335.289] (-336.116) (-336.724) (-335.558) -- 0:00:26
544000 -- [-340.968] (-338.725) (-339.432) (-338.610) * (-335.907) (-334.888) [-334.831] (-337.098) -- 0:00:26
544500 -- (-335.195) (-337.116) [-337.078] (-335.269) * (-338.182) (-333.947) [-336.556] (-335.593) -- 0:00:26
545000 -- (-334.110) (-335.831) (-337.710) [-337.207] * (-335.565) [-337.867] (-335.896) (-336.161) -- 0:00:26
Average standard deviation of split frequencies: 0.008431
545500 -- (-336.623) (-334.992) (-336.871) [-335.173] * [-340.685] (-338.242) (-336.210) (-335.116) -- 0:00:26
546000 -- (-335.536) (-335.710) (-334.447) [-335.859] * (-339.872) (-336.617) (-335.253) [-335.998] -- 0:00:26
546500 -- [-337.198] (-343.677) (-334.950) (-335.701) * [-340.217] (-338.496) (-338.850) (-336.691) -- 0:00:27
547000 -- (-336.675) (-339.926) [-335.667] (-336.160) * [-336.748] (-336.460) (-335.948) (-335.004) -- 0:00:27
547500 -- (-336.394) [-336.449] (-334.594) (-335.982) * (-336.055) [-334.082] (-335.868) (-335.821) -- 0:00:27
548000 -- (-337.248) (-336.313) (-338.328) [-339.274] * (-335.079) (-334.310) (-335.917) [-337.206] -- 0:00:27
548500 -- (-335.825) (-334.999) [-336.030] (-335.751) * (-335.132) (-335.947) [-335.431] (-340.911) -- 0:00:27
549000 -- (-336.479) (-335.948) [-338.768] (-335.954) * (-334.481) (-335.029) [-336.783] (-340.798) -- 0:00:27
549500 -- [-335.959] (-336.477) (-334.770) (-335.804) * [-336.803] (-336.615) (-337.543) (-334.839) -- 0:00:27
550000 -- (-338.365) (-341.614) (-334.095) [-335.784] * (-336.667) [-335.970] (-334.062) (-336.391) -- 0:00:27
Average standard deviation of split frequencies: 0.008561
550500 -- (-336.233) (-336.714) (-338.855) [-335.128] * (-339.142) [-336.971] (-335.418) (-335.338) -- 0:00:26
551000 -- (-336.339) [-335.382] (-335.772) (-334.500) * (-335.684) (-338.274) (-336.149) [-336.363] -- 0:00:26
551500 -- (-337.795) (-335.711) [-335.392] (-334.589) * (-335.564) (-336.604) [-336.183] (-337.120) -- 0:00:26
552000 -- [-334.898] (-338.635) (-339.752) (-336.089) * (-335.833) (-336.610) [-337.790] (-336.727) -- 0:00:26
552500 -- (-336.978) [-335.444] (-339.406) (-339.752) * [-336.244] (-334.043) (-335.502) (-334.667) -- 0:00:26
553000 -- (-334.440) [-334.572] (-336.052) (-335.231) * (-334.457) (-336.597) (-336.349) [-335.381] -- 0:00:26
553500 -- (-335.518) [-334.885] (-336.327) (-334.855) * (-339.894) (-337.433) (-337.736) [-335.722] -- 0:00:26
554000 -- (-335.830) (-340.132) [-335.691] (-336.348) * (-339.227) (-334.709) (-336.945) [-335.636] -- 0:00:26
554500 -- (-335.129) (-336.439) (-339.105) [-337.385] * [-336.701] (-336.707) (-334.804) (-337.548) -- 0:00:26
555000 -- [-337.185] (-335.424) (-342.846) (-336.313) * [-336.810] (-335.395) (-335.638) (-340.115) -- 0:00:26
Average standard deviation of split frequencies: 0.008977
555500 -- (-336.645) [-335.101] (-342.658) (-334.879) * (-340.988) (-337.768) (-334.768) [-337.979] -- 0:00:26
556000 -- [-335.397] (-335.920) (-336.705) (-338.579) * (-341.400) [-335.355] (-338.460) (-335.762) -- 0:00:26
556500 -- (-334.300) [-335.420] (-338.315) (-336.087) * (-338.599) (-336.846) [-337.316] (-334.970) -- 0:00:26
557000 -- (-334.417) (-337.977) (-337.642) [-338.171] * (-339.638) (-342.107) [-334.527] (-338.182) -- 0:00:26
557500 -- (-337.414) (-339.339) [-335.277] (-336.363) * (-335.067) (-337.965) (-335.622) [-338.719] -- 0:00:26
558000 -- (-338.131) [-334.332] (-338.542) (-337.107) * (-334.951) (-338.686) (-336.690) [-339.070] -- 0:00:26
558500 -- (-336.735) (-335.213) (-335.872) [-335.410] * (-335.760) (-334.282) (-336.810) [-336.313] -- 0:00:26
559000 -- (-336.142) [-334.233] (-334.449) (-335.263) * [-336.310] (-334.505) (-335.673) (-340.380) -- 0:00:26
559500 -- [-334.531] (-336.943) (-334.334) (-336.316) * (-336.257) (-337.431) (-335.735) [-340.108] -- 0:00:25
560000 -- (-335.698) (-334.599) [-335.231] (-336.897) * (-335.234) (-335.057) [-338.166] (-335.506) -- 0:00:25
Average standard deviation of split frequencies: 0.008952
560500 -- (-335.693) (-335.913) (-339.042) [-334.333] * (-337.089) [-335.110] (-336.705) (-338.028) -- 0:00:25
561000 -- (-335.225) (-339.010) (-337.718) [-334.976] * (-339.509) [-334.321] (-336.178) (-336.966) -- 0:00:25
561500 -- (-334.867) (-341.585) (-338.944) [-336.809] * (-334.505) [-336.607] (-338.955) (-334.935) -- 0:00:25
562000 -- (-334.168) [-334.598] (-336.171) (-336.024) * (-341.638) [-339.654] (-336.336) (-337.862) -- 0:00:25
562500 -- (-334.881) [-334.190] (-336.692) (-339.140) * (-337.045) [-343.434] (-336.797) (-336.038) -- 0:00:25
563000 -- (-335.463) [-339.078] (-334.072) (-335.956) * (-336.771) (-343.636) (-335.135) [-337.362] -- 0:00:25
563500 -- (-335.401) (-335.461) (-336.213) [-336.479] * (-337.812) (-343.392) [-334.819] (-341.432) -- 0:00:25
564000 -- (-334.639) (-339.823) [-335.425] (-339.911) * (-337.339) (-340.682) [-336.142] (-340.056) -- 0:00:26
564500 -- (-334.574) (-335.608) (-336.427) [-334.246] * [-335.410] (-336.266) (-337.758) (-335.897) -- 0:00:26
565000 -- [-334.949] (-335.577) (-334.913) (-334.499) * [-334.682] (-334.519) (-336.557) (-336.941) -- 0:00:26
Average standard deviation of split frequencies: 0.009015
565500 -- [-336.589] (-337.219) (-334.715) (-335.353) * (-335.717) [-336.658] (-336.924) (-336.259) -- 0:00:26
566000 -- (-337.105) (-338.037) (-334.488) [-335.474] * (-335.623) [-334.857] (-336.894) (-333.979) -- 0:00:26
566500 -- [-338.441] (-338.620) (-336.455) (-339.636) * (-335.982) [-340.079] (-336.637) (-335.421) -- 0:00:26
567000 -- [-334.344] (-338.098) (-336.077) (-338.053) * (-338.313) (-335.662) (-337.715) [-339.615] -- 0:00:25
567500 -- (-343.312) (-335.382) (-336.603) [-342.441] * (-334.997) (-337.286) [-336.721] (-337.453) -- 0:00:25
568000 -- (-342.546) (-335.179) [-335.869] (-337.964) * [-334.912] (-335.450) (-336.337) (-334.426) -- 0:00:25
568500 -- [-334.692] (-334.131) (-334.778) (-334.622) * (-336.415) [-334.642] (-340.579) (-336.441) -- 0:00:25
569000 -- [-336.482] (-334.799) (-336.574) (-335.061) * (-335.922) [-335.688] (-336.452) (-336.104) -- 0:00:25
569500 -- (-338.330) (-335.467) (-335.552) [-334.867] * (-337.875) (-335.161) (-338.705) [-337.062] -- 0:00:25
570000 -- (-339.665) (-334.765) (-340.718) [-334.343] * (-338.101) [-338.725] (-334.991) (-334.844) -- 0:00:25
Average standard deviation of split frequencies: 0.008892
570500 -- (-336.994) [-335.272] (-335.304) (-336.300) * (-334.935) (-339.433) (-336.133) [-334.889] -- 0:00:25
571000 -- [-336.456] (-336.549) (-337.256) (-334.562) * (-337.711) [-336.242] (-338.210) (-335.739) -- 0:00:25
571500 -- (-334.154) (-334.672) [-336.396] (-336.189) * (-337.337) (-334.556) (-337.091) [-333.949] -- 0:00:25
572000 -- (-335.826) [-337.612] (-338.875) (-336.080) * (-334.838) (-336.376) (-342.009) [-338.036] -- 0:00:25
572500 -- (-335.736) [-334.682] (-339.358) (-334.368) * [-334.974] (-338.122) (-335.732) (-342.326) -- 0:00:25
573000 -- (-336.192) [-335.126] (-335.433) (-335.153) * (-337.198) [-334.952] (-334.597) (-337.593) -- 0:00:25
573500 -- (-335.029) (-334.636) (-337.434) [-336.163] * (-335.176) (-336.014) (-334.892) [-337.114] -- 0:00:25
574000 -- (-334.746) [-335.472] (-340.843) (-335.494) * (-336.105) (-334.953) (-335.884) [-338.368] -- 0:00:25
574500 -- (-336.369) [-334.642] (-336.291) (-335.179) * (-338.808) (-335.830) (-334.783) [-335.131] -- 0:00:25
575000 -- (-339.663) (-337.599) (-339.270) [-335.344] * [-334.747] (-340.158) (-334.510) (-334.497) -- 0:00:25
Average standard deviation of split frequencies: 0.008798
575500 -- (-334.835) (-341.191) [-338.587] (-334.408) * [-335.965] (-336.170) (-337.444) (-335.060) -- 0:00:25
576000 -- (-338.176) [-334.572] (-335.821) (-334.311) * (-335.916) [-336.186] (-338.309) (-336.210) -- 0:00:25
576500 -- (-336.777) (-336.845) (-340.920) [-334.351] * (-336.641) (-334.291) [-334.901] (-335.203) -- 0:00:24
577000 -- [-334.326] (-339.253) (-337.942) (-336.328) * (-337.456) (-336.654) [-335.221] (-335.567) -- 0:00:24
577500 -- [-334.866] (-336.819) (-340.592) (-334.602) * (-337.630) (-336.942) (-335.356) [-337.221] -- 0:00:24
578000 -- (-335.583) (-337.705) (-337.351) [-334.537] * (-336.575) (-335.798) [-334.682] (-335.574) -- 0:00:24
578500 -- (-342.150) (-335.418) (-338.432) [-336.353] * [-336.509] (-336.020) (-335.093) (-336.675) -- 0:00:24
579000 -- (-336.766) (-339.976) (-339.747) [-334.239] * (-337.980) (-336.925) (-336.544) [-335.236] -- 0:00:24
579500 -- [-336.000] (-334.415) (-335.744) (-336.554) * (-338.877) (-337.659) [-336.072] (-336.036) -- 0:00:24
580000 -- (-336.618) [-337.642] (-335.144) (-335.823) * [-335.596] (-334.911) (-338.189) (-336.796) -- 0:00:24
Average standard deviation of split frequencies: 0.008644
580500 -- [-338.934] (-335.534) (-334.527) (-336.484) * [-335.846] (-336.239) (-336.587) (-334.453) -- 0:00:24
581000 -- (-335.986) [-336.224] (-334.403) (-338.566) * (-335.337) (-337.102) [-337.785] (-340.948) -- 0:00:25
581500 -- (-343.963) (-334.333) (-335.927) [-337.895] * (-336.078) (-336.028) (-336.958) [-336.152] -- 0:00:25
582000 -- (-343.892) [-334.209] (-337.125) (-339.026) * (-335.294) (-334.944) (-335.200) [-336.225] -- 0:00:25
582500 -- [-335.804] (-336.322) (-341.118) (-336.161) * [-335.595] (-334.330) (-334.713) (-336.914) -- 0:00:25
583000 -- (-335.463) (-334.926) [-337.033] (-339.895) * (-335.450) (-335.598) [-336.514] (-336.888) -- 0:00:25
583500 -- (-337.452) [-334.756] (-337.036) (-335.374) * (-336.760) (-334.511) (-336.048) [-335.720] -- 0:00:24
584000 -- [-335.196] (-336.196) (-341.193) (-336.916) * (-339.600) (-339.598) [-334.940] (-335.301) -- 0:00:24
584500 -- [-337.279] (-336.115) (-335.890) (-336.273) * (-334.612) [-335.975] (-335.707) (-336.460) -- 0:00:24
585000 -- [-335.420] (-336.275) (-338.070) (-335.189) * (-337.626) (-339.447) [-334.444] (-334.926) -- 0:00:24
Average standard deviation of split frequencies: 0.008849
585500 -- [-335.706] (-336.540) (-336.167) (-337.851) * [-336.143] (-337.166) (-338.977) (-337.444) -- 0:00:24
586000 -- (-336.398) (-335.348) [-335.596] (-335.438) * [-340.940] (-337.001) (-339.523) (-334.185) -- 0:00:24
586500 -- (-339.372) (-338.738) [-335.183] (-336.405) * [-335.428] (-335.035) (-336.903) (-337.932) -- 0:00:24
587000 -- (-335.643) (-334.286) (-333.915) [-335.785] * (-336.503) [-337.417] (-335.303) (-335.256) -- 0:00:24
587500 -- (-334.791) (-337.061) [-337.474] (-336.438) * (-337.045) (-337.371) [-335.713] (-334.469) -- 0:00:24
588000 -- [-335.709] (-337.204) (-337.508) (-335.890) * (-335.696) [-338.154] (-334.871) (-336.402) -- 0:00:24
588500 -- (-336.742) [-336.979] (-336.835) (-335.400) * (-334.753) [-337.625] (-336.841) (-337.809) -- 0:00:24
589000 -- (-337.193) (-335.623) (-336.540) [-335.606] * [-335.821] (-335.349) (-334.584) (-335.432) -- 0:00:24
589500 -- (-339.455) (-337.257) [-334.355] (-337.245) * (-335.262) (-336.159) (-335.455) [-335.534] -- 0:00:24
590000 -- (-338.875) [-337.002] (-335.415) (-337.295) * [-339.656] (-337.759) (-335.958) (-334.079) -- 0:00:24
Average standard deviation of split frequencies: 0.008779
590500 -- [-334.542] (-335.782) (-334.735) (-336.459) * (-334.398) (-337.296) [-335.111] (-334.380) -- 0:00:24
591000 -- [-335.761] (-338.199) (-336.281) (-336.903) * (-340.453) (-336.178) (-336.197) [-335.360] -- 0:00:24
591500 -- [-339.732] (-337.520) (-334.542) (-334.285) * (-336.441) (-338.923) (-335.439) [-336.138] -- 0:00:24
592000 -- (-336.430) (-336.303) [-334.713] (-335.041) * [-335.071] (-339.126) (-340.526) (-334.097) -- 0:00:24
592500 -- (-335.397) (-336.828) [-335.169] (-334.979) * (-337.930) [-335.245] (-335.260) (-335.408) -- 0:00:24
593000 -- [-335.978] (-334.595) (-337.737) (-335.865) * (-335.226) (-334.117) [-337.317] (-336.786) -- 0:00:24
593500 -- (-337.662) [-338.465] (-338.778) (-334.917) * (-334.648) [-336.388] (-336.277) (-336.218) -- 0:00:23
594000 -- (-336.716) (-336.392) (-334.130) [-335.033] * (-339.928) (-335.717) [-334.926] (-337.427) -- 0:00:23
594500 -- (-334.825) (-336.606) [-335.434] (-335.365) * (-333.920) (-335.736) [-337.404] (-335.888) -- 0:00:23
595000 -- (-334.002) (-334.418) (-337.732) [-335.097] * (-339.010) (-335.856) [-334.874] (-335.327) -- 0:00:23
Average standard deviation of split frequencies: 0.008793
595500 -- (-334.824) (-334.743) [-335.507] (-335.569) * (-334.181) (-336.554) [-337.017] (-337.827) -- 0:00:23
596000 -- (-334.021) (-335.099) [-334.690] (-336.612) * (-335.657) (-336.426) [-335.744] (-339.184) -- 0:00:23
596500 -- (-334.250) (-336.510) (-336.217) [-335.347] * [-334.630] (-336.229) (-334.422) (-340.091) -- 0:00:23
597000 -- [-334.942] (-341.953) (-337.836) (-337.185) * (-334.894) [-334.989] (-333.934) (-341.426) -- 0:00:23
597500 -- [-337.274] (-335.629) (-338.092) (-335.183) * (-337.286) [-337.288] (-336.543) (-336.013) -- 0:00:23
598000 -- [-338.836] (-335.377) (-338.277) (-334.967) * [-334.324] (-338.147) (-336.349) (-336.116) -- 0:00:23
598500 -- (-335.296) (-336.528) [-335.790] (-336.462) * (-335.790) (-336.586) [-338.268] (-337.042) -- 0:00:24
599000 -- (-337.977) [-338.569] (-335.874) (-334.412) * (-336.295) (-341.528) (-336.105) [-336.643] -- 0:00:24
599500 -- (-334.423) (-334.007) (-336.851) [-335.142] * (-339.136) (-336.138) [-336.832] (-334.727) -- 0:00:24
600000 -- [-337.299] (-340.292) (-338.027) (-336.089) * (-338.198) [-336.399] (-337.823) (-334.345) -- 0:00:24
Average standard deviation of split frequencies: 0.008927
600500 -- (-335.397) (-336.578) (-338.240) [-335.838] * (-337.780) [-333.975] (-336.048) (-335.603) -- 0:00:23
601000 -- (-334.454) (-336.421) [-337.017] (-338.487) * (-336.580) [-334.087] (-335.630) (-334.678) -- 0:00:23
601500 -- (-338.384) [-337.595] (-342.980) (-336.162) * (-334.123) (-336.031) (-337.784) [-336.000] -- 0:00:23
602000 -- [-335.766] (-339.186) (-337.636) (-337.077) * (-341.725) (-340.965) [-335.629] (-335.584) -- 0:00:23
602500 -- [-336.505] (-342.081) (-334.896) (-338.699) * (-336.129) (-341.288) (-334.914) [-336.729] -- 0:00:23
603000 -- (-337.131) [-337.937] (-337.834) (-337.240) * [-337.882] (-335.369) (-338.463) (-336.899) -- 0:00:23
603500 -- (-338.098) [-335.318] (-335.354) (-336.364) * (-337.418) (-341.296) (-336.535) [-337.957] -- 0:00:23
604000 -- (-340.848) (-335.613) [-335.428] (-334.840) * (-341.785) [-335.307] (-335.456) (-338.198) -- 0:00:23
604500 -- [-338.855] (-336.004) (-336.674) (-335.752) * (-337.072) [-334.525] (-335.950) (-337.209) -- 0:00:23
605000 -- (-339.046) [-336.808] (-336.497) (-337.667) * [-336.235] (-336.799) (-338.347) (-336.707) -- 0:00:23
Average standard deviation of split frequencies: 0.008022
605500 -- (-335.853) (-336.965) [-334.683] (-341.349) * (-337.087) [-335.084] (-336.703) (-335.827) -- 0:00:23
606000 -- (-341.430) [-335.743] (-335.716) (-336.922) * (-336.995) (-339.347) (-334.921) [-334.337] -- 0:00:23
606500 -- (-337.973) [-334.932] (-339.130) (-337.855) * (-335.533) (-335.440) [-334.660] (-336.430) -- 0:00:23
607000 -- (-337.686) (-336.251) (-336.461) [-335.959] * [-335.284] (-340.252) (-336.853) (-335.480) -- 0:00:23
607500 -- (-336.544) (-337.002) [-334.832] (-335.746) * (-336.494) (-335.065) (-335.224) [-335.781] -- 0:00:23
608000 -- (-335.064) (-336.430) (-339.085) [-337.728] * (-336.075) (-337.013) [-335.222] (-336.010) -- 0:00:23
608500 -- (-337.445) (-337.021) [-336.644] (-336.947) * [-335.373] (-337.474) (-335.989) (-335.838) -- 0:00:23
609000 -- [-336.284] (-335.788) (-335.652) (-336.767) * [-335.361] (-335.986) (-335.785) (-336.025) -- 0:00:23
609500 -- (-336.414) [-338.986] (-336.406) (-335.531) * [-336.019] (-336.404) (-334.773) (-335.707) -- 0:00:23
610000 -- (-335.676) (-334.733) (-335.467) [-334.902] * (-336.476) (-336.734) (-337.850) [-337.208] -- 0:00:23
Average standard deviation of split frequencies: 0.008037
610500 -- (-336.354) (-335.803) (-335.063) [-335.358] * [-336.134] (-334.573) (-336.800) (-338.416) -- 0:00:22
611000 -- (-335.834) (-335.013) [-335.302] (-341.170) * (-335.208) [-335.357] (-339.111) (-336.862) -- 0:00:22
611500 -- (-338.516) (-335.388) [-336.021] (-335.961) * (-336.746) (-337.822) [-337.172] (-336.997) -- 0:00:22
612000 -- [-335.916] (-334.672) (-341.964) (-337.859) * [-334.378] (-339.572) (-335.031) (-337.147) -- 0:00:22
612500 -- [-333.818] (-336.350) (-334.073) (-334.723) * (-333.816) (-334.854) (-335.062) [-336.702] -- 0:00:22
613000 -- (-336.862) (-337.307) (-334.808) [-335.091] * (-338.851) (-334.941) [-334.434] (-335.292) -- 0:00:22
613500 -- [-335.975] (-334.509) (-337.042) (-335.085) * (-337.272) (-335.056) (-334.907) [-340.782] -- 0:00:22
614000 -- (-335.625) (-335.689) (-338.866) [-334.882] * [-340.373] (-334.268) (-336.178) (-338.291) -- 0:00:22
614500 -- (-334.748) (-336.441) [-334.749] (-339.404) * (-336.723) [-337.883] (-335.439) (-339.196) -- 0:00:22
615000 -- (-336.297) (-336.013) [-334.155] (-336.756) * (-335.262) (-337.462) [-334.546] (-340.814) -- 0:00:22
Average standard deviation of split frequencies: 0.008058
615500 -- (-335.748) [-334.913] (-338.368) (-334.671) * (-338.285) (-338.727) [-335.084] (-339.994) -- 0:00:22
616000 -- (-336.154) (-334.777) (-334.282) [-335.366] * [-334.854] (-339.428) (-336.221) (-335.771) -- 0:00:23
616500 -- (-336.240) [-335.535] (-335.817) (-335.567) * (-334.677) (-337.942) [-335.117] (-334.615) -- 0:00:23
617000 -- (-334.915) [-339.386] (-336.732) (-339.002) * (-335.266) (-336.779) [-334.746] (-334.935) -- 0:00:22
617500 -- (-337.250) (-336.490) (-339.183) [-335.156] * (-337.092) (-334.959) (-335.099) [-336.179] -- 0:00:22
618000 -- [-334.994] (-336.836) (-341.939) (-342.441) * [-335.020] (-338.755) (-339.742) (-335.872) -- 0:00:22
618500 -- (-337.490) [-335.996] (-340.265) (-336.375) * (-334.881) (-340.859) [-337.353] (-336.208) -- 0:00:22
619000 -- [-337.968] (-339.032) (-338.937) (-336.934) * (-335.250) (-335.985) [-337.871] (-337.038) -- 0:00:22
619500 -- (-338.348) [-338.164] (-337.467) (-337.345) * (-334.908) [-339.069] (-338.828) (-336.644) -- 0:00:22
620000 -- (-334.376) (-336.945) (-340.317) [-335.803] * (-335.251) (-335.568) (-334.918) [-334.679] -- 0:00:22
Average standard deviation of split frequencies: 0.008623
620500 -- [-339.512] (-336.821) (-337.645) (-336.554) * (-336.682) (-336.314) (-337.069) [-336.779] -- 0:00:22
621000 -- (-336.227) (-337.380) [-335.200] (-338.662) * (-336.527) (-334.556) [-336.066] (-335.004) -- 0:00:22
621500 -- [-338.249] (-336.040) (-337.181) (-338.335) * [-336.134] (-337.198) (-337.707) (-334.382) -- 0:00:22
622000 -- (-337.991) (-336.872) [-335.704] (-339.979) * (-342.686) (-340.759) [-337.551] (-337.305) -- 0:00:22
622500 -- (-335.470) (-336.839) (-337.484) [-336.561] * (-341.241) [-338.195] (-335.673) (-336.790) -- 0:00:22
623000 -- (-336.665) (-336.007) (-336.687) [-335.721] * (-340.500) (-338.682) (-335.201) [-336.731] -- 0:00:22
623500 -- (-338.934) (-335.671) [-334.802] (-336.699) * (-337.398) [-338.847] (-335.815) (-336.426) -- 0:00:22
624000 -- (-337.902) (-336.089) [-335.360] (-335.011) * [-335.923] (-334.889) (-336.189) (-335.715) -- 0:00:22
624500 -- (-335.351) (-337.259) [-338.263] (-336.174) * (-335.297) (-334.878) (-335.759) [-336.929] -- 0:00:22
625000 -- [-334.046] (-333.886) (-336.774) (-336.049) * (-339.534) (-336.478) (-335.190) [-339.833] -- 0:00:22
Average standard deviation of split frequencies: 0.008195
625500 -- [-337.615] (-336.139) (-335.215) (-336.161) * (-337.920) [-336.258] (-336.701) (-337.595) -- 0:00:22
626000 -- (-334.665) (-341.448) (-336.440) [-335.143] * (-338.266) (-336.243) (-339.258) [-334.796] -- 0:00:22
626500 -- (-336.121) [-336.837] (-334.886) (-336.862) * (-337.357) (-338.634) [-335.128] (-335.309) -- 0:00:22
627000 -- (-336.973) (-337.205) (-336.013) [-334.466] * [-335.521] (-335.581) (-335.208) (-337.419) -- 0:00:22
627500 -- (-337.186) (-335.123) (-338.264) [-336.491] * (-336.056) [-337.580] (-334.776) (-334.146) -- 0:00:21
628000 -- [-336.034] (-335.601) (-337.217) (-337.051) * (-336.970) (-339.146) (-335.234) [-334.467] -- 0:00:21
628500 -- (-337.435) (-335.113) [-334.409] (-335.463) * (-337.122) (-334.967) (-336.287) [-336.195] -- 0:00:21
629000 -- (-335.045) (-336.760) (-338.403) [-334.228] * (-335.868) (-334.658) (-336.059) [-334.465] -- 0:00:21
629500 -- [-335.712] (-336.121) (-344.317) (-337.560) * (-340.057) (-338.628) (-335.548) [-335.522] -- 0:00:21
630000 -- (-340.573) [-335.795] (-336.952) (-336.308) * (-336.670) (-337.866) [-337.086] (-334.911) -- 0:00:21
Average standard deviation of split frequencies: 0.008549
630500 -- (-338.423) (-337.885) [-335.471] (-336.522) * (-340.467) (-334.606) [-336.233] (-338.492) -- 0:00:21
631000 -- (-336.693) [-336.940] (-337.431) (-335.506) * (-335.211) (-335.801) (-336.749) [-336.911] -- 0:00:21
631500 -- (-335.972) (-337.350) (-336.238) [-336.585] * [-338.098] (-337.227) (-336.001) (-340.997) -- 0:00:21
632000 -- (-337.238) (-334.712) [-336.634] (-337.194) * (-335.669) (-334.744) (-335.248) [-336.456] -- 0:00:21
632500 -- (-334.569) [-334.772] (-338.638) (-335.288) * [-334.051] (-336.308) (-341.114) (-337.418) -- 0:00:21
633000 -- (-337.017) [-335.337] (-334.603) (-337.123) * (-336.613) (-335.808) [-336.603] (-335.928) -- 0:00:22
633500 -- (-335.466) [-336.218] (-340.418) (-339.784) * [-337.412] (-334.966) (-338.563) (-336.627) -- 0:00:21
634000 -- (-333.956) (-337.063) (-334.170) [-335.053] * (-334.251) [-335.158] (-339.952) (-337.435) -- 0:00:21
634500 -- (-336.372) (-337.509) [-334.527] (-336.512) * (-333.997) [-335.134] (-336.018) (-335.782) -- 0:00:21
635000 -- (-337.842) (-336.570) [-334.639] (-334.816) * (-337.420) (-337.591) (-335.166) [-336.962] -- 0:00:21
Average standard deviation of split frequencies: 0.008616
635500 -- (-336.094) (-336.155) (-334.942) [-335.747] * (-335.614) (-335.261) [-334.792] (-338.849) -- 0:00:21
636000 -- (-336.094) [-334.891] (-336.570) (-335.826) * (-336.637) (-338.532) [-335.986] (-335.642) -- 0:00:21
636500 -- [-335.193] (-334.666) (-337.785) (-335.739) * (-335.296) (-339.300) (-338.373) [-336.954] -- 0:00:21
637000 -- (-336.639) (-336.229) (-338.477) [-336.305] * (-337.257) [-339.280] (-335.743) (-344.241) -- 0:00:21
637500 -- (-334.583) [-338.007] (-336.824) (-337.457) * (-334.211) (-334.932) [-335.443] (-339.129) -- 0:00:21
638000 -- (-335.043) (-337.054) (-335.641) [-337.977] * (-337.098) [-334.900] (-336.095) (-343.021) -- 0:00:21
638500 -- (-338.476) (-339.702) [-334.857] (-336.363) * [-338.484] (-335.847) (-335.768) (-340.043) -- 0:00:21
639000 -- (-339.087) (-337.277) (-335.676) [-336.471] * [-336.328] (-335.927) (-340.870) (-336.141) -- 0:00:21
639500 -- (-338.667) [-338.213] (-335.827) (-336.421) * (-334.963) (-335.966) (-334.397) [-334.180] -- 0:00:21
640000 -- [-338.163] (-337.219) (-337.727) (-340.001) * (-335.795) [-336.037] (-336.394) (-336.462) -- 0:00:21
Average standard deviation of split frequencies: 0.008554
640500 -- (-336.592) (-336.949) [-335.689] (-340.084) * (-339.685) (-335.236) [-334.827] (-339.788) -- 0:00:21
641000 -- (-339.026) (-337.288) [-338.620] (-336.902) * (-336.818) [-334.632] (-339.464) (-335.019) -- 0:00:21
641500 -- (-335.213) (-339.182) [-335.143] (-334.956) * (-341.582) (-334.341) [-335.839] (-337.487) -- 0:00:21
642000 -- (-333.968) (-336.704) (-336.717) [-336.689] * [-341.295] (-335.395) (-336.132) (-335.018) -- 0:00:21
642500 -- [-334.910] (-334.619) (-337.885) (-334.006) * (-335.990) (-337.116) [-335.694] (-340.823) -- 0:00:21
643000 -- [-336.022] (-335.200) (-335.729) (-336.960) * [-336.126] (-338.389) (-337.241) (-334.849) -- 0:00:21
643500 -- (-337.379) [-334.018] (-335.170) (-342.122) * (-335.055) (-334.185) (-335.233) [-337.720] -- 0:00:21
644000 -- [-335.357] (-336.927) (-336.388) (-334.725) * (-336.120) [-333.999] (-335.911) (-335.081) -- 0:00:21
644500 -- [-335.090] (-336.665) (-335.640) (-341.200) * (-342.611) (-336.259) [-334.670] (-336.391) -- 0:00:20
645000 -- [-335.872] (-337.735) (-338.031) (-335.815) * (-334.525) (-342.194) (-336.551) [-337.630] -- 0:00:20
Average standard deviation of split frequencies: 0.008209
645500 -- (-337.370) (-334.794) [-334.597] (-334.796) * (-336.271) [-335.702] (-338.870) (-338.484) -- 0:00:20
646000 -- (-337.422) (-335.314) [-337.667] (-335.826) * (-335.419) [-336.055] (-337.323) (-336.722) -- 0:00:20
646500 -- (-338.235) [-336.275] (-335.140) (-337.415) * (-338.124) (-335.633) (-336.135) [-338.151] -- 0:00:20
647000 -- [-339.460] (-334.817) (-336.559) (-335.915) * (-335.942) [-338.664] (-334.880) (-336.429) -- 0:00:20
647500 -- (-337.269) (-337.100) (-337.950) [-335.433] * (-335.379) (-337.026) [-334.784] (-341.491) -- 0:00:20
648000 -- (-337.205) (-336.096) [-335.677] (-336.613) * (-335.590) (-334.419) (-335.669) [-336.418] -- 0:00:20
648500 -- [-336.616] (-335.581) (-335.012) (-336.706) * [-335.897] (-338.815) (-339.455) (-335.860) -- 0:00:20
649000 -- (-335.745) (-337.113) [-334.590] (-342.366) * (-335.455) (-338.677) (-340.671) [-336.426] -- 0:00:20
649500 -- (-337.280) (-335.263) (-338.167) [-337.418] * [-338.000] (-334.083) (-336.193) (-334.299) -- 0:00:20
650000 -- (-336.559) (-335.760) [-335.521] (-335.016) * [-334.667] (-335.978) (-344.936) (-334.610) -- 0:00:20
Average standard deviation of split frequencies: 0.008241
650500 -- [-335.705] (-334.179) (-334.711) (-337.571) * (-334.454) [-335.158] (-334.891) (-334.756) -- 0:00:20
651000 -- (-338.915) [-335.749] (-339.195) (-338.952) * (-334.928) (-334.898) (-340.081) [-339.771] -- 0:00:20
651500 -- (-339.220) (-338.272) [-334.873] (-335.855) * (-335.240) (-336.429) [-339.072] (-337.514) -- 0:00:20
652000 -- [-336.754] (-335.881) (-335.466) (-335.835) * [-333.929] (-337.385) (-336.845) (-337.318) -- 0:00:20
652500 -- (-338.430) (-334.637) (-335.619) [-337.017] * [-335.759] (-334.302) (-336.743) (-335.450) -- 0:00:20
653000 -- [-335.450] (-334.004) (-336.560) (-335.501) * (-334.652) [-334.977] (-335.335) (-336.677) -- 0:00:20
653500 -- (-336.123) [-337.718] (-339.586) (-335.808) * (-334.202) [-335.726] (-338.840) (-334.200) -- 0:00:20
654000 -- (-336.540) (-335.504) (-339.795) [-335.033] * (-335.667) [-336.237] (-338.854) (-335.224) -- 0:00:20
654500 -- (-335.447) [-334.311] (-335.162) (-336.836) * (-335.340) [-334.390] (-335.045) (-335.849) -- 0:00:20
655000 -- (-335.253) (-337.289) (-334.191) [-336.790] * [-335.149] (-334.651) (-337.077) (-337.818) -- 0:00:20
Average standard deviation of split frequencies: 0.008578
655500 -- (-338.607) (-337.238) [-335.457] (-338.723) * (-335.731) [-334.308] (-343.613) (-340.283) -- 0:00:20
656000 -- (-335.199) (-336.147) [-335.455] (-337.073) * (-336.101) (-337.460) (-337.676) [-335.497] -- 0:00:20
656500 -- (-337.972) (-336.921) [-337.614] (-336.609) * (-336.630) (-336.143) (-337.263) [-338.674] -- 0:00:20
657000 -- (-336.707) (-335.032) (-335.801) [-336.595] * (-337.034) (-338.518) (-336.216) [-335.891] -- 0:00:20
657500 -- [-336.379] (-336.272) (-335.464) (-338.072) * (-342.515) [-335.497] (-336.451) (-335.667) -- 0:00:20
658000 -- (-341.242) [-334.853] (-337.150) (-336.155) * (-339.094) (-337.063) [-337.998] (-337.636) -- 0:00:20
658500 -- (-340.794) (-338.431) [-339.044] (-335.811) * (-336.703) (-336.227) (-335.811) [-335.335] -- 0:00:20
659000 -- (-335.752) (-342.517) [-334.936] (-335.199) * (-343.685) (-335.552) [-339.366] (-335.741) -- 0:00:20
659500 -- [-336.031] (-336.588) (-335.938) (-337.359) * (-335.631) (-335.138) (-336.610) [-335.625] -- 0:00:20
660000 -- [-339.491] (-338.109) (-337.214) (-341.054) * (-337.554) (-335.261) (-337.438) [-337.212] -- 0:00:20
Average standard deviation of split frequencies: 0.008161
660500 -- (-335.264) (-337.656) (-335.014) [-335.317] * [-335.357] (-338.180) (-334.658) (-339.246) -- 0:00:20
661000 -- (-336.372) (-340.806) (-335.541) [-340.639] * (-333.922) (-338.430) (-334.600) [-338.788] -- 0:00:20
661500 -- [-334.889] (-336.117) (-334.366) (-339.508) * (-337.818) [-337.159] (-334.910) (-335.808) -- 0:00:19
662000 -- (-337.288) [-336.722] (-335.092) (-342.376) * (-336.473) (-335.983) (-337.188) [-335.278] -- 0:00:19
662500 -- (-336.466) [-339.921] (-335.896) (-338.508) * (-334.997) (-336.801) [-336.688] (-337.712) -- 0:00:19
663000 -- (-335.881) (-338.974) [-336.867] (-336.245) * [-334.699] (-336.549) (-340.803) (-335.593) -- 0:00:19
663500 -- (-335.688) [-335.960] (-337.673) (-339.760) * [-335.133] (-337.097) (-335.746) (-338.119) -- 0:00:19
664000 -- (-335.089) [-334.638] (-339.169) (-337.617) * (-335.499) [-336.648] (-335.846) (-337.549) -- 0:00:19
664500 -- [-335.344] (-334.586) (-340.323) (-335.692) * [-334.595] (-335.997) (-334.831) (-334.877) -- 0:00:19
665000 -- [-337.619] (-334.714) (-337.766) (-335.267) * (-336.574) (-336.659) [-335.474] (-336.363) -- 0:00:19
Average standard deviation of split frequencies: 0.007744
665500 -- [-334.450] (-335.042) (-341.171) (-335.075) * (-335.488) [-337.041] (-338.717) (-335.513) -- 0:00:19
666000 -- [-335.948] (-337.615) (-335.267) (-334.716) * (-340.460) (-338.845) [-336.694] (-336.249) -- 0:00:19
666500 -- [-334.437] (-335.493) (-335.195) (-335.254) * (-335.122) (-334.785) [-338.056] (-335.553) -- 0:00:19
667000 -- (-334.488) (-336.096) [-338.118] (-334.120) * (-335.203) (-334.756) (-335.884) [-335.384] -- 0:00:19
667500 -- [-334.254] (-336.469) (-335.901) (-334.803) * [-335.754] (-334.703) (-337.430) (-335.454) -- 0:00:19
668000 -- (-334.773) (-339.249) (-335.667) [-336.082] * (-341.107) [-334.054] (-334.879) (-336.402) -- 0:00:19
668500 -- (-336.027) (-337.301) [-334.836] (-337.016) * (-344.586) (-335.259) (-336.373) [-336.164] -- 0:00:19
669000 -- (-341.207) [-334.760] (-336.210) (-336.312) * (-342.773) (-336.074) [-335.336] (-337.408) -- 0:00:19
669500 -- [-334.194] (-334.631) (-338.980) (-335.388) * (-337.097) [-335.020] (-342.778) (-336.371) -- 0:00:19
670000 -- (-338.830) (-335.265) (-336.094) [-335.740] * (-337.755) [-334.941] (-335.725) (-335.716) -- 0:00:19
Average standard deviation of split frequencies: 0.008127
670500 -- [-336.792] (-335.750) (-335.757) (-336.814) * [-335.998] (-336.295) (-333.992) (-336.825) -- 0:00:19
671000 -- (-335.766) [-334.865] (-334.548) (-335.798) * (-336.544) (-338.375) [-338.563] (-337.788) -- 0:00:19
671500 -- (-335.980) [-334.949] (-338.822) (-338.998) * (-342.573) (-335.050) (-334.707) [-334.795] -- 0:00:19
672000 -- [-334.636] (-339.632) (-344.591) (-341.196) * [-342.204] (-335.609) (-337.124) (-336.855) -- 0:00:19
672500 -- (-335.182) (-335.005) [-335.501] (-341.243) * [-335.452] (-334.852) (-340.492) (-335.824) -- 0:00:19
673000 -- (-336.052) (-334.562) (-336.925) [-337.161] * (-341.040) (-338.390) [-336.546] (-335.807) -- 0:00:19
673500 -- (-334.166) (-338.558) (-335.952) [-336.946] * (-334.577) (-335.675) [-334.767] (-334.174) -- 0:00:19
674000 -- (-335.578) (-335.224) (-337.804) [-339.028] * (-334.405) (-335.548) (-335.129) [-335.365] -- 0:00:19
674500 -- (-336.838) (-335.220) [-337.844] (-337.072) * [-334.798] (-337.518) (-336.502) (-334.633) -- 0:00:19
675000 -- [-334.905] (-336.142) (-334.141) (-335.426) * (-334.799) [-335.881] (-336.696) (-334.445) -- 0:00:19
Average standard deviation of split frequencies: 0.008063
675500 -- (-335.658) (-337.968) [-335.675] (-339.151) * (-334.889) [-337.577] (-335.122) (-335.711) -- 0:00:19
676000 -- [-334.190] (-334.567) (-336.305) (-337.207) * (-340.789) (-337.347) [-334.306] (-342.349) -- 0:00:19
676500 -- (-336.366) (-336.557) (-335.344) [-336.541] * (-337.005) (-336.531) [-337.658] (-340.198) -- 0:00:19
677000 -- (-334.905) (-334.498) [-337.328] (-338.277) * (-340.232) (-341.067) (-337.147) [-335.077] -- 0:00:19
677500 -- [-334.531] (-336.074) (-334.873) (-336.448) * (-336.541) (-339.980) (-336.074) [-335.512] -- 0:00:19
678000 -- [-335.217] (-338.759) (-336.618) (-336.823) * (-336.824) (-337.192) (-337.317) [-334.090] -- 0:00:18
678500 -- (-334.577) (-335.623) [-335.097] (-338.558) * (-334.579) (-335.194) (-336.328) [-335.946] -- 0:00:18
679000 -- (-337.063) (-337.202) (-338.407) [-339.763] * [-337.228] (-336.818) (-336.092) (-337.555) -- 0:00:18
679500 -- (-336.915) (-337.094) (-337.724) [-341.458] * [-336.847] (-333.975) (-334.900) (-335.233) -- 0:00:18
680000 -- (-335.395) [-336.937] (-336.933) (-336.291) * (-334.948) (-334.806) [-334.757] (-336.560) -- 0:00:18
Average standard deviation of split frequencies: 0.007822
680500 -- [-335.838] (-335.942) (-338.223) (-335.592) * [-337.167] (-334.319) (-334.548) (-335.837) -- 0:00:18
681000 -- (-338.450) (-334.946) (-334.617) [-337.667] * (-336.846) (-335.500) (-336.436) [-336.741] -- 0:00:18
681500 -- [-338.601] (-334.202) (-335.628) (-336.822) * (-335.444) (-335.773) (-335.295) [-335.161] -- 0:00:18
682000 -- (-336.748) (-334.626) (-335.323) [-335.340] * (-339.251) (-335.603) [-335.007] (-334.440) -- 0:00:18
682500 -- (-335.067) (-334.411) [-335.904] (-340.682) * (-335.734) (-337.388) [-336.987] (-339.340) -- 0:00:18
683000 -- [-335.419] (-334.413) (-340.291) (-339.926) * (-333.859) (-336.103) [-336.278] (-336.973) -- 0:00:18
683500 -- (-334.571) (-335.271) [-338.406] (-334.635) * (-337.779) (-335.334) [-337.236] (-336.858) -- 0:00:18
684000 -- (-334.336) (-335.182) (-337.125) [-334.355] * [-335.269] (-336.214) (-335.307) (-336.060) -- 0:00:18
684500 -- [-335.296] (-343.611) (-336.192) (-334.660) * (-339.311) (-335.967) [-335.845] (-334.834) -- 0:00:18
685000 -- (-338.035) (-337.060) (-336.406) [-334.406] * [-334.617] (-336.585) (-338.294) (-335.177) -- 0:00:18
Average standard deviation of split frequencies: 0.007761
685500 -- (-336.884) (-339.293) [-337.430] (-336.582) * (-334.804) [-337.483] (-336.770) (-336.358) -- 0:00:18
686000 -- [-334.899] (-336.847) (-334.393) (-336.434) * (-335.176) (-334.876) [-337.622] (-336.339) -- 0:00:18
686500 -- (-334.855) (-337.452) [-334.092] (-339.583) * (-335.187) (-342.352) (-337.262) [-335.371] -- 0:00:18
687000 -- [-335.150] (-337.801) (-335.429) (-335.768) * (-335.921) [-335.623] (-336.006) (-338.942) -- 0:00:18
687500 -- (-334.834) [-336.417] (-337.216) (-339.276) * (-337.725) [-335.487] (-335.618) (-338.757) -- 0:00:18
688000 -- (-334.602) [-337.470] (-337.037) (-336.217) * [-339.333] (-334.548) (-336.380) (-338.885) -- 0:00:18
688500 -- [-341.693] (-336.384) (-336.032) (-340.934) * (-335.686) [-334.412] (-339.014) (-339.818) -- 0:00:18
689000 -- [-334.637] (-336.269) (-336.647) (-338.701) * (-335.483) [-338.318] (-334.346) (-336.858) -- 0:00:18
689500 -- (-336.314) (-335.410) [-335.610] (-337.108) * (-335.902) (-336.755) (-335.581) [-334.174] -- 0:00:18
690000 -- [-338.110] (-336.637) (-337.234) (-334.327) * (-336.793) [-334.496] (-340.767) (-334.581) -- 0:00:18
Average standard deviation of split frequencies: 0.007764
690500 -- (-336.475) (-340.332) (-340.919) [-334.176] * (-335.579) (-335.703) (-337.096) [-336.236] -- 0:00:18
691000 -- [-336.177] (-335.238) (-335.847) (-337.565) * (-335.336) (-336.020) [-335.330] (-335.054) -- 0:00:18
691500 -- (-336.997) (-340.252) [-337.396] (-334.855) * (-335.198) (-340.500) [-334.711] (-337.008) -- 0:00:18
692000 -- (-334.985) [-335.894] (-336.002) (-335.319) * (-335.574) [-334.825] (-335.946) (-337.644) -- 0:00:18
692500 -- (-336.776) [-340.397] (-337.191) (-337.788) * (-337.048) [-335.289] (-335.899) (-337.500) -- 0:00:18
693000 -- (-339.942) (-334.452) (-335.737) [-334.941] * (-342.797) [-335.819] (-337.594) (-336.131) -- 0:00:18
693500 -- (-336.204) (-335.437) (-336.549) [-334.597] * [-337.174] (-337.434) (-336.033) (-339.412) -- 0:00:18
694000 -- (-334.611) [-336.535] (-335.350) (-334.728) * (-341.028) (-341.016) (-336.717) [-336.356] -- 0:00:18
694500 -- (-335.886) (-336.318) (-335.922) [-334.985] * (-336.098) [-339.154] (-336.051) (-334.655) -- 0:00:18
695000 -- (-342.296) (-336.543) [-335.929] (-334.806) * [-335.809] (-338.549) (-338.024) (-335.766) -- 0:00:17
Average standard deviation of split frequencies: 0.008297
695500 -- (-335.605) (-335.401) [-337.034] (-337.300) * [-335.909] (-337.795) (-335.859) (-335.200) -- 0:00:17
696000 -- [-334.055] (-337.389) (-337.365) (-337.785) * (-334.558) (-338.090) (-336.002) [-337.894] -- 0:00:17
696500 -- (-334.198) [-336.895] (-335.909) (-337.381) * (-338.953) (-334.483) [-334.460] (-334.816) -- 0:00:17
697000 -- (-337.289) (-335.345) (-337.791) [-334.139] * (-341.012) (-335.980) [-339.107] (-335.561) -- 0:00:17
697500 -- [-336.837] (-337.052) (-340.218) (-334.780) * [-336.989] (-337.253) (-341.893) (-337.345) -- 0:00:17
698000 -- (-336.469) [-335.276] (-338.729) (-336.894) * (-340.249) [-337.022] (-335.005) (-339.353) -- 0:00:17
698500 -- (-337.009) (-337.960) [-336.461] (-336.557) * (-339.983) [-335.021] (-335.989) (-337.949) -- 0:00:17
699000 -- (-336.601) [-337.394] (-336.043) (-341.860) * (-335.379) (-334.074) (-334.811) [-337.012] -- 0:00:17
699500 -- (-336.361) [-336.530] (-338.259) (-347.777) * (-336.789) [-334.923] (-335.675) (-335.205) -- 0:00:17
700000 -- (-335.666) [-334.929] (-339.728) (-334.255) * [-338.556] (-334.185) (-342.302) (-335.867) -- 0:00:17
Average standard deviation of split frequencies: 0.007947
700500 -- [-335.949] (-338.391) (-337.669) (-335.644) * (-337.592) (-342.256) [-334.143] (-336.320) -- 0:00:17
701000 -- (-336.839) (-334.464) (-336.486) [-336.839] * (-337.913) (-337.958) (-337.234) [-334.467] -- 0:00:17
701500 -- (-334.598) (-335.559) (-334.065) [-334.388] * (-337.279) [-334.582] (-341.339) (-335.305) -- 0:00:17
702000 -- (-338.956) [-335.239] (-340.387) (-335.307) * (-335.556) [-334.640] (-339.489) (-336.323) -- 0:00:17
702500 -- (-335.021) [-335.371] (-337.934) (-339.777) * (-338.377) (-337.114) (-343.853) [-336.293] -- 0:00:17
703000 -- (-342.244) (-335.483) [-336.547] (-337.564) * (-335.725) [-335.991] (-343.141) (-335.589) -- 0:00:17
703500 -- (-335.159) (-338.116) (-339.266) [-341.124] * (-337.104) (-338.434) (-335.890) [-334.753] -- 0:00:17
704000 -- (-339.174) (-338.608) (-335.508) [-335.697] * (-335.494) (-340.116) [-337.044] (-334.706) -- 0:00:17
704500 -- [-336.000] (-340.712) (-337.385) (-335.671) * [-334.956] (-336.157) (-339.420) (-335.597) -- 0:00:17
705000 -- (-335.001) (-336.940) (-339.847) [-334.319] * (-335.388) [-336.463] (-337.586) (-335.228) -- 0:00:17
Average standard deviation of split frequencies: 0.008096
705500 -- (-335.021) [-334.349] (-340.050) (-335.215) * (-335.442) (-336.146) (-338.488) [-335.532] -- 0:00:17
706000 -- (-337.508) [-335.967] (-335.553) (-342.785) * (-336.046) (-337.570) (-335.347) [-335.348] -- 0:00:17
706500 -- [-336.047] (-335.060) (-335.839) (-336.263) * (-334.332) [-337.834] (-335.359) (-336.917) -- 0:00:17
707000 -- (-336.095) (-339.687) (-334.626) [-337.000] * (-336.731) (-334.280) (-335.212) [-334.745] -- 0:00:17
707500 -- (-336.272) (-338.694) (-334.125) [-335.301] * [-335.169] (-335.149) (-337.819) (-334.641) -- 0:00:17
708000 -- (-336.400) (-336.050) (-335.830) [-336.058] * (-336.254) (-337.556) (-338.448) [-334.058] -- 0:00:17
708500 -- (-336.013) (-335.342) (-334.961) [-334.398] * (-337.973) (-336.279) [-336.775] (-334.612) -- 0:00:17
709000 -- (-335.617) (-337.331) (-341.344) [-335.544] * (-337.932) (-336.751) (-335.506) [-335.080] -- 0:00:17
709500 -- [-335.754] (-336.593) (-336.774) (-335.020) * (-335.671) [-336.979] (-337.575) (-334.702) -- 0:00:17
710000 -- [-335.565] (-338.007) (-335.958) (-336.219) * (-337.252) (-336.413) [-335.713] (-334.553) -- 0:00:17
Average standard deviation of split frequencies: 0.007918
710500 -- (-335.852) (-342.623) [-335.661] (-336.080) * [-337.141] (-337.149) (-336.843) (-335.581) -- 0:00:17
711000 -- (-334.027) (-339.817) (-336.127) [-335.544] * (-336.985) (-336.051) (-342.251) [-336.213] -- 0:00:17
711500 -- (-335.734) [-335.019] (-335.401) (-336.063) * (-336.186) (-337.618) [-336.187] (-335.803) -- 0:00:17
712000 -- (-337.421) (-338.965) (-334.990) [-336.285] * [-334.781] (-339.223) (-336.264) (-337.607) -- 0:00:16
712500 -- (-334.633) [-335.530] (-335.193) (-334.426) * [-338.979] (-335.626) (-334.476) (-337.107) -- 0:00:16
713000 -- (-333.899) (-338.478) (-335.448) [-334.189] * (-334.436) [-337.359] (-335.634) (-338.969) -- 0:00:16
713500 -- (-337.253) (-335.531) (-338.317) [-336.564] * [-335.647] (-335.673) (-336.398) (-340.449) -- 0:00:16
714000 -- (-339.030) (-335.755) [-334.874] (-338.933) * [-334.542] (-335.385) (-339.315) (-338.857) -- 0:00:16
714500 -- (-336.379) [-337.054] (-335.545) (-336.557) * (-334.801) (-335.013) [-335.187] (-338.293) -- 0:00:16
715000 -- (-335.479) [-335.400] (-337.653) (-341.573) * (-334.588) (-338.498) (-334.925) [-335.858] -- 0:00:16
Average standard deviation of split frequencies: 0.008148
715500 -- [-336.552] (-337.040) (-335.499) (-342.754) * [-334.423] (-335.556) (-336.141) (-334.374) -- 0:00:16
716000 -- (-335.777) (-337.516) (-337.254) [-338.242] * (-337.223) [-338.191] (-335.252) (-335.228) -- 0:00:16
716500 -- (-335.923) [-335.540] (-335.769) (-342.084) * (-339.825) (-334.633) (-337.673) [-334.935] -- 0:00:16
717000 -- (-337.162) [-334.336] (-336.057) (-336.570) * (-336.775) [-337.671] (-334.879) (-336.143) -- 0:00:16
717500 -- (-335.418) (-337.858) [-337.090] (-335.579) * (-337.171) (-342.347) [-335.646] (-335.188) -- 0:00:16
718000 -- (-337.421) (-336.266) (-335.651) [-337.113] * (-335.260) [-338.424] (-334.851) (-335.634) -- 0:00:16
718500 -- [-337.910] (-338.216) (-339.471) (-334.840) * [-335.826] (-340.831) (-337.524) (-336.131) -- 0:00:16
719000 -- [-337.114] (-335.015) (-337.922) (-335.491) * (-336.401) (-336.852) [-335.683] (-334.670) -- 0:00:16
719500 -- (-334.181) (-337.223) [-337.247] (-337.765) * (-335.292) (-337.528) [-336.472] (-335.970) -- 0:00:16
720000 -- [-334.738] (-338.605) (-336.101) (-335.711) * (-338.940) (-335.407) [-335.160] (-334.937) -- 0:00:16
Average standard deviation of split frequencies: 0.008054
720500 -- [-335.410] (-342.121) (-337.083) (-336.161) * [-334.343] (-335.777) (-334.764) (-334.101) -- 0:00:16
721000 -- (-337.936) (-343.302) (-335.161) [-335.198] * (-334.705) (-339.343) [-336.080] (-335.350) -- 0:00:16
721500 -- (-336.669) [-340.817] (-334.294) (-335.676) * (-334.330) [-335.754] (-334.403) (-339.264) -- 0:00:16
722000 -- (-334.359) [-340.272] (-334.788) (-334.451) * (-335.543) [-334.534] (-334.931) (-337.607) -- 0:00:16
722500 -- [-335.402] (-338.867) (-335.321) (-335.238) * (-338.518) (-336.880) [-337.557] (-337.683) -- 0:00:16
723000 -- (-335.223) (-336.919) (-338.230) [-338.109] * (-335.905) (-335.883) [-336.826] (-339.822) -- 0:00:16
723500 -- (-336.134) (-337.316) [-335.087] (-335.228) * [-334.474] (-336.248) (-340.832) (-334.788) -- 0:00:16
724000 -- (-341.007) (-334.472) (-334.686) [-334.712] * [-339.775] (-335.808) (-340.436) (-335.632) -- 0:00:16
724500 -- (-336.512) (-334.934) [-338.034] (-336.342) * (-337.251) (-336.326) [-341.227] (-335.440) -- 0:00:16
725000 -- [-335.174] (-336.176) (-335.387) (-341.517) * (-336.478) (-335.776) (-340.859) [-335.528] -- 0:00:16
Average standard deviation of split frequencies: 0.008076
725500 -- [-335.322] (-336.766) (-335.588) (-336.851) * (-335.890) (-335.828) (-333.908) [-338.606] -- 0:00:16
726000 -- (-339.051) (-335.350) [-335.824] (-336.721) * (-338.456) [-336.762] (-338.753) (-337.324) -- 0:00:16
726500 -- [-335.102] (-335.842) (-335.082) (-337.339) * [-335.030] (-343.646) (-341.616) (-335.937) -- 0:00:16
727000 -- (-337.441) (-336.418) (-336.841) [-337.262] * (-337.552) [-335.565] (-339.614) (-338.374) -- 0:00:16
727500 -- (-335.734) [-334.811] (-338.977) (-336.835) * [-336.191] (-336.211) (-337.413) (-337.996) -- 0:00:16
728000 -- (-337.079) (-334.930) [-337.524] (-335.611) * (-336.057) [-335.291] (-337.290) (-334.844) -- 0:00:16
728500 -- [-336.301] (-335.342) (-337.355) (-336.025) * (-334.309) (-338.962) (-337.057) [-335.885] -- 0:00:16
729000 -- (-336.766) (-335.158) [-337.919] (-337.179) * [-339.637] (-335.488) (-334.145) (-334.793) -- 0:00:15
729500 -- (-336.986) (-337.243) (-337.497) [-334.736] * (-334.243) (-336.043) [-335.608] (-335.139) -- 0:00:15
730000 -- (-334.932) (-337.879) (-335.660) [-336.482] * [-337.445] (-336.424) (-336.479) (-335.393) -- 0:00:15
Average standard deviation of split frequencies: 0.008266
730500 -- (-336.495) (-334.593) (-336.130) [-335.849] * [-334.606] (-334.549) (-338.199) (-340.861) -- 0:00:15
731000 -- (-340.130) (-335.801) (-337.637) [-334.204] * (-336.276) (-335.791) [-341.247] (-335.242) -- 0:00:15
731500 -- (-335.007) (-337.199) (-334.767) [-335.641] * (-335.344) (-335.776) [-334.113] (-336.334) -- 0:00:15
732000 -- (-335.644) (-338.479) [-335.960] (-337.388) * (-338.662) (-336.458) (-335.961) [-336.446] -- 0:00:15
732500 -- (-335.093) (-334.209) (-335.522) [-335.610] * [-337.296] (-337.535) (-337.349) (-335.796) -- 0:00:15
733000 -- [-335.332] (-334.637) (-338.668) (-335.333) * (-334.824) [-337.963] (-336.635) (-339.050) -- 0:00:15
733500 -- [-338.257] (-336.303) (-336.919) (-335.335) * (-336.627) [-335.234] (-334.753) (-340.148) -- 0:00:15
734000 -- [-336.379] (-335.849) (-334.862) (-335.514) * (-339.864) (-334.533) [-337.702] (-338.323) -- 0:00:15
734500 -- (-336.571) (-335.196) [-334.218] (-339.349) * [-336.725] (-336.874) (-339.554) (-336.043) -- 0:00:15
735000 -- (-335.358) (-338.497) [-334.544] (-337.461) * (-337.199) (-335.877) [-334.931] (-335.304) -- 0:00:15
Average standard deviation of split frequencies: 0.008206
735500 -- (-335.631) [-336.368] (-335.228) (-339.339) * (-337.934) (-337.683) [-343.556] (-334.873) -- 0:00:15
736000 -- [-338.449] (-336.865) (-334.354) (-337.252) * (-336.362) [-337.673] (-336.831) (-338.628) -- 0:00:15
736500 -- (-336.019) [-337.232] (-337.169) (-337.612) * [-335.697] (-337.533) (-334.916) (-341.271) -- 0:00:15
737000 -- (-336.777) (-336.432) (-335.658) [-337.107] * (-335.939) (-342.275) [-336.717] (-337.247) -- 0:00:15
737500 -- (-334.299) [-335.661] (-337.348) (-343.341) * (-335.917) (-336.830) [-335.040] (-337.398) -- 0:00:15
738000 -- (-335.840) [-337.393] (-336.129) (-339.422) * (-334.771) (-341.545) (-335.847) [-334.707] -- 0:00:15
738500 -- (-335.530) (-335.066) [-336.151] (-335.760) * (-335.616) [-336.166] (-334.957) (-336.070) -- 0:00:15
739000 -- (-335.730) [-334.459] (-336.519) (-335.682) * (-336.862) (-335.813) [-335.328] (-335.849) -- 0:00:15
739500 -- (-335.270) [-334.629] (-341.737) (-335.148) * (-335.066) (-338.176) (-335.891) [-340.210] -- 0:00:15
740000 -- (-335.901) (-335.617) (-335.641) [-334.721] * (-338.584) (-335.928) (-336.349) [-335.555] -- 0:00:15
Average standard deviation of split frequencies: 0.008552
740500 -- [-334.207] (-336.553) (-337.258) (-338.211) * (-333.973) (-337.556) (-334.255) [-335.085] -- 0:00:15
741000 -- (-336.276) [-335.623] (-336.176) (-335.675) * (-338.756) (-336.227) [-336.165] (-335.541) -- 0:00:15
741500 -- (-334.126) (-337.543) (-335.569) [-337.612] * (-335.563) (-337.146) (-339.989) [-335.480] -- 0:00:15
742000 -- [-335.111] (-336.335) (-336.929) (-339.197) * (-337.271) [-335.669] (-336.306) (-336.454) -- 0:00:15
742500 -- (-336.610) (-341.196) (-337.114) [-336.364] * (-335.372) (-338.103) (-337.475) [-335.025] -- 0:00:15
743000 -- (-338.924) (-334.904) [-338.486] (-335.196) * (-334.579) (-335.055) (-336.312) [-337.535] -- 0:00:15
743500 -- [-334.077] (-335.306) (-339.548) (-338.366) * (-334.500) (-335.852) [-335.351] (-335.308) -- 0:00:15
744000 -- [-334.686] (-335.505) (-336.829) (-337.934) * (-334.684) (-338.064) [-335.545] (-335.492) -- 0:00:15
744500 -- [-336.373] (-334.351) (-335.244) (-337.023) * (-338.600) [-336.551] (-334.135) (-335.200) -- 0:00:15
745000 -- [-335.081] (-336.309) (-335.503) (-338.400) * (-340.533) (-337.157) (-335.315) [-334.640] -- 0:00:15
Average standard deviation of split frequencies: 0.008649
745500 -- [-334.995] (-338.109) (-335.104) (-336.630) * (-341.277) (-338.129) [-334.647] (-336.921) -- 0:00:15
746000 -- (-334.854) (-334.883) (-337.711) [-336.382] * [-335.438] (-338.060) (-335.969) (-336.321) -- 0:00:14
746500 -- (-334.775) (-336.650) [-334.498] (-340.621) * (-336.316) (-340.016) (-338.401) [-334.864] -- 0:00:14
747000 -- (-335.919) [-336.686] (-336.561) (-340.145) * (-336.768) [-337.739] (-341.076) (-338.403) -- 0:00:14
747500 -- (-336.036) (-336.015) [-334.720] (-335.048) * [-337.032] (-335.941) (-337.955) (-336.017) -- 0:00:14
748000 -- (-335.285) (-336.648) [-336.290] (-335.880) * (-334.384) (-334.244) [-336.925] (-337.732) -- 0:00:14
748500 -- (-335.451) (-336.618) [-334.409] (-336.632) * (-336.859) [-335.211] (-334.043) (-337.936) -- 0:00:14
749000 -- (-335.432) (-336.962) (-338.263) [-335.660] * [-337.146] (-335.126) (-336.195) (-334.160) -- 0:00:14
749500 -- (-334.960) [-339.237] (-333.999) (-336.462) * [-335.531] (-335.579) (-336.951) (-334.192) -- 0:00:14
750000 -- (-335.022) (-337.265) [-336.018] (-334.619) * (-335.020) [-334.668] (-334.226) (-334.656) -- 0:00:14
Average standard deviation of split frequencies: 0.008321
750500 -- [-336.900] (-335.395) (-337.390) (-334.961) * [-335.452] (-337.119) (-335.596) (-335.106) -- 0:00:14
751000 -- (-335.344) [-334.989] (-334.714) (-336.521) * (-337.446) (-334.593) [-335.470] (-334.781) -- 0:00:14
751500 -- [-338.419] (-337.037) (-335.940) (-339.069) * [-335.628] (-334.116) (-336.064) (-336.049) -- 0:00:14
752000 -- (-335.528) (-336.351) (-338.310) [-336.980] * (-340.579) [-335.101] (-336.813) (-340.134) -- 0:00:14
752500 -- [-334.772] (-336.416) (-337.778) (-335.747) * (-337.034) [-335.486] (-336.774) (-337.426) -- 0:00:14
753000 -- (-334.815) [-336.742] (-337.093) (-339.011) * [-335.067] (-335.457) (-335.841) (-335.088) -- 0:00:14
753500 -- [-335.010] (-336.889) (-336.457) (-335.532) * (-337.291) [-334.369] (-336.025) (-335.125) -- 0:00:14
754000 -- (-342.661) (-334.273) [-334.797] (-336.769) * (-335.170) (-335.417) (-336.928) [-334.939] -- 0:00:14
754500 -- (-337.416) (-334.493) [-336.504] (-337.903) * (-336.912) (-337.692) (-336.752) [-336.299] -- 0:00:14
755000 -- (-340.652) [-335.673] (-342.180) (-335.855) * (-340.306) (-335.015) [-334.992] (-336.548) -- 0:00:14
Average standard deviation of split frequencies: 0.008262
755500 -- (-337.469) (-337.515) (-334.992) [-335.494] * [-337.207] (-336.608) (-337.229) (-337.115) -- 0:00:14
756000 -- (-334.673) (-336.202) (-340.990) [-334.569] * (-336.773) (-336.506) (-336.598) [-336.871] -- 0:00:14
756500 -- (-338.249) (-335.734) (-336.386) [-334.610] * (-339.252) (-334.567) (-334.379) [-337.081] -- 0:00:14
757000 -- (-342.463) [-338.350] (-334.879) (-336.037) * (-337.945) (-335.734) (-335.626) [-341.386] -- 0:00:14
757500 -- (-341.224) (-342.039) [-335.498] (-338.648) * (-335.298) [-335.951] (-335.442) (-336.459) -- 0:00:14
758000 -- [-338.924] (-335.930) (-336.244) (-335.223) * (-334.543) [-334.923] (-336.968) (-339.093) -- 0:00:14
758500 -- (-338.947) [-337.286] (-341.682) (-335.190) * [-336.908] (-335.049) (-337.463) (-340.571) -- 0:00:14
759000 -- (-335.734) (-337.911) (-340.371) [-338.749] * [-335.510] (-334.100) (-336.875) (-337.353) -- 0:00:14
759500 -- (-338.262) [-337.200] (-335.224) (-335.548) * (-338.370) [-337.040] (-336.083) (-334.535) -- 0:00:14
760000 -- (-340.478) (-336.038) [-336.593] (-336.894) * (-336.001) (-336.284) [-335.454] (-338.868) -- 0:00:14
Average standard deviation of split frequencies: 0.008250
760500 -- (-334.879) (-335.798) (-336.215) [-338.635] * [-335.234] (-335.386) (-338.325) (-340.020) -- 0:00:14
761000 -- [-335.261] (-335.940) (-336.024) (-340.163) * (-336.177) (-334.326) [-340.527] (-335.089) -- 0:00:14
761500 -- [-335.078] (-339.825) (-339.264) (-336.685) * (-337.435) (-340.159) [-336.225] (-338.411) -- 0:00:14
762000 -- (-336.360) (-338.832) (-337.477) [-337.659] * (-337.500) (-336.741) [-338.489] (-335.616) -- 0:00:14
762500 -- (-336.929) [-336.971] (-335.344) (-335.438) * [-337.564] (-336.916) (-335.040) (-338.327) -- 0:00:14
763000 -- [-335.214] (-337.039) (-338.530) (-339.621) * (-337.802) (-337.058) (-336.337) [-335.699] -- 0:00:13
763500 -- (-334.111) [-334.661] (-341.934) (-334.165) * (-336.864) (-336.154) [-337.880] (-337.386) -- 0:00:13
764000 -- (-335.755) (-334.985) (-342.638) [-338.219] * [-336.003] (-336.152) (-337.537) (-337.908) -- 0:00:13
764500 -- (-336.692) (-335.307) [-335.057] (-336.030) * (-335.117) (-336.874) [-336.964] (-337.827) -- 0:00:13
765000 -- [-340.415] (-335.612) (-338.940) (-337.850) * (-334.853) (-338.623) (-337.476) [-338.197] -- 0:00:13
Average standard deviation of split frequencies: 0.007808
765500 -- (-335.931) (-337.801) (-338.417) [-335.416] * (-335.711) [-336.875] (-335.176) (-336.316) -- 0:00:13
766000 -- (-336.831) [-335.173] (-338.861) (-334.256) * (-334.811) [-335.873] (-335.374) (-334.574) -- 0:00:13
766500 -- [-340.478] (-334.956) (-337.718) (-336.724) * [-337.600] (-334.628) (-336.624) (-337.305) -- 0:00:13
767000 -- (-341.798) (-337.728) (-337.034) [-336.752] * (-339.129) (-336.538) (-337.700) [-334.766] -- 0:00:13
767500 -- (-336.410) (-337.446) [-335.921] (-341.239) * [-337.228] (-336.108) (-339.600) (-334.360) -- 0:00:13
768000 -- [-334.459] (-337.323) (-335.586) (-337.978) * [-336.309] (-337.332) (-335.416) (-336.601) -- 0:00:13
768500 -- (-334.482) (-337.021) (-335.389) [-335.717] * (-335.207) [-336.910] (-336.221) (-335.265) -- 0:00:13
769000 -- (-334.039) (-335.312) (-338.041) [-336.027] * [-337.849] (-337.449) (-336.846) (-334.847) -- 0:00:13
769500 -- (-334.383) (-338.524) [-336.627] (-334.826) * (-340.405) [-339.111] (-339.580) (-335.791) -- 0:00:13
770000 -- [-335.723] (-338.334) (-335.707) (-336.044) * (-335.188) (-336.579) (-338.469) [-337.909] -- 0:00:13
Average standard deviation of split frequencies: 0.007761
770500 -- (-335.534) (-334.589) [-334.352] (-335.846) * [-334.156] (-336.398) (-336.713) (-339.678) -- 0:00:13
771000 -- (-336.500) [-334.184] (-336.227) (-335.918) * [-335.230] (-337.759) (-337.515) (-337.187) -- 0:00:13
771500 -- (-339.728) (-335.067) (-337.992) [-337.492] * (-334.909) (-338.480) (-339.598) [-335.798] -- 0:00:13
772000 -- (-339.493) [-335.041] (-338.960) (-337.422) * [-334.226] (-337.221) (-337.802) (-338.698) -- 0:00:13
772500 -- (-342.108) [-335.606] (-343.985) (-335.184) * [-334.728] (-340.155) (-338.047) (-335.461) -- 0:00:13
773000 -- (-335.019) [-339.706] (-341.798) (-336.170) * (-339.695) [-336.386] (-335.994) (-333.810) -- 0:00:13
773500 -- (-338.237) (-340.217) [-334.154] (-334.220) * [-336.266] (-334.848) (-335.097) (-335.648) -- 0:00:13
774000 -- (-340.627) (-334.473) [-336.138] (-337.237) * (-334.981) (-339.567) (-337.029) [-337.467] -- 0:00:13
774500 -- (-335.825) (-335.048) [-338.117] (-337.531) * (-334.823) [-337.491] (-336.399) (-335.781) -- 0:00:13
775000 -- [-335.996] (-334.235) (-336.835) (-335.653) * [-337.474] (-334.006) (-338.403) (-336.019) -- 0:00:13
Average standard deviation of split frequencies: 0.007669
775500 -- (-334.727) [-335.523] (-334.605) (-335.221) * (-338.042) [-335.881] (-337.583) (-336.915) -- 0:00:13
776000 -- [-336.756] (-334.987) (-334.351) (-335.245) * (-342.576) [-334.720] (-334.768) (-337.128) -- 0:00:13
776500 -- [-335.762] (-334.735) (-334.563) (-336.402) * [-336.449] (-335.983) (-336.890) (-335.675) -- 0:00:13
777000 -- (-336.515) [-335.443] (-333.990) (-343.054) * (-337.577) [-338.708] (-335.555) (-334.531) -- 0:00:13
777500 -- [-338.266] (-335.050) (-337.720) (-337.354) * [-337.379] (-337.846) (-337.939) (-335.904) -- 0:00:13
778000 -- (-334.383) (-336.466) [-335.562] (-334.170) * [-334.079] (-338.493) (-337.938) (-335.285) -- 0:00:13
778500 -- (-336.711) (-334.250) [-335.594] (-336.014) * (-336.703) (-336.067) (-336.855) [-334.064] -- 0:00:13
779000 -- (-334.625) (-337.464) (-338.425) [-335.980] * (-343.524) (-336.228) (-334.079) [-334.842] -- 0:00:13
779500 -- (-337.549) (-335.884) [-336.442] (-335.095) * (-334.088) (-336.018) (-337.863) [-334.609] -- 0:00:13
780000 -- (-336.016) (-336.467) [-335.296] (-335.325) * (-337.172) [-338.044] (-339.534) (-334.844) -- 0:00:12
Average standard deviation of split frequencies: 0.008152
780500 -- (-334.649) (-336.998) [-335.324] (-338.147) * (-336.415) (-335.632) (-336.474) [-335.849] -- 0:00:12
781000 -- [-335.262] (-335.564) (-337.872) (-334.311) * (-337.887) (-335.079) [-334.950] (-335.381) -- 0:00:12
781500 -- (-334.953) (-336.148) [-339.512] (-336.648) * (-334.987) [-336.792] (-336.548) (-335.863) -- 0:00:12
782000 -- (-334.656) (-336.718) (-336.867) [-333.961] * [-334.484] (-334.539) (-338.794) (-338.950) -- 0:00:12
782500 -- (-342.293) [-337.155] (-336.785) (-337.853) * (-337.796) (-336.513) [-335.859] (-337.393) -- 0:00:12
783000 -- (-333.871) (-339.594) [-336.751] (-334.957) * (-338.440) (-335.496) (-341.739) [-338.341] -- 0:00:12
783500 -- (-334.704) (-338.350) (-338.247) [-335.196] * (-346.806) (-336.793) (-335.209) [-335.346] -- 0:00:12
784000 -- (-336.113) [-334.700] (-334.063) (-334.239) * [-343.117] (-337.803) (-337.748) (-337.352) -- 0:00:12
784500 -- (-338.006) [-337.537] (-338.060) (-335.869) * (-335.960) [-338.386] (-338.344) (-336.696) -- 0:00:12
785000 -- (-339.138) (-334.213) [-334.650] (-335.682) * [-334.677] (-336.103) (-336.966) (-336.364) -- 0:00:12
Average standard deviation of split frequencies: 0.007834
785500 -- (-337.077) (-336.588) (-335.651) [-335.802] * [-335.115] (-336.092) (-338.227) (-336.939) -- 0:00:12
786000 -- (-337.338) (-336.322) [-337.330] (-334.520) * (-334.723) (-335.837) [-336.843] (-338.009) -- 0:00:12
786500 -- (-336.632) (-337.962) [-335.130] (-337.008) * [-334.433] (-337.969) (-342.150) (-338.534) -- 0:00:12
787000 -- (-336.415) (-336.760) (-337.971) [-338.088] * (-334.938) (-335.031) [-336.217] (-340.758) -- 0:00:12
787500 -- (-335.539) [-334.796] (-335.783) (-336.810) * (-335.741) (-336.613) (-337.553) [-334.613] -- 0:00:12
788000 -- (-337.378) (-336.052) [-336.277] (-336.917) * (-335.708) [-335.733] (-336.020) (-335.171) -- 0:00:12
788500 -- (-335.900) (-336.452) (-337.122) [-335.891] * [-334.710] (-335.332) (-335.514) (-335.462) -- 0:00:12
789000 -- (-336.995) (-339.295) [-335.042] (-338.790) * (-338.427) [-336.363] (-343.001) (-339.213) -- 0:00:12
789500 -- (-335.950) [-334.826] (-338.049) (-336.267) * (-339.377) (-337.602) [-335.525] (-338.714) -- 0:00:12
790000 -- (-336.462) [-334.330] (-339.976) (-336.399) * (-336.669) (-340.302) (-339.049) [-335.304] -- 0:00:12
Average standard deviation of split frequencies: 0.007639
790500 -- (-334.712) (-339.293) (-337.220) [-335.105] * (-337.183) (-339.347) [-335.855] (-336.424) -- 0:00:12
791000 -- (-339.309) [-335.864] (-338.625) (-336.494) * (-336.584) (-336.835) [-336.820] (-336.606) -- 0:00:12
791500 -- (-337.010) [-336.766] (-335.492) (-336.345) * (-335.754) (-336.718) (-336.087) [-335.169] -- 0:00:12
792000 -- [-334.311] (-334.959) (-335.946) (-335.463) * (-334.462) (-334.785) [-337.937] (-335.406) -- 0:00:12
792500 -- (-334.981) (-336.375) [-335.709] (-334.539) * (-334.735) (-333.894) (-337.974) [-336.532] -- 0:00:12
793000 -- (-334.598) [-334.339] (-335.589) (-334.794) * (-338.100) (-337.883) [-337.863] (-334.900) -- 0:00:12
793500 -- [-335.197] (-334.540) (-337.366) (-335.503) * (-339.225) (-336.946) (-335.616) [-334.867] -- 0:00:12
794000 -- [-335.999] (-336.532) (-338.905) (-335.528) * (-337.891) [-335.711] (-336.691) (-335.949) -- 0:00:12
794500 -- [-339.072] (-336.079) (-335.545) (-335.196) * [-336.733] (-335.483) (-337.714) (-335.090) -- 0:00:12
795000 -- [-338.554] (-334.913) (-337.377) (-334.129) * [-335.136] (-337.531) (-340.114) (-338.123) -- 0:00:12
Average standard deviation of split frequencies: 0.007699
795500 -- (-336.629) (-338.182) [-335.380] (-337.817) * (-336.790) [-335.669] (-338.507) (-335.361) -- 0:00:12
796000 -- (-336.843) [-336.402] (-338.198) (-336.868) * (-339.007) (-334.114) [-337.162] (-335.955) -- 0:00:12
796500 -- (-336.089) (-336.849) (-336.026) [-335.682] * (-340.255) [-334.602] (-334.854) (-334.452) -- 0:00:12
797000 -- (-340.384) [-337.126] (-341.130) (-337.085) * (-340.893) [-334.478] (-337.425) (-337.159) -- 0:00:11
797500 -- (-335.790) (-337.089) [-336.364] (-337.786) * (-336.585) (-336.577) [-340.079] (-337.834) -- 0:00:11
798000 -- (-336.454) [-336.091] (-335.933) (-337.172) * [-335.612] (-337.311) (-339.985) (-335.537) -- 0:00:11
798500 -- (-337.513) (-334.792) (-336.500) [-337.247] * (-336.662) (-336.604) [-338.980] (-338.657) -- 0:00:11
799000 -- (-336.177) [-336.823] (-338.029) (-339.250) * (-334.426) [-337.049] (-334.872) (-339.536) -- 0:00:11
799500 -- [-338.423] (-335.709) (-339.463) (-334.321) * (-334.504) (-336.417) [-338.462] (-337.985) -- 0:00:11
800000 -- (-341.103) [-337.198] (-337.009) (-337.780) * (-335.862) (-334.296) (-336.984) [-335.002] -- 0:00:11
Average standard deviation of split frequencies: 0.007507
800500 -- (-338.076) (-335.534) (-335.172) [-334.637] * [-335.817] (-336.918) (-337.124) (-338.258) -- 0:00:11
801000 -- (-336.603) [-335.690] (-337.769) (-335.526) * (-335.578) (-334.048) (-334.690) [-334.838] -- 0:00:11
801500 -- (-339.945) [-335.037] (-334.746) (-336.283) * (-335.658) (-335.753) [-334.263] (-336.816) -- 0:00:11
802000 -- (-337.284) (-334.366) (-335.382) [-335.269] * [-335.113] (-336.373) (-334.427) (-336.587) -- 0:00:11
802500 -- [-336.065] (-337.507) (-336.144) (-334.922) * (-336.614) (-336.322) (-335.274) [-335.576] -- 0:00:11
803000 -- [-335.047] (-335.593) (-335.982) (-337.082) * [-338.214] (-336.855) (-336.119) (-334.820) -- 0:00:11
803500 -- (-336.310) [-334.536] (-334.744) (-336.949) * (-337.661) (-335.782) (-337.537) [-336.885] -- 0:00:11
804000 -- (-335.184) [-335.982] (-338.199) (-334.695) * (-339.260) (-335.380) [-336.488] (-337.840) -- 0:00:11
804500 -- (-337.851) [-334.643] (-336.666) (-335.634) * (-336.668) (-336.756) [-335.750] (-338.230) -- 0:00:11
805000 -- (-337.724) (-335.528) (-338.169) [-335.168] * (-335.016) (-339.032) (-334.785) [-338.544] -- 0:00:11
Average standard deviation of split frequencies: 0.007969
805500 -- [-334.992] (-336.293) (-336.126) (-335.124) * (-337.070) (-337.247) (-335.585) [-335.349] -- 0:00:11
806000 -- [-335.700] (-334.450) (-336.206) (-336.309) * (-334.163) [-334.660] (-339.435) (-338.088) -- 0:00:11
806500 -- [-335.701] (-334.311) (-340.946) (-337.605) * [-335.814] (-335.363) (-335.788) (-334.668) -- 0:00:11
807000 -- (-336.176) [-334.181] (-338.809) (-336.226) * (-335.684) (-336.157) [-334.954] (-334.039) -- 0:00:11
807500 -- (-344.664) (-336.476) [-336.664] (-336.889) * (-334.953) [-334.597] (-336.857) (-334.162) -- 0:00:11
808000 -- (-337.978) [-334.274] (-336.087) (-337.640) * [-334.757] (-338.298) (-337.071) (-336.867) -- 0:00:11
808500 -- (-336.214) [-335.462] (-335.462) (-335.444) * (-334.448) (-334.484) (-336.600) [-335.212] -- 0:00:11
809000 -- (-335.530) (-337.609) (-334.610) [-338.091] * (-335.182) [-337.337] (-335.155) (-338.463) -- 0:00:11
809500 -- (-335.151) [-334.745] (-335.269) (-337.788) * (-335.696) (-334.989) [-334.499] (-334.918) -- 0:00:11
810000 -- (-334.461) (-334.882) (-336.888) [-340.520] * (-335.325) (-334.872) [-334.416] (-336.182) -- 0:00:11
Average standard deviation of split frequencies: 0.007887
810500 -- (-334.877) (-336.451) [-337.920] (-338.755) * [-341.178] (-335.399) (-337.076) (-336.747) -- 0:00:11
811000 -- (-337.376) (-335.077) (-334.801) [-334.486] * (-338.849) (-335.082) (-337.516) [-335.321] -- 0:00:11
811500 -- [-337.685] (-335.755) (-334.001) (-344.707) * (-334.978) (-338.115) (-335.396) [-334.950] -- 0:00:11
812000 -- (-336.299) (-334.629) [-335.023] (-336.469) * (-338.860) (-334.633) (-338.523) [-334.654] -- 0:00:11
812500 -- (-334.588) [-336.395] (-336.245) (-335.323) * (-336.138) (-334.320) (-338.699) [-336.691] -- 0:00:11
813000 -- (-334.800) [-338.931] (-334.695) (-334.850) * [-338.022] (-334.167) (-336.455) (-337.275) -- 0:00:11
813500 -- [-335.690] (-338.331) (-337.933) (-336.052) * (-334.838) (-336.584) (-334.835) [-340.733] -- 0:00:11
814000 -- (-337.399) [-338.424] (-338.806) (-334.014) * (-335.268) [-336.947] (-335.970) (-337.657) -- 0:00:10
814500 -- (-337.218) [-338.401] (-337.459) (-337.326) * (-337.093) (-337.082) (-335.402) [-336.835] -- 0:00:10
815000 -- (-336.547) (-337.879) (-337.828) [-336.172] * (-335.016) [-334.282] (-336.674) (-337.064) -- 0:00:10
Average standard deviation of split frequencies: 0.007835
815500 -- (-337.753) (-339.585) [-335.706] (-334.703) * (-337.478) [-334.951] (-334.411) (-336.444) -- 0:00:10
816000 -- [-337.310] (-336.164) (-336.255) (-335.903) * [-338.617] (-335.961) (-336.936) (-334.107) -- 0:00:10
816500 -- (-338.674) (-336.859) [-336.613] (-334.854) * (-339.965) (-336.573) [-335.857] (-334.304) -- 0:00:10
817000 -- (-334.979) (-334.193) [-336.419] (-336.811) * (-338.268) (-338.642) (-336.385) [-336.254] -- 0:00:10
817500 -- (-340.825) (-336.002) [-336.992] (-337.581) * [-335.420] (-337.785) (-335.194) (-336.509) -- 0:00:10
818000 -- (-335.502) (-335.301) [-336.332] (-335.683) * (-337.621) (-335.110) [-339.288] (-338.528) -- 0:00:10
818500 -- [-337.961] (-335.470) (-334.642) (-335.558) * [-337.650] (-335.493) (-336.443) (-339.991) -- 0:00:10
819000 -- (-340.507) [-335.615] (-335.609) (-334.719) * (-340.042) (-336.164) (-336.015) [-338.550] -- 0:00:10
819500 -- (-338.619) [-335.558] (-335.385) (-338.752) * [-339.625] (-337.971) (-334.950) (-338.173) -- 0:00:10
820000 -- (-336.973) [-336.539] (-336.073) (-335.037) * [-334.237] (-337.333) (-334.059) (-336.395) -- 0:00:10
Average standard deviation of split frequencies: 0.008221
820500 -- [-339.876] (-334.775) (-335.817) (-338.030) * (-342.271) (-334.864) (-334.668) [-334.519] -- 0:00:10
821000 -- (-338.578) (-334.931) (-334.101) [-336.288] * (-337.222) [-334.861] (-336.273) (-334.613) -- 0:00:10
821500 -- (-336.728) [-339.953] (-333.915) (-335.147) * (-335.763) (-337.589) (-334.428) [-335.413] -- 0:00:10
822000 -- (-339.539) (-338.729) [-337.151] (-337.374) * (-334.135) (-335.678) (-335.141) [-336.202] -- 0:00:10
822500 -- (-335.669) (-335.177) (-339.229) [-338.152] * (-336.991) (-334.569) [-334.150] (-338.246) -- 0:00:10
823000 -- (-335.034) (-335.857) (-336.835) [-334.399] * (-335.843) (-339.819) [-336.306] (-340.603) -- 0:00:10
823500 -- (-334.755) (-339.054) [-335.050] (-335.429) * (-336.592) [-335.412] (-338.217) (-337.668) -- 0:00:10
824000 -- [-335.595] (-335.587) (-338.179) (-336.832) * (-337.265) (-335.118) [-340.356] (-336.977) -- 0:00:10
824500 -- (-339.959) (-335.400) [-336.698] (-335.648) * [-336.137] (-341.195) (-339.745) (-335.517) -- 0:00:10
825000 -- (-334.541) [-337.174] (-337.006) (-336.631) * (-337.769) [-336.728] (-338.223) (-334.229) -- 0:00:10
Average standard deviation of split frequencies: 0.008061
825500 -- [-334.621] (-334.952) (-338.944) (-335.643) * (-336.958) (-339.056) (-336.336) [-334.513] -- 0:00:10
826000 -- [-336.534] (-335.745) (-342.577) (-335.211) * (-337.529) (-335.047) (-338.126) [-334.920] -- 0:00:10
826500 -- [-334.123] (-335.602) (-337.746) (-336.367) * [-335.515] (-334.968) (-335.847) (-337.255) -- 0:00:10
827000 -- (-334.276) [-335.360] (-337.305) (-335.394) * (-339.169) (-337.984) (-337.312) [-336.933] -- 0:00:10
827500 -- (-335.986) (-334.556) (-337.283) [-335.668] * [-336.211] (-337.118) (-335.572) (-337.166) -- 0:00:10
828000 -- (-336.503) [-336.122] (-339.247) (-338.177) * (-334.765) [-336.807] (-335.933) (-339.205) -- 0:00:10
828500 -- (-335.385) (-338.524) (-335.431) [-335.683] * [-334.861] (-341.273) (-336.369) (-335.613) -- 0:00:10
829000 -- (-337.136) (-336.571) [-335.108] (-335.160) * (-336.810) [-336.704] (-338.931) (-336.395) -- 0:00:10
829500 -- (-335.005) [-336.855] (-338.058) (-336.487) * (-336.025) [-336.043] (-336.167) (-336.369) -- 0:00:10
830000 -- (-334.430) (-337.044) [-334.711] (-335.120) * (-337.544) (-335.152) (-339.741) [-340.160] -- 0:00:10
Average standard deviation of split frequencies: 0.007697
830500 -- (-337.556) (-334.758) (-336.008) [-334.856] * (-339.683) (-334.656) [-335.084] (-340.145) -- 0:00:10
831000 -- [-335.467] (-334.274) (-336.833) (-335.287) * (-337.218) (-333.999) (-336.802) [-335.074] -- 0:00:09
831500 -- (-336.856) [-334.485] (-336.609) (-335.000) * (-334.393) (-335.719) (-334.635) [-334.889] -- 0:00:09
832000 -- (-337.847) (-336.737) [-336.667] (-336.681) * (-335.142) [-335.453] (-336.201) (-337.205) -- 0:00:09
832500 -- [-336.402] (-336.624) (-333.972) (-335.818) * (-337.084) [-335.924] (-334.468) (-335.598) -- 0:00:09
833000 -- (-334.793) [-334.829] (-340.473) (-334.970) * (-338.759) [-335.071] (-334.801) (-337.453) -- 0:00:09
833500 -- (-339.236) (-337.107) (-338.471) [-334.751] * (-336.985) [-336.220] (-335.346) (-337.943) -- 0:00:09
834000 -- (-343.575) (-338.803) (-338.142) [-335.135] * (-335.948) (-335.070) (-334.272) [-336.694] -- 0:00:09
834500 -- (-342.465) (-338.784) [-339.867] (-334.947) * (-335.155) [-334.934] (-337.861) (-340.484) -- 0:00:09
835000 -- (-337.687) [-341.100] (-338.710) (-346.188) * (-336.288) (-336.946) [-337.792] (-334.671) -- 0:00:09
Average standard deviation of split frequencies: 0.007577
835500 -- (-336.997) (-336.898) (-335.866) [-338.595] * (-336.118) [-337.523] (-336.405) (-336.318) -- 0:00:09
836000 -- (-341.244) (-338.245) (-336.470) [-336.008] * (-336.352) [-335.778] (-335.566) (-336.977) -- 0:00:09
836500 -- (-335.155) [-335.139] (-339.255) (-336.648) * (-336.830) (-342.655) [-335.432] (-336.969) -- 0:00:09
837000 -- (-335.039) (-334.649) (-340.537) [-335.093] * (-338.306) (-334.896) [-335.905] (-335.705) -- 0:00:09
837500 -- (-334.725) (-340.444) (-339.038) [-337.075] * (-337.024) [-337.647] (-336.827) (-336.998) -- 0:00:09
838000 -- (-334.080) [-338.558] (-337.632) (-336.317) * (-340.665) (-337.648) [-335.868] (-335.068) -- 0:00:09
838500 -- (-335.354) (-337.035) [-337.854] (-335.964) * (-337.059) [-335.747] (-338.467) (-335.072) -- 0:00:09
839000 -- [-335.468] (-335.013) (-335.624) (-336.373) * (-339.393) (-339.042) (-336.114) [-336.667] -- 0:00:09
839500 -- (-334.185) [-335.158] (-336.805) (-337.172) * (-336.940) [-335.696] (-336.236) (-339.258) -- 0:00:09
840000 -- [-336.229] (-336.822) (-335.063) (-338.132) * (-337.495) (-340.414) [-336.799] (-342.081) -- 0:00:09
Average standard deviation of split frequencies: 0.007290
840500 -- (-334.838) [-334.619] (-335.100) (-338.922) * (-337.554) (-334.113) [-338.282] (-339.712) -- 0:00:09
841000 -- (-339.293) (-340.510) [-334.345] (-339.395) * (-338.431) [-336.432] (-336.526) (-340.808) -- 0:00:09
841500 -- (-341.324) (-336.113) [-335.644] (-337.811) * (-335.285) (-337.526) [-337.778] (-338.722) -- 0:00:09
842000 -- [-335.264] (-335.370) (-335.747) (-335.814) * [-336.203] (-335.611) (-334.695) (-336.592) -- 0:00:09
842500 -- [-336.289] (-336.729) (-336.056) (-335.407) * (-334.910) [-335.762] (-334.915) (-336.408) -- 0:00:09
843000 -- (-335.963) [-336.231] (-337.850) (-333.924) * (-335.537) [-336.126] (-336.053) (-336.046) -- 0:00:09
843500 -- [-338.014] (-335.959) (-334.589) (-334.734) * (-336.047) (-337.955) [-334.293] (-336.285) -- 0:00:09
844000 -- (-336.059) (-335.888) [-334.810] (-334.299) * [-334.941] (-335.528) (-336.738) (-336.532) -- 0:00:09
844500 -- (-334.537) (-335.369) (-335.668) [-336.794] * (-336.122) (-336.243) [-336.809] (-335.663) -- 0:00:09
845000 -- (-335.949) [-335.438] (-338.292) (-336.909) * (-339.336) [-335.548] (-337.486) (-334.112) -- 0:00:09
Average standard deviation of split frequencies: 0.006547
845500 -- (-337.793) [-335.516] (-337.338) (-336.369) * [-335.658] (-338.417) (-337.037) (-335.934) -- 0:00:09
846000 -- (-335.818) (-335.833) [-338.070] (-340.405) * [-334.875] (-335.275) (-337.029) (-339.999) -- 0:00:09
846500 -- [-336.876] (-339.143) (-338.127) (-336.759) * (-337.221) [-337.977] (-337.338) (-337.310) -- 0:00:09
847000 -- [-336.518] (-336.274) (-339.090) (-339.023) * (-337.603) (-334.410) [-337.335] (-335.982) -- 0:00:09
847500 -- (-337.094) [-335.112] (-336.875) (-340.218) * (-334.633) [-334.685] (-336.207) (-336.668) -- 0:00:08
848000 -- (-335.608) (-337.922) (-335.045) [-342.524] * [-336.428] (-334.089) (-335.342) (-338.896) -- 0:00:08
848500 -- (-335.532) [-339.138] (-339.106) (-335.751) * (-336.608) (-336.406) [-334.994] (-336.645) -- 0:00:08
849000 -- (-334.949) (-335.337) [-335.807] (-337.780) * (-336.329) [-335.472] (-341.515) (-336.119) -- 0:00:08
849500 -- (-337.463) [-335.046] (-336.496) (-338.208) * (-334.307) (-334.379) [-337.370] (-336.548) -- 0:00:08
850000 -- (-339.606) (-334.621) [-336.399] (-335.307) * [-334.398] (-339.769) (-335.571) (-335.239) -- 0:00:08
Average standard deviation of split frequencies: 0.006546
850500 -- (-335.317) (-336.602) [-335.251] (-337.686) * (-337.784) (-336.037) (-337.330) [-338.999] -- 0:00:08
851000 -- (-341.796) [-338.025] (-336.031) (-336.974) * (-337.831) [-334.687] (-337.442) (-341.849) -- 0:00:08
851500 -- [-335.252] (-335.968) (-336.236) (-335.599) * (-337.079) (-337.863) (-335.560) [-336.163] -- 0:00:08
852000 -- (-335.970) (-336.384) (-335.144) [-335.306] * (-337.099) [-339.271] (-336.784) (-337.730) -- 0:00:08
852500 -- (-335.486) (-335.807) (-335.672) [-337.293] * (-335.526) [-335.155] (-337.360) (-337.980) -- 0:00:08
853000 -- (-336.167) [-337.140] (-336.276) (-338.289) * (-337.091) [-334.728] (-336.433) (-335.711) -- 0:00:08
853500 -- (-337.374) [-335.845] (-335.482) (-336.939) * (-336.700) (-336.081) [-335.303] (-334.803) -- 0:00:08
854000 -- (-335.563) [-334.401] (-340.321) (-334.611) * (-338.445) [-334.152] (-335.726) (-336.029) -- 0:00:08
854500 -- [-334.780] (-337.519) (-339.666) (-336.148) * (-337.087) (-339.127) [-335.574] (-337.200) -- 0:00:08
855000 -- [-335.326] (-335.588) (-338.311) (-335.495) * (-335.664) (-338.434) (-339.727) [-334.986] -- 0:00:08
Average standard deviation of split frequencies: 0.006540
855500 -- (-336.531) (-337.263) (-337.110) [-339.805] * (-337.580) (-342.126) [-337.619] (-334.952) -- 0:00:08
856000 -- [-335.166] (-336.419) (-337.519) (-340.407) * (-334.274) (-334.644) (-336.496) [-336.494] -- 0:00:08
856500 -- [-335.072] (-336.459) (-338.679) (-339.719) * (-335.344) [-334.403] (-341.699) (-340.006) -- 0:00:08
857000 -- (-339.368) [-335.087] (-340.392) (-338.059) * [-335.305] (-338.474) (-337.611) (-335.439) -- 0:00:08
857500 -- (-343.391) (-336.413) [-335.999] (-335.287) * [-335.661] (-339.028) (-338.908) (-334.487) -- 0:00:08
858000 -- (-336.396) [-335.041] (-338.898) (-335.060) * (-336.657) [-335.991] (-336.895) (-334.668) -- 0:00:08
858500 -- (-338.889) (-335.302) (-336.534) [-335.254] * (-335.125) (-336.058) (-339.319) [-334.013] -- 0:00:08
859000 -- (-336.193) (-335.835) (-339.007) [-340.009] * [-338.196] (-336.346) (-334.562) (-335.416) -- 0:00:08
859500 -- (-336.681) [-335.728] (-341.008) (-337.874) * (-337.007) (-334.971) (-335.189) [-336.665] -- 0:00:08
860000 -- (-334.324) (-335.629) [-335.136] (-337.350) * (-334.117) (-337.035) [-334.588] (-334.120) -- 0:00:08
Average standard deviation of split frequencies: 0.006025
860500 -- [-337.141] (-335.989) (-340.257) (-338.711) * (-335.917) (-337.532) (-334.755) [-336.650] -- 0:00:08
861000 -- [-337.271] (-335.804) (-342.749) (-334.997) * [-337.335] (-337.579) (-336.343) (-338.211) -- 0:00:08
861500 -- (-336.566) (-337.343) [-335.093] (-335.791) * (-335.238) (-340.273) [-336.336] (-340.834) -- 0:00:08
862000 -- (-336.655) (-336.781) [-335.197] (-337.945) * [-337.172] (-337.168) (-337.318) (-335.979) -- 0:00:08
862500 -- (-337.245) [-337.285] (-334.341) (-337.958) * (-336.507) (-335.907) (-338.526) [-341.978] -- 0:00:08
863000 -- [-336.011] (-335.928) (-336.352) (-336.814) * [-335.019] (-338.011) (-334.715) (-334.973) -- 0:00:08
863500 -- (-335.981) [-338.652] (-338.105) (-335.218) * [-335.162] (-336.177) (-335.114) (-336.821) -- 0:00:08
864000 -- [-336.440] (-336.504) (-337.053) (-335.340) * (-335.101) (-336.882) (-338.119) [-334.736] -- 0:00:08
864500 -- (-335.543) (-337.362) [-336.408] (-335.915) * (-334.697) (-335.279) [-338.444] (-336.029) -- 0:00:07
865000 -- (-335.574) [-341.065] (-334.599) (-335.152) * (-344.274) [-335.142] (-335.510) (-335.426) -- 0:00:07
Average standard deviation of split frequencies: 0.006702
865500 -- (-334.078) (-335.402) (-334.803) [-335.908] * (-339.106) (-337.343) [-339.707] (-335.479) -- 0:00:07
866000 -- [-335.212] (-335.503) (-335.960) (-337.416) * (-341.557) (-335.974) (-337.111) [-336.680] -- 0:00:07
866500 -- (-335.776) [-334.645] (-336.886) (-335.680) * (-336.847) [-334.534] (-334.231) (-338.409) -- 0:00:07
867000 -- [-335.407] (-334.581) (-336.091) (-336.182) * (-336.834) (-337.144) [-337.269] (-336.846) -- 0:00:07
867500 -- [-338.769] (-334.346) (-335.331) (-338.285) * (-338.785) [-334.842] (-339.135) (-337.442) -- 0:00:07
868000 -- (-338.664) (-334.628) [-337.072] (-338.004) * (-337.957) (-335.333) [-337.146] (-336.061) -- 0:00:07
868500 -- (-335.253) (-337.125) (-336.236) [-339.338] * (-337.129) [-336.198] (-336.074) (-335.558) -- 0:00:07
869000 -- (-335.766) (-336.855) [-335.831] (-339.406) * (-341.259) [-335.333] (-334.948) (-338.908) -- 0:00:07
869500 -- (-335.318) [-336.578] (-338.993) (-339.458) * (-338.737) (-335.746) [-335.045] (-338.150) -- 0:00:07
870000 -- [-336.761] (-339.031) (-337.672) (-341.471) * (-338.710) (-334.082) (-335.263) [-334.516] -- 0:00:07
Average standard deviation of split frequencies: 0.006353
870500 -- (-334.179) (-338.624) (-340.063) [-336.377] * (-338.416) (-337.436) [-336.460] (-337.093) -- 0:00:07
871000 -- [-335.814] (-339.225) (-333.958) (-334.105) * (-335.349) (-336.499) [-335.353] (-338.219) -- 0:00:07
871500 -- (-335.047) (-339.130) [-339.445] (-336.269) * (-335.364) (-338.129) (-336.349) [-335.803] -- 0:00:07
872000 -- (-335.558) (-340.687) (-336.873) [-335.037] * (-335.766) (-335.828) (-336.228) [-335.001] -- 0:00:07
872500 -- [-335.223] (-335.383) (-337.841) (-334.684) * (-335.718) (-336.175) [-336.458] (-341.210) -- 0:00:07
873000 -- (-337.179) [-337.411] (-335.020) (-336.333) * [-339.319] (-336.642) (-339.244) (-336.365) -- 0:00:07
873500 -- (-335.125) (-337.414) (-336.017) [-336.834] * (-336.335) [-340.190] (-334.809) (-339.239) -- 0:00:07
874000 -- [-337.853] (-339.706) (-334.992) (-336.689) * (-335.811) (-339.324) (-334.891) [-335.274] -- 0:00:07
874500 -- (-336.340) (-335.392) (-334.832) [-338.729] * (-334.316) (-335.869) [-335.490] (-335.192) -- 0:00:07
875000 -- (-335.255) [-334.914] (-337.536) (-335.623) * (-337.803) [-336.200] (-337.236) (-335.527) -- 0:00:07
Average standard deviation of split frequencies: 0.006852
875500 -- [-337.119] (-339.879) (-337.146) (-336.518) * (-336.784) (-335.453) [-337.523] (-334.851) -- 0:00:07
876000 -- (-335.862) [-336.519] (-338.652) (-335.426) * (-334.939) (-336.237) (-335.160) [-337.061] -- 0:00:07
876500 -- (-336.206) [-334.363] (-338.432) (-335.682) * (-334.501) [-335.819] (-340.980) (-341.505) -- 0:00:07
877000 -- [-334.528] (-335.305) (-339.731) (-338.374) * (-337.462) (-337.855) [-339.792] (-343.957) -- 0:00:07
877500 -- [-334.857] (-337.474) (-335.362) (-336.927) * (-336.708) (-337.156) (-337.522) [-335.861] -- 0:00:07
878000 -- (-335.010) (-336.765) [-337.041] (-336.162) * (-335.878) (-334.925) [-340.224] (-338.693) -- 0:00:07
878500 -- (-334.939) (-338.857) [-335.624] (-335.359) * [-340.483] (-336.448) (-337.673) (-334.767) -- 0:00:07
879000 -- (-336.243) [-336.922] (-334.751) (-334.658) * (-337.270) (-341.693) [-336.368] (-338.822) -- 0:00:07
879500 -- (-340.121) (-335.202) (-337.286) [-334.631] * (-335.005) [-336.670] (-335.331) (-340.834) -- 0:00:07
880000 -- (-340.754) (-334.882) [-334.783] (-336.085) * (-335.391) [-336.919] (-336.842) (-337.896) -- 0:00:07
Average standard deviation of split frequencies: 0.006994
880500 -- (-339.762) (-335.325) [-336.078] (-334.652) * (-336.167) [-336.120] (-338.599) (-340.198) -- 0:00:07
881000 -- [-337.530] (-335.863) (-335.169) (-336.198) * (-334.984) (-341.180) (-334.698) [-338.452] -- 0:00:07
881500 -- (-338.371) [-335.936] (-336.829) (-336.153) * [-335.151] (-337.138) (-334.726) (-338.052) -- 0:00:06
882000 -- (-337.797) [-337.327] (-337.811) (-335.524) * [-335.589] (-338.372) (-335.087) (-335.629) -- 0:00:06
882500 -- (-337.038) (-338.130) [-336.841] (-337.309) * (-334.771) [-334.958] (-335.241) (-336.794) -- 0:00:06
883000 -- (-336.357) [-335.171] (-336.140) (-336.635) * [-337.228] (-339.527) (-334.113) (-335.990) -- 0:00:06
883500 -- [-336.843] (-335.246) (-337.476) (-337.171) * (-340.314) (-335.141) [-334.567] (-339.620) -- 0:00:06
884000 -- (-336.238) [-336.540] (-336.322) (-341.059) * (-338.544) [-335.452] (-335.228) (-335.301) -- 0:00:06
884500 -- (-335.476) (-338.704) [-338.214] (-337.024) * [-339.799] (-336.879) (-333.971) (-336.430) -- 0:00:06
885000 -- (-339.885) (-336.737) (-335.903) [-335.539] * (-337.911) [-334.189] (-335.896) (-335.396) -- 0:00:06
Average standard deviation of split frequencies: 0.006952
885500 -- [-336.852] (-334.456) (-338.003) (-336.830) * [-334.768] (-335.275) (-335.898) (-335.555) -- 0:00:06
886000 -- (-336.657) (-335.459) (-337.942) [-336.627] * [-334.209] (-335.684) (-335.960) (-336.370) -- 0:00:06
886500 -- (-334.153) (-335.716) (-337.475) [-341.805] * (-335.636) (-335.885) (-338.250) [-336.250] -- 0:00:06
887000 -- (-334.785) (-337.643) (-339.050) [-334.547] * (-334.976) (-337.792) [-335.192] (-334.992) -- 0:00:06
887500 -- (-338.046) (-335.240) (-334.785) [-336.712] * [-337.600] (-335.670) (-336.908) (-336.118) -- 0:00:06
888000 -- (-338.390) (-334.468) [-337.023] (-334.930) * (-337.643) (-333.999) [-335.104] (-334.642) -- 0:00:06
888500 -- [-335.168] (-336.191) (-338.717) (-335.523) * (-337.751) [-336.323] (-339.208) (-334.041) -- 0:00:06
889000 -- (-336.763) (-334.427) (-335.702) [-336.255] * (-338.779) (-336.305) (-336.121) [-335.314] -- 0:00:06
889500 -- [-335.302] (-337.309) (-336.513) (-337.375) * (-336.759) (-337.968) (-335.428) [-334.294] -- 0:00:06
890000 -- (-336.368) (-334.428) (-337.316) [-336.543] * (-336.196) [-335.426] (-336.483) (-341.285) -- 0:00:06
Average standard deviation of split frequencies: 0.007375
890500 -- [-338.723] (-335.444) (-334.228) (-335.581) * (-336.178) [-334.324] (-335.527) (-335.787) -- 0:00:06
891000 -- [-335.694] (-339.029) (-334.817) (-337.032) * (-336.445) [-339.775] (-335.903) (-337.250) -- 0:00:06
891500 -- (-340.087) (-334.044) [-335.742] (-335.078) * (-341.047) (-337.216) [-336.295] (-337.599) -- 0:00:06
892000 -- (-337.236) (-336.659) [-336.997] (-335.838) * (-335.249) [-336.835] (-335.933) (-337.169) -- 0:00:06
892500 -- (-340.725) (-341.672) (-337.985) [-335.550] * (-335.138) (-341.357) [-335.375] (-336.811) -- 0:00:06
893000 -- (-337.445) (-335.070) (-336.065) [-334.812] * (-337.227) (-336.347) [-338.864] (-334.652) -- 0:00:06
893500 -- [-335.323] (-335.426) (-341.473) (-336.077) * (-338.273) [-337.207] (-335.706) (-334.971) -- 0:00:06
894000 -- (-335.468) [-336.562] (-341.001) (-335.978) * (-335.314) (-335.392) [-336.069] (-335.087) -- 0:00:06
894500 -- (-334.411) [-337.038] (-335.233) (-335.080) * (-338.620) [-335.408] (-335.284) (-336.629) -- 0:00:06
895000 -- [-334.513] (-337.136) (-337.672) (-337.309) * [-338.067] (-338.493) (-336.009) (-335.398) -- 0:00:06
Average standard deviation of split frequencies: 0.007646
895500 -- (-335.227) (-336.363) (-337.427) [-334.448] * [-334.666] (-336.756) (-335.194) (-335.485) -- 0:00:06
896000 -- [-335.417] (-334.994) (-338.194) (-337.832) * [-336.154] (-337.070) (-336.976) (-339.002) -- 0:00:06
896500 -- [-335.645] (-337.257) (-341.733) (-335.220) * (-338.055) [-335.655] (-336.885) (-342.001) -- 0:00:06
897000 -- (-338.871) (-335.140) (-337.940) [-336.244] * [-334.463] (-335.530) (-335.392) (-340.237) -- 0:00:06
897500 -- (-338.373) (-334.825) [-337.290] (-334.869) * [-334.487] (-334.731) (-341.081) (-339.202) -- 0:00:06
898000 -- (-335.283) (-334.827) (-337.367) [-334.639] * [-334.437] (-334.530) (-335.091) (-341.108) -- 0:00:06
898500 -- (-336.283) (-334.616) (-341.995) [-335.489] * (-335.180) (-335.318) [-335.992] (-337.295) -- 0:00:05
899000 -- (-336.530) (-334.281) [-341.300] (-336.748) * (-334.372) (-338.776) [-336.539] (-335.940) -- 0:00:05
899500 -- (-335.754) (-339.142) (-342.515) [-336.712] * (-336.251) (-336.765) (-334.460) [-336.902] -- 0:00:05
900000 -- (-335.776) [-338.637] (-339.104) (-338.836) * (-336.460) (-334.331) (-334.238) [-334.528] -- 0:00:05
Average standard deviation of split frequencies: 0.007572
900500 -- [-334.817] (-334.194) (-336.852) (-338.412) * (-334.158) [-335.382] (-335.122) (-334.297) -- 0:00:05
901000 -- [-336.082] (-338.608) (-336.198) (-335.476) * [-334.551] (-337.811) (-334.124) (-336.126) -- 0:00:05
901500 -- [-340.577] (-338.053) (-340.917) (-335.830) * [-334.297] (-341.531) (-333.900) (-336.333) -- 0:00:05
902000 -- (-336.702) [-337.248] (-335.480) (-334.027) * (-336.518) [-338.789] (-336.644) (-335.475) -- 0:00:05
902500 -- [-334.576] (-337.033) (-335.412) (-334.522) * [-335.291] (-338.120) (-335.115) (-335.092) -- 0:00:05
903000 -- (-344.840) (-338.457) (-334.363) [-333.964] * (-338.623) [-336.022] (-335.215) (-334.441) -- 0:00:05
903500 -- (-335.371) (-339.787) (-336.099) [-333.885] * (-336.030) (-334.501) (-335.830) [-334.644] -- 0:00:05
904000 -- (-334.660) [-340.145] (-333.979) (-334.780) * (-343.251) (-337.999) [-336.855] (-334.713) -- 0:00:05
904500 -- (-335.051) (-339.277) (-336.071) [-337.306] * (-339.722) (-335.511) (-338.475) [-335.474] -- 0:00:05
905000 -- (-336.468) [-335.069] (-337.352) (-335.647) * (-337.522) (-333.903) [-336.670] (-335.232) -- 0:00:05
Average standard deviation of split frequencies: 0.007250
905500 -- (-335.134) [-334.798] (-338.608) (-337.221) * (-337.122) (-334.941) [-337.906] (-335.083) -- 0:00:05
906000 -- (-334.477) (-334.851) (-336.304) [-337.930] * [-338.982] (-335.983) (-335.588) (-336.366) -- 0:00:05
906500 -- (-340.726) (-335.775) [-338.356] (-335.940) * (-334.447) (-334.190) (-337.433) [-333.986] -- 0:00:05
907000 -- (-336.169) (-334.089) (-336.042) [-338.075] * (-336.356) [-335.011] (-337.296) (-335.439) -- 0:00:05
907500 -- (-336.356) (-339.516) [-335.541] (-337.625) * (-335.767) (-334.766) (-338.078) [-334.535] -- 0:00:05
908000 -- [-337.296] (-337.729) (-335.318) (-340.479) * (-334.569) (-334.702) [-336.374] (-336.517) -- 0:00:05
908500 -- [-336.142] (-343.710) (-334.509) (-340.292) * (-336.260) [-339.068] (-335.768) (-337.126) -- 0:00:05
909000 -- [-335.187] (-336.104) (-334.926) (-338.038) * (-336.400) (-335.355) [-334.244] (-334.141) -- 0:00:05
909500 -- (-336.662) [-334.936] (-337.643) (-338.375) * [-335.596] (-334.875) (-334.700) (-334.140) -- 0:00:05
910000 -- (-335.751) (-337.658) [-335.892] (-335.533) * [-335.192] (-336.679) (-338.136) (-335.115) -- 0:00:05
Average standard deviation of split frequencies: 0.007523
910500 -- [-337.448] (-338.061) (-334.853) (-334.528) * [-338.296] (-337.251) (-336.045) (-335.646) -- 0:00:05
911000 -- (-338.280) (-343.079) [-335.265] (-334.987) * (-335.855) (-335.579) (-337.570) [-336.681] -- 0:00:05
911500 -- (-337.141) (-334.434) [-338.454] (-337.345) * [-337.681] (-338.237) (-339.010) (-336.559) -- 0:00:05
912000 -- (-335.659) (-335.212) [-335.304] (-335.273) * (-334.014) (-336.117) [-335.505] (-336.248) -- 0:00:05
912500 -- [-336.129] (-335.801) (-334.866) (-338.907) * (-335.936) (-338.727) [-334.958] (-335.587) -- 0:00:05
913000 -- (-337.408) (-334.504) [-334.877] (-335.756) * (-335.816) (-334.162) [-335.758] (-335.061) -- 0:00:05
913500 -- (-334.408) (-334.577) (-336.724) [-337.046] * (-338.821) (-334.739) (-338.424) [-335.722] -- 0:00:05
914000 -- [-334.850] (-335.721) (-336.591) (-338.196) * (-338.287) [-334.936] (-342.526) (-338.248) -- 0:00:05
914500 -- [-334.846] (-335.202) (-339.354) (-335.492) * (-345.070) (-335.643) (-339.432) [-334.420] -- 0:00:05
915000 -- (-337.265) (-334.665) (-338.416) [-334.786] * (-339.375) (-337.274) (-337.113) [-339.196] -- 0:00:05
Average standard deviation of split frequencies: 0.007411
915500 -- (-334.657) [-335.156] (-337.695) (-335.980) * (-338.564) (-337.982) [-339.039] (-335.287) -- 0:00:04
916000 -- (-335.803) (-335.608) (-337.253) [-335.076] * (-335.126) [-335.667] (-336.250) (-335.859) -- 0:00:04
916500 -- (-334.079) (-334.866) (-340.417) [-334.255] * (-335.157) (-337.671) (-336.334) [-336.773] -- 0:00:04
917000 -- (-334.140) (-337.866) (-334.935) [-336.612] * [-334.903] (-336.229) (-334.089) (-334.831) -- 0:00:04
917500 -- (-336.017) [-336.667] (-338.525) (-336.614) * [-335.588] (-336.612) (-334.473) (-335.506) -- 0:00:04
918000 -- (-336.035) (-335.422) (-340.076) [-336.305] * (-335.061) [-335.609] (-334.864) (-344.434) -- 0:00:04
918500 -- [-334.976] (-335.961) (-338.238) (-335.530) * (-337.943) (-336.748) (-334.143) [-334.819] -- 0:00:04
919000 -- (-335.353) (-334.286) [-336.524] (-336.571) * (-337.052) [-339.800] (-334.842) (-336.063) -- 0:00:04
919500 -- (-335.752) (-337.026) [-336.338] (-336.714) * (-334.531) (-337.413) [-335.031] (-336.022) -- 0:00:04
920000 -- (-342.784) [-334.426] (-334.716) (-335.145) * (-335.122) (-335.833) (-337.231) [-334.521] -- 0:00:04
Average standard deviation of split frequencies: 0.007441
920500 -- (-340.320) (-336.446) [-334.421] (-336.708) * (-335.795) [-338.117] (-336.484) (-335.227) -- 0:00:04
921000 -- (-340.363) (-336.059) (-336.991) [-334.593] * [-337.662] (-334.539) (-336.914) (-334.549) -- 0:00:04
921500 -- (-343.039) [-335.061] (-336.510) (-335.241) * (-335.533) (-334.826) [-335.168] (-338.743) -- 0:00:04
922000 -- (-341.090) (-336.296) [-335.864] (-337.427) * [-336.729] (-335.718) (-335.525) (-336.755) -- 0:00:04
922500 -- (-334.967) (-335.647) [-336.503] (-337.041) * (-338.152) (-337.593) (-336.666) [-335.957] -- 0:00:04
923000 -- (-336.022) [-336.531] (-338.275) (-336.934) * (-339.330) (-337.131) (-337.542) [-335.575] -- 0:00:04
923500 -- (-336.747) [-336.438] (-335.549) (-335.583) * (-340.838) [-341.655] (-338.070) (-334.748) -- 0:00:04
924000 -- (-339.556) (-335.872) (-334.329) [-335.980] * (-344.554) (-338.518) [-335.494] (-334.634) -- 0:00:04
924500 -- (-336.113) (-336.972) [-335.748] (-335.871) * [-336.108] (-335.437) (-335.514) (-334.330) -- 0:00:04
925000 -- (-335.171) (-334.215) [-335.389] (-336.443) * (-337.636) (-334.951) (-334.958) [-335.668] -- 0:00:04
Average standard deviation of split frequencies: 0.007059
925500 -- (-334.793) (-338.313) [-336.664] (-340.172) * (-337.425) (-335.537) [-334.752] (-338.686) -- 0:00:04
926000 -- (-336.595) (-339.671) (-337.963) [-336.719] * [-336.557] (-335.729) (-336.311) (-341.015) -- 0:00:04
926500 -- [-336.620] (-339.358) (-337.336) (-335.632) * (-336.496) [-334.754] (-341.196) (-334.583) -- 0:00:04
927000 -- (-336.185) (-334.974) (-335.054) [-335.268] * (-335.543) (-335.163) [-338.278] (-335.080) -- 0:00:04
927500 -- (-335.377) [-334.367] (-335.088) (-336.317) * [-334.998] (-340.773) (-335.009) (-336.787) -- 0:00:04
928000 -- (-338.399) (-338.228) [-335.024] (-335.393) * [-335.701] (-336.601) (-336.887) (-335.219) -- 0:00:04
928500 -- (-336.557) (-334.083) [-338.894] (-336.166) * [-341.774] (-336.559) (-336.670) (-335.660) -- 0:00:04
929000 -- (-337.025) (-336.901) [-335.032] (-339.809) * (-337.127) [-334.252] (-334.892) (-336.720) -- 0:00:04
929500 -- (-334.980) (-334.340) [-335.453] (-340.918) * [-337.885] (-335.529) (-336.053) (-336.751) -- 0:00:04
930000 -- (-339.491) [-334.422] (-335.740) (-336.489) * (-337.844) [-337.316] (-338.086) (-335.676) -- 0:00:04
Average standard deviation of split frequencies: 0.006720
930500 -- (-334.332) [-338.049] (-337.778) (-334.708) * (-334.395) (-334.085) [-343.079] (-335.305) -- 0:00:04
931000 -- [-334.343] (-337.555) (-337.100) (-334.533) * (-342.069) (-334.315) [-340.391] (-340.278) -- 0:00:04
931500 -- (-339.076) (-336.427) [-337.422] (-334.678) * (-338.510) [-334.157] (-335.326) (-336.057) -- 0:00:04
932000 -- [-336.764] (-335.282) (-335.286) (-336.594) * (-335.940) (-338.367) [-335.031] (-334.667) -- 0:00:04
932500 -- (-341.376) (-335.929) [-335.500] (-337.077) * (-338.290) (-334.423) (-336.703) [-335.544] -- 0:00:03
933000 -- [-340.442] (-333.956) (-335.364) (-339.266) * (-334.904) (-335.029) (-338.504) [-338.314] -- 0:00:03
933500 -- (-338.570) [-339.351] (-335.888) (-335.967) * (-338.771) (-334.052) [-334.511] (-336.359) -- 0:00:03
934000 -- (-336.767) [-335.663] (-337.132) (-335.811) * [-335.196] (-334.763) (-335.592) (-334.727) -- 0:00:03
934500 -- (-338.140) (-335.884) [-335.875] (-337.099) * [-335.204] (-334.816) (-336.160) (-334.125) -- 0:00:03
935000 -- (-336.605) (-336.022) (-335.756) [-334.882] * (-336.489) (-335.632) (-335.678) [-336.124] -- 0:00:03
Average standard deviation of split frequencies: 0.006547
935500 -- [-338.189] (-338.119) (-335.247) (-335.448) * (-338.390) (-335.159) (-335.862) [-336.538] -- 0:00:03
936000 -- (-340.919) [-338.917] (-339.405) (-335.314) * (-335.953) (-335.141) (-333.994) [-334.099] -- 0:00:03
936500 -- [-337.455] (-338.484) (-333.970) (-337.137) * (-340.466) (-337.176) (-333.976) [-337.007] -- 0:00:03
937000 -- (-335.546) [-336.925] (-334.979) (-335.049) * (-342.705) (-337.184) [-334.550] (-338.399) -- 0:00:03
937500 -- [-335.625] (-334.333) (-334.838) (-337.894) * (-336.162) (-340.988) [-335.614] (-340.733) -- 0:00:03
938000 -- (-335.844) [-334.150] (-334.492) (-334.826) * (-337.096) (-339.772) [-336.139] (-335.105) -- 0:00:03
938500 -- (-335.516) (-337.878) (-336.010) [-334.444] * (-338.264) (-337.119) (-334.793) [-336.349] -- 0:00:03
939000 -- (-336.043) (-335.816) [-335.045] (-333.949) * (-335.764) [-337.648] (-334.815) (-336.810) -- 0:00:03
939500 -- [-335.763] (-338.753) (-335.221) (-338.106) * [-335.594] (-335.812) (-334.457) (-335.829) -- 0:00:03
940000 -- (-334.607) (-336.600) (-338.106) [-337.607] * (-336.781) (-337.612) (-339.598) [-336.513] -- 0:00:03
Average standard deviation of split frequencies: 0.006014
940500 -- [-334.027] (-335.523) (-334.754) (-335.776) * (-337.426) (-335.255) [-336.267] (-336.726) -- 0:00:03
941000 -- (-334.335) (-335.404) [-335.683] (-334.654) * (-341.157) [-335.622] (-336.122) (-336.796) -- 0:00:03
941500 -- (-337.220) (-335.090) [-335.111] (-335.303) * (-335.231) (-337.213) [-339.388] (-335.279) -- 0:00:03
942000 -- (-334.707) (-336.619) (-336.458) [-336.408] * [-334.929] (-338.525) (-336.911) (-335.970) -- 0:00:03
942500 -- (-336.222) [-336.708] (-335.692) (-335.471) * (-339.121) (-340.028) (-335.064) [-334.166] -- 0:00:03
943000 -- (-336.873) (-335.904) (-339.814) [-337.277] * (-338.287) [-336.947] (-337.228) (-337.679) -- 0:00:03
943500 -- (-339.602) (-337.006) [-341.118] (-338.057) * (-336.154) [-335.605] (-334.111) (-333.998) -- 0:00:03
944000 -- (-334.176) (-335.780) (-334.748) [-337.212] * (-335.925) (-335.471) [-334.504] (-334.140) -- 0:00:03
944500 -- [-334.821] (-334.332) (-334.429) (-336.445) * (-336.526) (-337.383) (-334.976) [-335.278] -- 0:00:03
945000 -- (-334.551) (-334.756) (-335.445) [-336.508] * (-335.082) [-336.899] (-336.888) (-335.909) -- 0:00:03
Average standard deviation of split frequencies: 0.006212
945500 -- (-338.551) (-334.713) [-335.445] (-337.532) * (-335.157) (-334.562) [-337.923] (-337.256) -- 0:00:03
946000 -- (-337.917) (-336.622) [-333.976] (-339.856) * (-336.009) (-334.827) [-334.962] (-336.550) -- 0:00:03
946500 -- (-334.840) [-337.178] (-337.861) (-336.389) * (-341.343) (-337.250) (-334.529) [-338.163] -- 0:00:03
947000 -- (-336.441) [-335.224] (-335.583) (-338.119) * (-338.011) [-338.544] (-335.338) (-334.767) -- 0:00:03
947500 -- [-334.775] (-338.480) (-335.428) (-334.440) * [-336.704] (-337.866) (-336.989) (-336.607) -- 0:00:03
948000 -- (-334.666) (-336.372) [-338.245] (-334.363) * (-337.268) (-335.103) [-335.677] (-336.221) -- 0:00:03
948500 -- [-336.859] (-338.264) (-341.172) (-340.031) * (-342.081) (-334.753) [-337.193] (-336.165) -- 0:00:03
949000 -- (-335.600) (-334.768) (-336.683) [-334.397] * (-335.309) [-334.720] (-336.750) (-336.956) -- 0:00:03
949500 -- [-336.362] (-334.768) (-337.232) (-334.946) * (-337.368) (-335.192) (-337.903) [-336.167] -- 0:00:02
950000 -- (-336.442) (-335.736) (-336.010) [-336.356] * (-335.911) [-335.446] (-337.634) (-336.881) -- 0:00:02
Average standard deviation of split frequencies: 0.006149
950500 -- (-337.070) (-339.224) [-335.708] (-337.746) * (-335.832) [-338.029] (-337.490) (-335.730) -- 0:00:02
951000 -- (-336.301) (-341.881) (-335.564) [-336.203] * (-337.445) [-334.818] (-334.804) (-336.941) -- 0:00:02
951500 -- (-338.913) (-338.176) [-335.863] (-335.713) * (-334.971) [-336.365] (-334.798) (-336.977) -- 0:00:02
952000 -- (-336.125) [-335.312] (-338.692) (-335.406) * (-339.880) [-335.779] (-334.937) (-336.707) -- 0:00:02
952500 -- (-334.815) [-335.589] (-337.671) (-334.809) * (-338.833) (-336.573) (-335.580) [-335.182] -- 0:00:02
953000 -- (-335.539) (-335.077) [-336.690] (-335.217) * (-336.881) (-337.879) [-335.074] (-339.927) -- 0:00:02
953500 -- [-337.946] (-334.433) (-335.613) (-335.160) * (-338.839) (-335.852) [-334.234] (-335.145) -- 0:00:02
954000 -- [-340.486] (-338.465) (-337.820) (-335.327) * (-334.893) (-335.913) [-335.897] (-336.465) -- 0:00:02
954500 -- [-335.921] (-339.213) (-339.802) (-334.391) * (-335.404) (-335.690) (-334.870) [-335.924] -- 0:00:02
955000 -- (-336.340) [-336.078] (-341.021) (-339.094) * (-339.133) (-336.651) [-335.555] (-336.653) -- 0:00:02
Average standard deviation of split frequencies: 0.006246
955500 -- (-335.294) [-334.405] (-337.480) (-334.618) * (-339.801) (-336.599) (-335.573) [-334.466] -- 0:00:02
956000 -- [-335.587] (-336.320) (-336.109) (-336.512) * (-335.988) (-335.364) [-337.240] (-334.451) -- 0:00:02
956500 -- (-335.350) [-335.351] (-336.937) (-338.901) * (-335.560) (-337.154) (-338.468) [-335.728] -- 0:00:02
957000 -- (-334.756) [-336.838] (-334.780) (-334.632) * [-336.865] (-344.381) (-338.436) (-337.737) -- 0:00:02
957500 -- (-335.210) [-335.171] (-334.762) (-334.154) * (-335.980) (-336.822) [-335.254] (-335.506) -- 0:00:02
958000 -- (-334.963) (-335.567) (-336.483) [-335.996] * (-334.958) (-334.553) [-334.329] (-339.307) -- 0:00:02
958500 -- (-338.700) (-338.530) [-338.293] (-335.428) * (-336.809) (-335.701) (-334.817) [-334.378] -- 0:00:02
959000 -- (-335.816) (-333.861) [-339.383] (-334.122) * (-334.338) (-336.248) [-334.580] (-334.371) -- 0:00:02
959500 -- (-335.599) (-335.146) [-335.814] (-339.540) * (-334.908) (-338.315) [-334.627] (-338.342) -- 0:00:02
960000 -- (-336.769) [-334.910] (-337.822) (-337.189) * (-334.529) [-337.516] (-335.239) (-345.264) -- 0:00:02
Average standard deviation of split frequencies: 0.006510
960500 -- (-338.800) (-335.647) (-336.531) [-335.445] * [-337.015] (-337.977) (-334.836) (-335.698) -- 0:00:02
961000 -- [-338.151] (-336.907) (-338.094) (-334.514) * (-335.596) (-337.162) [-337.029] (-334.174) -- 0:00:02
961500 -- (-335.144) (-335.796) (-334.891) [-335.361] * (-334.798) (-335.498) (-334.644) [-335.766] -- 0:00:02
962000 -- (-335.130) (-336.313) [-335.181] (-336.116) * (-338.371) (-335.099) [-335.603] (-335.930) -- 0:00:02
962500 -- (-338.669) [-334.832] (-336.890) (-335.822) * (-337.936) (-335.200) [-335.099] (-338.203) -- 0:00:02
963000 -- (-336.578) (-335.201) [-339.005] (-334.833) * [-337.288] (-337.416) (-335.476) (-339.684) -- 0:00:02
963500 -- (-338.909) (-335.858) (-338.374) [-334.830] * (-336.359) (-334.475) (-336.196) [-334.786] -- 0:00:02
964000 -- (-337.556) (-336.377) [-334.985] (-336.446) * (-334.475) (-338.492) (-336.229) [-335.084] -- 0:00:02
964500 -- (-336.425) [-334.896] (-338.467) (-335.280) * (-334.420) [-335.012] (-338.182) (-335.408) -- 0:00:02
965000 -- (-336.356) (-337.027) (-339.114) [-336.247] * (-335.895) (-336.139) (-337.079) [-337.831] -- 0:00:02
Average standard deviation of split frequencies: 0.006214
965500 -- (-335.298) (-337.576) (-340.081) [-336.584] * (-336.405) (-336.308) [-337.217] (-343.755) -- 0:00:02
966000 -- (-335.763) (-339.462) (-337.364) [-335.468] * (-335.014) (-337.755) [-334.501] (-340.476) -- 0:00:02
966500 -- (-335.414) (-334.497) [-336.561] (-339.953) * (-336.018) (-334.285) (-334.922) [-337.241] -- 0:00:01
967000 -- (-335.720) (-337.253) [-335.990] (-335.483) * [-334.700] (-333.902) (-338.172) (-335.489) -- 0:00:01
967500 -- (-336.510) (-336.067) [-337.415] (-334.765) * (-335.232) [-339.027] (-338.154) (-335.203) -- 0:00:01
968000 -- (-337.889) [-336.035] (-334.382) (-341.174) * [-339.331] (-340.106) (-337.047) (-338.689) -- 0:00:01
968500 -- (-336.260) [-336.292] (-336.399) (-340.711) * (-342.260) (-339.220) (-337.250) [-335.749] -- 0:00:01
969000 -- (-335.452) [-335.636] (-335.355) (-336.602) * [-334.141] (-337.121) (-336.131) (-336.857) -- 0:00:01
969500 -- (-337.302) [-335.503] (-338.857) (-337.973) * (-335.204) [-335.371] (-337.110) (-336.425) -- 0:00:01
970000 -- (-335.773) (-336.192) (-335.633) [-334.968] * (-336.794) [-335.586] (-334.417) (-338.305) -- 0:00:01
Average standard deviation of split frequencies: 0.006313
970500 -- (-340.630) (-337.883) (-335.336) [-335.742] * (-336.723) (-339.254) [-335.157] (-338.862) -- 0:00:01
971000 -- (-335.136) [-337.941] (-334.572) (-336.560) * (-334.937) (-335.645) (-338.642) [-337.971] -- 0:00:01
971500 -- (-335.070) (-338.381) [-334.005] (-336.616) * (-337.805) [-334.471] (-338.708) (-336.525) -- 0:00:01
972000 -- (-335.004) (-334.815) [-335.361] (-340.721) * (-335.444) (-339.148) (-336.399) [-334.505] -- 0:00:01
972500 -- (-335.056) [-335.037] (-334.499) (-338.266) * (-334.163) (-338.274) [-337.807] (-337.905) -- 0:00:01
973000 -- (-336.018) (-337.299) [-334.846] (-336.069) * [-335.001] (-337.571) (-336.777) (-334.758) -- 0:00:01
973500 -- (-336.865) (-334.972) (-339.563) [-334.441] * (-335.221) [-335.104] (-336.845) (-335.663) -- 0:00:01
974000 -- (-335.950) (-335.501) [-335.485] (-336.918) * (-336.395) [-343.052] (-337.440) (-335.037) -- 0:00:01
974500 -- (-339.210) (-335.611) [-338.148] (-334.334) * (-335.442) [-334.801] (-339.080) (-336.866) -- 0:00:01
975000 -- [-334.141] (-337.539) (-335.217) (-336.605) * [-335.326] (-334.983) (-337.387) (-335.523) -- 0:00:01
Average standard deviation of split frequencies: 0.006698
975500 -- [-335.506] (-337.166) (-339.190) (-334.551) * [-336.161] (-335.475) (-334.987) (-334.132) -- 0:00:01
976000 -- (-335.743) (-335.175) [-336.607] (-335.090) * [-336.055] (-336.861) (-335.314) (-334.648) -- 0:00:01
976500 -- (-337.542) (-336.855) (-341.604) [-338.216] * (-334.791) (-338.433) (-334.859) [-335.434] -- 0:00:01
977000 -- (-339.630) [-335.323] (-339.325) (-336.764) * (-335.409) [-336.847] (-337.188) (-336.841) -- 0:00:01
977500 -- [-335.286] (-335.420) (-335.378) (-335.574) * (-334.986) [-335.672] (-334.756) (-338.761) -- 0:00:01
978000 -- (-335.829) (-335.024) [-335.624] (-340.528) * (-335.744) [-336.587] (-336.496) (-334.640) -- 0:00:01
978500 -- (-334.614) (-336.114) [-340.382] (-336.216) * (-336.246) (-338.702) (-334.955) [-335.837] -- 0:00:01
979000 -- (-337.357) [-335.919] (-336.273) (-336.982) * (-338.227) (-334.580) [-334.683] (-340.308) -- 0:00:01
979500 -- (-337.159) [-336.422] (-334.980) (-335.062) * (-335.871) [-335.126] (-338.611) (-338.290) -- 0:00:01
980000 -- (-334.681) (-340.027) (-335.013) [-334.862] * (-336.589) (-334.962) [-339.041] (-335.909) -- 0:00:01
Average standard deviation of split frequencies: 0.006570
980500 -- (-335.246) (-335.656) [-335.941] (-336.031) * (-337.259) (-336.112) (-335.874) [-335.796] -- 0:00:01
981000 -- (-334.939) [-336.105] (-335.470) (-337.322) * (-335.165) (-337.788) [-335.420] (-337.202) -- 0:00:01
981500 -- (-338.202) (-334.635) [-335.129] (-340.067) * [-334.878] (-335.337) (-337.335) (-336.452) -- 0:00:01
982000 -- (-335.493) (-335.030) (-334.933) [-341.534] * [-335.020] (-338.073) (-340.486) (-338.552) -- 0:00:01
982500 -- (-335.122) (-335.393) (-335.260) [-335.414] * (-338.208) (-336.978) (-340.153) [-337.663] -- 0:00:01
983000 -- [-337.970] (-335.170) (-334.586) (-336.985) * [-338.398] (-337.017) (-334.981) (-340.305) -- 0:00:01
983500 -- [-336.272] (-337.453) (-335.299) (-340.606) * (-337.980) (-341.211) [-334.963] (-341.505) -- 0:00:00
984000 -- (-335.133) [-339.353] (-336.853) (-338.389) * (-337.636) (-335.630) (-335.962) [-336.599] -- 0:00:00
984500 -- (-336.951) (-339.628) [-336.076] (-335.378) * (-343.315) (-336.905) (-334.741) [-337.917] -- 0:00:00
985000 -- (-335.777) (-340.738) [-335.542] (-339.970) * (-335.568) (-338.254) [-337.049] (-337.824) -- 0:00:00
Average standard deviation of split frequencies: 0.006407
985500 -- (-335.314) (-334.047) [-336.816] (-334.336) * [-338.503] (-335.307) (-337.394) (-338.487) -- 0:00:00
986000 -- (-334.503) (-336.237) [-336.100] (-337.339) * (-336.401) (-334.402) [-336.704] (-334.349) -- 0:00:00
986500 -- [-336.573] (-337.638) (-334.456) (-335.928) * (-336.138) (-335.428) [-335.684] (-334.705) -- 0:00:00
987000 -- (-334.704) [-337.227] (-335.610) (-338.066) * (-334.672) (-334.612) [-338.776] (-336.507) -- 0:00:00
987500 -- (-336.511) (-334.567) [-335.639] (-334.510) * (-335.226) (-336.423) (-335.599) [-335.009] -- 0:00:00
988000 -- (-338.247) [-333.921] (-336.887) (-334.963) * (-335.938) (-341.271) [-336.037] (-334.586) -- 0:00:00
988500 -- (-336.631) [-337.066] (-340.611) (-335.757) * (-337.990) (-337.340) (-335.235) [-337.425] -- 0:00:00
989000 -- (-334.076) (-335.531) [-338.636] (-336.207) * (-340.255) (-336.134) [-334.414] (-340.668) -- 0:00:00
989500 -- [-335.908] (-334.801) (-334.658) (-334.214) * (-338.080) (-334.694) [-335.331] (-341.043) -- 0:00:00
990000 -- (-334.875) (-336.414) (-335.887) [-335.744] * (-340.584) (-339.914) [-335.336] (-338.715) -- 0:00:00
Average standard deviation of split frequencies: 0.006313
990500 -- [-334.693] (-334.560) (-337.453) (-335.934) * (-339.405) (-337.173) (-335.282) [-336.879] -- 0:00:00
991000 -- (-338.630) (-341.919) [-339.489] (-335.183) * (-345.123) (-336.084) (-334.936) [-335.231] -- 0:00:00
991500 -- (-339.997) (-339.025) [-334.654] (-337.249) * (-337.626) [-334.637] (-337.483) (-334.196) -- 0:00:00
992000 -- (-335.655) (-338.595) [-336.653] (-338.067) * (-333.787) [-334.423] (-335.218) (-336.220) -- 0:00:00
992500 -- [-333.985] (-338.450) (-335.770) (-337.606) * [-333.790] (-334.182) (-335.994) (-338.935) -- 0:00:00
993000 -- [-337.645] (-336.582) (-336.339) (-336.190) * (-336.425) (-334.320) [-335.095] (-337.652) -- 0:00:00
993500 -- (-337.753) (-338.554) [-337.203] (-341.271) * [-342.540] (-335.052) (-335.083) (-338.456) -- 0:00:00
994000 -- [-337.313] (-339.365) (-336.363) (-336.295) * (-344.213) (-335.830) [-334.230] (-340.409) -- 0:00:00
994500 -- (-338.085) (-338.497) (-336.222) [-337.194] * (-338.281) (-344.897) [-336.714] (-335.970) -- 0:00:00
995000 -- [-336.357] (-337.686) (-335.937) (-336.898) * (-334.751) (-339.713) (-335.478) [-334.428] -- 0:00:00
Average standard deviation of split frequencies: 0.006311
995500 -- (-334.594) (-335.803) [-336.064] (-339.393) * [-335.323] (-334.612) (-334.858) (-335.376) -- 0:00:00
996000 -- (-336.417) (-335.719) [-336.877] (-336.338) * (-334.882) [-336.101] (-334.485) (-337.301) -- 0:00:00
996500 -- (-336.231) (-338.067) (-336.978) [-338.095] * [-335.047] (-335.653) (-334.183) (-337.675) -- 0:00:00
997000 -- (-342.055) [-336.963] (-335.090) (-335.381) * (-335.392) (-336.804) [-334.539] (-336.601) -- 0:00:00
997500 -- [-335.137] (-337.767) (-335.979) (-336.636) * (-335.167) [-335.491] (-334.894) (-337.807) -- 0:00:00
998000 -- (-335.191) [-342.248] (-336.330) (-337.235) * (-334.191) (-336.416) (-342.480) [-337.077] -- 0:00:00
998500 -- (-334.918) (-338.444) [-335.858] (-337.184) * (-335.038) [-335.448] (-335.267) (-334.223) -- 0:00:00
999000 -- [-336.469] (-335.543) (-335.087) (-338.051) * (-336.906) [-336.439] (-337.269) (-335.803) -- 0:00:00
999500 -- [-334.857] (-338.708) (-336.817) (-336.185) * (-338.390) (-336.293) (-338.080) [-334.357] -- 0:00:00
1000000 -- [-334.922] (-336.184) (-335.763) (-334.749) * [-334.816] (-335.297) (-336.955) (-336.242) -- 0:00:00
Average standard deviation of split frequencies: 0.006627
Analysis completed in 59 seconds
Analysis used 57.39 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -333.74
Likelihood of best state for "cold" chain of run 2 was -333.74
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
43.0 % ( 34 %) Dirichlet(Pi{all})
41.1 % ( 25 %) Slider(Pi{all})
78.9 % ( 45 %) Multiplier(Alpha{1,2})
77.0 % ( 51 %) Multiplier(Alpha{3})
26.3 % ( 17 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
43.4 % ( 21 %) Dirichlet(Pi{all})
40.6 % ( 22 %) Slider(Pi{all})
78.7 % ( 56 %) Multiplier(Alpha{1,2})
77.9 % ( 38 %) Multiplier(Alpha{3})
27.0 % ( 18 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166153 0.82 0.67
3 | 167230 166646 0.84
4 | 166960 166711 166300
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166406 0.82 0.67
3 | 167188 166779 0.84
4 | 166177 166718 166732
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -335.42
| 1 1 1 |
| 2 12 2 2 2 1 2 2 2|
| 12 1 1 1 1 2 1 1 |
| 11 1 * 11 2 121 1 *2 1 11 * * 22 1 |
| 221 2 *1 221 2 21 222 12 2122 2 11 212 |
|*1 22 2 1 2 11 1 * 1 1 2 22 2 |
| 1 2 21 22 2 2 2 1 1 11|
| 2 112 2 2 2 |
| 1 2 1 1 1 |
| |
| |
| |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -338.12
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -335.47 -338.84
2 -335.47 -338.64
--------------------------------------
TOTAL -335.47 -338.75
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890745 0.088624 0.362279 1.461502 0.853113 1303.60 1402.30 1.000
r(A<->C){all} 0.170828 0.019717 0.000032 0.448799 0.135666 178.95 217.36 1.002
r(A<->G){all} 0.165598 0.020791 0.000051 0.464564 0.123036 159.63 206.90 1.002
r(A<->T){all} 0.159913 0.019150 0.000012 0.449125 0.123841 220.59 237.67 1.000
r(C<->G){all} 0.164214 0.019365 0.000061 0.443237 0.129383 217.59 223.00 1.002
r(C<->T){all} 0.168353 0.021172 0.000013 0.461217 0.132667 220.92 232.00 1.000
r(G<->T){all} 0.171093 0.020645 0.000056 0.463406 0.136720 171.21 208.60 1.002
pi(A){all} 0.194863 0.000629 0.147375 0.243571 0.194013 695.47 1098.23 1.000
pi(C){all} 0.264487 0.000761 0.210453 0.318323 0.264092 1219.35 1313.66 1.000
pi(G){all} 0.344294 0.000858 0.287954 0.402189 0.343767 1495.09 1498.05 1.000
pi(T){all} 0.196356 0.000621 0.150602 0.249390 0.195367 1465.70 1483.35 1.000
alpha{1,2} 0.410390 0.208659 0.000225 1.339720 0.252776 1159.89 1330.45 1.000
alpha{3} 0.457757 0.242920 0.000210 1.419612 0.300507 1163.39 1226.39 1.000
pinvar{all} 0.993110 0.000074 0.977593 0.999992 0.995784 982.06 1204.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .****.
9 -- ..**..
10 -- .*.*..
11 -- .*.***
12 -- ....**
13 -- .***.*
14 -- ...**.
15 -- .**.**
16 -- .**...
17 -- ..****
18 -- ..*..*
19 -- ..*.*.
20 -- .*..*.
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.005653 0.146569 0.154564 2
8 445 0.148235 0.008009 0.142572 0.153897 2
9 443 0.147568 0.000471 0.147235 0.147901 2
10 442 0.147235 0.022612 0.131246 0.163225 2
11 436 0.145237 0.002827 0.143238 0.147235 2
12 430 0.143238 0.004711 0.139907 0.146569 2
13 429 0.142905 0.008951 0.136576 0.149234 2
14 427 0.142239 0.001413 0.141239 0.143238 2
15 427 0.142239 0.010835 0.134577 0.149900 2
16 425 0.141572 0.002355 0.139907 0.143238 2
17 425 0.141572 0.010835 0.133911 0.149234 2
18 424 0.141239 0.011306 0.133245 0.149234 2
19 423 0.140906 0.003298 0.138574 0.143238 2
20 416 0.138574 0.000942 0.137908 0.139241 2
21 393 0.130913 0.005182 0.127249 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099738 0.009323 0.000005 0.283415 0.071074 1.000 2
length{all}[2] 0.097934 0.009729 0.000028 0.285817 0.068780 1.000 2
length{all}[3] 0.100207 0.009714 0.000043 0.287820 0.070707 1.000 2
length{all}[4] 0.099407 0.009830 0.000000 0.299576 0.067833 1.000 2
length{all}[5] 0.099561 0.010405 0.000079 0.301564 0.068937 1.000 2
length{all}[6] 0.096099 0.008999 0.000006 0.291460 0.067082 1.001 2
length{all}[7] 0.101638 0.008532 0.000528 0.295858 0.071806 0.999 2
length{all}[8] 0.105542 0.011290 0.000155 0.314477 0.069798 0.999 2
length{all}[9] 0.097889 0.009245 0.000588 0.287958 0.067656 0.998 2
length{all}[10] 0.096431 0.010299 0.000075 0.268813 0.069007 1.012 2
length{all}[11] 0.094158 0.009545 0.000169 0.284880 0.060061 0.998 2
length{all}[12] 0.107080 0.012065 0.000033 0.318203 0.072619 0.999 2
length{all}[13] 0.090585 0.008551 0.000112 0.274750 0.061788 0.999 2
length{all}[14] 0.106985 0.010405 0.000057 0.295575 0.069670 0.998 2
length{all}[15] 0.094230 0.008930 0.000270 0.262042 0.070458 0.998 2
length{all}[16] 0.101457 0.010385 0.000113 0.305291 0.072557 0.998 2
length{all}[17] 0.092313 0.008836 0.000129 0.265440 0.066655 0.998 2
length{all}[18] 0.099659 0.008346 0.000159 0.274577 0.075265 0.999 2
length{all}[19] 0.103184 0.010299 0.000001 0.300340 0.070891 0.999 2
length{all}[20] 0.096067 0.010328 0.000020 0.306584 0.062577 0.998 2
length{all}[21] 0.094494 0.009573 0.000026 0.296038 0.066399 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006627
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 47 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 246
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 40 patterns at 82 / 82 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 40 patterns at 82 / 82 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
39040 bytes for conP
3520 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107278 0.075052 0.077093 0.050888 0.029104 0.072322 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -354.185686
Iterating by ming2
Initial: fx= 354.185686
x= 0.10728 0.07505 0.07709 0.05089 0.02910 0.07232 0.30000 1.30000
1 h-m-p 0.0000 0.0004 197.5180 +++ 340.172813 m 0.0004 14 | 1/8
2 h-m-p 0.0021 0.0429 31.1902 ------------.. | 1/8
3 h-m-p 0.0000 0.0003 181.0212 +++ 331.331471 m 0.0003 47 | 2/8
4 h-m-p 0.0016 0.0502 26.7490 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 162.3754 +++ 324.304341 m 0.0003 79 | 3/8
6 h-m-p 0.0017 0.0614 22.3819 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 141.0927 ++ 323.629296 m 0.0000 110 | 4/8
8 h-m-p 0.0002 0.0809 17.4178 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 115.1370 ++ 323.293132 m 0.0000 140 | 5/8
10 h-m-p 0.0002 0.1221 11.5978 ----------.. | 5/8
11 h-m-p 0.0000 0.0004 81.2139 +++ 320.798816 m 0.0004 171 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 320.798816 m 8.0000 182 | 6/8
13 h-m-p 0.2857 8.0000 0.0001 ----Y 320.798816 0 0.0003 199 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798816 m 8.0000 215 | 6/8
15 h-m-p 0.0160 8.0000 0.0480 +++++ 320.798815 m 8.0000 231 | 6/8
16 h-m-p 0.0236 0.1178 5.8778 -----------C 320.798815 0 0.0000 255 | 6/8
17 h-m-p 0.0336 8.0000 0.0000 ---Y 320.798815 0 0.0001 269 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 ----N 320.798815 0 0.0000 286
Out..
lnL = -320.798815
287 lfun, 287 eigenQcodon, 1722 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103123 0.099296 0.092340 0.063650 0.092756 0.105910 0.674054 0.553683 0.387048
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.243444
np = 9
lnL0 = -364.139034
Iterating by ming2
Initial: fx= 364.139034
x= 0.10312 0.09930 0.09234 0.06365 0.09276 0.10591 0.67405 0.55368 0.38705
1 h-m-p 0.0000 0.0008 183.8917 ++++ 334.922211 m 0.0008 16 | 1/9
2 h-m-p 0.0002 0.0009 143.2971 ++ 323.380381 m 0.0009 28 | 2/9
3 h-m-p 0.0000 0.0000 117.6899 ++ 323.234329 m 0.0000 40 | 3/9
4 h-m-p 0.0000 0.0000 2212.9209 ++ 321.588435 m 0.0000 52 | 4/9
5 h-m-p 0.0000 0.0000 2383.4526 ++ 321.004339 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0000 54368.2693 ++ 320.798783 m 0.0000 76 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 320.798783 m 8.0000 88 | 6/9
8 h-m-p 0.0160 8.0000 0.0961 --------C 320.798783 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0002 -------------.. | 6/9
10 h-m-p 0.0160 8.0000 0.0001 +++++ 320.798783 m 8.0000 155 | 6/9
11 h-m-p 0.0053 2.6441 0.2921 ----------Y 320.798783 0 0.0000 180 | 6/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798783 m 8.0000 198 | 6/9
13 h-m-p 0.0041 2.0371 0.3852 --------C 320.798783 0 0.0000 221 | 6/9
14 h-m-p 0.0160 8.0000 0.0011 +++++ 320.798783 m 8.0000 239 | 6/9
15 h-m-p 0.0212 1.7054 0.4206 -------------.. | 6/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 320.798783 m 8.0000 283 | 6/9
17 h-m-p 0.0054 2.6892 0.2930 -----------Y 320.798783 0 0.0000 309 | 6/9
18 h-m-p 0.0160 8.0000 0.0004 +++++ 320.798782 m 8.0000 327 | 6/9
19 h-m-p 0.0094 1.7799 0.3638 ---------Y 320.798782 0 0.0000 351 | 6/9
20 h-m-p 0.0160 8.0000 0.0025 +++++ 320.798781 m 8.0000 369 | 6/9
21 h-m-p 0.0539 1.9118 0.3651 -----------Y 320.798781 0 0.0000 395 | 6/9
22 h-m-p 0.0160 8.0000 0.0004 -----------N 320.798781 0 0.0000 421 | 6/9
23 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
24 h-m-p 0.0160 8.0000 0.0001 +++++ 320.798781 m 8.0000 465 | 6/9
25 h-m-p 0.0058 2.9063 0.2834 ----------Y 320.798781 0 0.0000 490 | 6/9
26 h-m-p 0.0160 8.0000 0.0005 +++++ 320.798781 m 8.0000 508 | 6/9
27 h-m-p 0.0119 2.1328 0.3316 -----------C 320.798781 0 0.0000 534 | 6/9
28 h-m-p 0.0160 8.0000 0.0006 +++++ 320.798780 m 8.0000 552 | 6/9
29 h-m-p 0.0119 1.6596 0.3982 -----------Y 320.798780 0 0.0000 578 | 6/9
30 h-m-p 0.0160 8.0000 0.0004 -------C 320.798780 0 0.0000 600 | 6/9
31 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798780 m 8.0000 618 | 6/9
32 h-m-p 0.0030 1.4842 0.4794 ----------C 320.798780 0 0.0000 643 | 6/9
33 h-m-p 0.0160 8.0000 0.0000 ----------Y 320.798780 0 0.0000 668 | 6/9
34 h-m-p 0.0160 8.0000 0.0000 -Y 320.798780 0 0.0010 684
Out..
lnL = -320.798780
685 lfun, 2055 eigenQcodon, 8220 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037973 0.048725 0.099051 0.090599 0.031191 0.037366 0.660978 0.935725 0.295043 0.420961 1.443790
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.363986
np = 11
lnL0 = -347.849684
Iterating by ming2
Initial: fx= 347.849684
x= 0.03797 0.04872 0.09905 0.09060 0.03119 0.03737 0.66098 0.93573 0.29504 0.42096 1.44379
1 h-m-p 0.0000 0.0004 186.6434 +++ 333.430059 m 0.0004 17 | 1/11
2 h-m-p 0.0001 0.0007 68.1867 ++ 330.926649 m 0.0007 31 | 2/11
3 h-m-p 0.0000 0.0000 602.9291 ++ 330.742990 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 5865.2437 ++ 328.282514 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0002 869.7001 ++ 321.543954 m 0.0002 73 | 5/11
6 h-m-p 0.0000 0.0001 598.9572 ++ 320.798792 m 0.0001 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 320.798792 m 8.0000 101 | 6/11
8 h-m-p 0.0047 0.8101 0.1716 ++++ 320.798788 m 0.8101 122 | 7/11
9 h-m-p 0.6327 8.0000 0.0602 ----------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798788 m 8.0000 176 | 7/11
11 h-m-p 0.0160 8.0000 1.1771 ----------N 320.798788 0 0.0000 204 | 7/11
12 h-m-p 0.0160 8.0000 0.0004 +++++ 320.798788 m 8.0000 221 | 7/11
13 h-m-p 0.0160 8.0000 1.4033 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798788 m 8.0000 267 | 7/11
15 h-m-p 0.0160 8.0000 0.0861 ----------N 320.798788 0 0.0000 295 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 320.798788 m 8.0000 316 | 7/11
17 h-m-p 0.0160 8.0000 1.5977 -------------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798788 m 8.0000 362 | 7/11
19 h-m-p 0.0160 8.0000 0.0171 +++++ 320.798785 m 8.0000 383 | 7/11
20 h-m-p 0.1160 8.0000 1.1776 -------------Y 320.798785 0 0.0000 414 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798785 m 8.0000 431 | 7/11
22 h-m-p 0.0039 1.9665 1.8479 +++++ 320.798683 m 1.9665 452 | 8/11
23 h-m-p 0.1282 0.6411 9.6818 ---------------.. | 8/11
24 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798683 m 8.0000 496 | 8/11
25 h-m-p 0.0160 8.0000 0.8470 -------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798683 m 8.0000 544 | 8/11
27 h-m-p 0.0116 5.8184 1.6149 +++++ 320.798635 m 5.8184 564 | 8/11
28 h-m-p 1.6000 8.0000 0.0015 -----C 320.798635 0 0.0004 583 | 9/11
29 h-m-p 0.5174 8.0000 0.0000 --Y 320.798635 0 0.0081 602
Out..
lnL = -320.798635
603 lfun, 2412 eigenQcodon, 10854 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -320.813266 S = -320.798929 -0.005491
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:05
did 20 / 40 patterns 0:05
did 30 / 40 patterns 0:05
did 40 / 40 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030834 0.087277 0.038311 0.097865 0.090266 0.034797 0.000100 1.160691 1.951811
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.677464
np = 9
lnL0 = -349.731065
Iterating by ming2
Initial: fx= 349.731065
x= 0.03083 0.08728 0.03831 0.09787 0.09027 0.03480 0.00011 1.16069 1.95181
1 h-m-p 0.0000 0.0000 180.7603 ++ 349.579004 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0542 21.7045 ++++
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
+ 345.462459 m 0.0542 29
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16519) = 1.218369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16520) = 1.218368e-160 2000 rounds
| 2/9
3 h-m-p 0.0004 0.0022 78.6510
QuantileBeta(0.15, 0.00500, 2.19838) = 1.195221e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29793) = 1.130718e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
+ 343.378107 m 0.0022 41
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.149497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33112) = 1.110721e-160 2000 rounds
| 3/9
4 h-m-p 0.0001 0.0007 100.4807
QuantileBeta(0.15, 0.00500, 2.31783) = 1.118646e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27795) = 1.143106e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+ 341.014156 m 0.0007 53
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 4/9
5 h-m-p 0.0160 8.0000 8.8006
QuantileBeta(0.15, 0.00500, 2.40134) = 1.070635e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29883) = 1.130169e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27320) = 1.146090e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26680) = 1.150140e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26519) = 1.151157e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26479) = 1.151412e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26469) = 1.151475e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26467) = 1.151491e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151495e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 4/9
6 h-m-p 0.0000 0.0001 138.2770
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+ 339.482824 m 0.0001 88
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 5/9
7 h-m-p 0.0160 8.0000 1.7104
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151495e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 5/9
8 h-m-p 0.0000 0.0012 117.6415
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+ 322.487206 m 0.0012 125
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 6/9
9 h-m-p 0.0766 8.0000 1.4733
QuantileBeta(0.15, 0.00500, 2.26467) = 1.151492e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151495e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 6/9
10 h-m-p 0.0000 0.0001 103.6905
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+ 321.744179 m 0.0001 161
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 7/9
11 h-m-p 0.0160 8.0000 1.0253
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 7/9
12 h-m-p 0.0000 0.0002 73.2213
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
+ 320.798635 m 0.0002 197
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151496e-160 2000 rounds
| 8/9
13 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
N 320.798635 0 0.1000 210
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.191695e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26478) = 1.151418e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26454) = 1.151575e-160 2000 rounds
| 8/9
14 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
N 320.798635 0 1.6000 223
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
Out..
lnL = -320.798635
224 lfun, 2464 eigenQcodon, 13440 P(t)
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26466) = 1.151497e-160 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071842 0.108394 0.098134 0.062329 0.099609 0.047721 0.000100 0.900000 0.510929 1.562943 1.387539
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.970397
np = 11
lnL0 = -355.468824
Iterating by ming2
Initial: fx= 355.468824
x= 0.07184 0.10839 0.09813 0.06233 0.09961 0.04772 0.00011 0.90000 0.51093 1.56294 1.38754
1 h-m-p 0.0000 0.0000 158.2751 ++ 355.404020 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0021 115.0830 ++++ 336.014344 m 0.0021 32 | 2/11
3 h-m-p 0.0000 0.0000 758705.4576 ++ 330.738527 m 0.0000 46 | 3/11
4 h-m-p 0.0014 0.0071 20.6446 ++ 328.240673 m 0.0071 60 | 4/11
5 h-m-p 0.0004 0.0019 41.2659 ++ 322.683965 m 0.0019 74 | 5/11
6 h-m-p 0.0004 0.0022 24.1349 ++ 322.222103 m 0.0022 88 | 6/11
7 h-m-p 0.0000 0.0002 474.2087 ++ 320.798768 m 0.0002 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 320.798768 m 8.0000 116 | 7/11
9 h-m-p 0.0059 2.9428 0.4962 ----------Y 320.798768 0 0.0000 144 | 7/11
10 h-m-p 0.0160 8.0000 0.0003 +++++ 320.798767 m 8.0000 165 | 7/11
11 h-m-p 0.0062 3.1167 0.4135 ------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798767 m 8.0000 214 | 7/11
13 h-m-p 0.0059 2.9628 0.2669 ----------Y 320.798767 0 0.0000 242 | 7/11
14 h-m-p 0.0160 8.0000 0.0016 +++++ 320.798765 m 8.0000 263 | 7/11
15 h-m-p 0.0462 3.0340 0.2754 -------------Y 320.798765 0 0.0000 294 | 7/11
16 h-m-p 0.0160 8.0000 0.0005 +++++ 320.798764 m 8.0000 315 | 7/11
17 h-m-p 0.0093 1.3500 0.4145 ------------Y 320.798764 0 0.0000 345 | 7/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 320.798764 m 8.0000 366 | 7/11
19 h-m-p 0.0026 1.2780 0.3744 ----------C 320.798764 0 0.0000 394 | 7/11
20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
21 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798764 m 8.0000 444 | 7/11
22 h-m-p 0.0063 3.1529 0.2565 ------------.. | 7/11
23 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798763 m 8.0000 493 | 7/11
24 h-m-p 0.0063 3.1648 0.2560 ------------.. | 7/11
25 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798763 m 8.0000 542 | 7/11
26 h-m-p 0.0064 3.1840 0.2550 -----------Y 320.798763 0 0.0000 571 | 7/11
27 h-m-p 0.0160 8.0000 0.0037 +++++ 320.798757 m 8.0000 592 | 7/11
28 h-m-p 0.1117 3.0988 0.2642 --------------Y 320.798757 0 0.0000 624 | 7/11
29 h-m-p 0.0160 8.0000 0.0001 +++++ 320.798757 m 8.0000 645 | 7/11
30 h-m-p 0.0065 3.2413 0.3375 ----------N 320.798757 0 0.0000 673 | 7/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798757 m 8.0000 694 | 7/11
32 h-m-p 0.0064 3.1978 0.2674 ------------.. | 7/11
33 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798756 m 8.0000 743 | 7/11
34 h-m-p 0.0078 3.5615 0.2372 -------------.. | 7/11
35 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798756 m 8.0000 793 | 7/11
36 h-m-p 0.0079 3.5883 0.2359 ----------Y 320.798756 0 0.0000 821 | 7/11
37 h-m-p 0.0160 8.0000 0.0058 +++++ 320.798744 m 8.0000 842 | 7/11
38 h-m-p 0.1805 3.3962 0.2578 --------------N 320.798744 0 0.0000 874 | 7/11
39 h-m-p 0.0002 0.0751 2.0436 +++++ 320.798678 m 0.0751 895 | 8/11
40 h-m-p 0.5446 8.0000 0.0638 ------------C 320.798678 0 0.0000 921 | 8/11
41 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798678 m 8.0000 941 | 8/11
42 h-m-p 0.0001 0.0511 11.5160 ---------.. | 8/11
43 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798677 m 8.0000 982 | 8/11
44 h-m-p 0.0160 8.0000 0.2901 -------------.. | 8/11
45 h-m-p 0.0160 8.0000 0.0003 +++++ 320.798677 m 8.0000 1030 | 8/11
46 h-m-p 0.0160 8.0000 0.2542 -----------C 320.798677 0 0.0000 1058 | 8/11
47 h-m-p 0.0160 8.0000 0.0001 +++++ 320.798677 m 8.0000 1078 | 8/11
48 h-m-p 0.0011 0.5577 0.9388 -----------.. | 8/11
49 h-m-p 0.0160 8.0000 0.0003 +++++ 320.798676 m 8.0000 1124 | 8/11
50 h-m-p 0.0160 8.0000 0.2529 -------------.. | 8/11
51 h-m-p 0.0160 8.0000 0.0003 +++++ 320.798676 m 8.0000 1172 | 8/11
52 h-m-p 0.0160 8.0000 0.2513 -----------Y 320.798676 0 0.0000 1200 | 8/11
53 h-m-p 0.0160 8.0000 0.0003 +++++ 320.798676 m 8.0000 1220 | 8/11
54 h-m-p 0.0046 2.2845 0.8067 -----------Y 320.798676 0 0.0000 1248 | 8/11
55 h-m-p 0.0160 8.0000 0.0000 -----------C 320.798676 0 0.0000 1276 | 8/11
56 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798676 m 8.0000 1296 | 8/11
57 h-m-p 0.0160 8.0000 0.4741 ----------C 320.798676 0 0.0000 1323 | 8/11
58 h-m-p 0.0160 8.0000 0.0002 +++++ 320.798675 m 8.0000 1343 | 8/11
59 h-m-p 0.0160 8.0000 0.5238 ------------Y 320.798675 0 0.0000 1372 | 8/11
60 h-m-p 0.0160 8.0000 0.0000 +++++ 320.798675 m 8.0000 1392 | 8/11
61 h-m-p 0.0160 8.0000 0.5775 -------------.. | 8/11
62 h-m-p 0.0160 8.0000 0.0003 +++++ 320.798675 m 8.0000 1440 | 8/11
63 h-m-p 0.0160 8.0000 0.2487 -----------N 320.798675 0 0.0000 1468 | 8/11
64 h-m-p 0.0013 0.6282 0.2008 +++++ 320.798635 m 0.6282 1488 | 9/11
65 h-m-p 1.6000 8.0000 0.0000 C 320.798635 0 1.6000 1505 | 9/11
66 h-m-p 0.0670 8.0000 0.0000 -N 320.798635 0 0.0042 1522 | 9/11
67 h-m-p 0.0628 8.0000 0.0000 -Y 320.798635 0 0.0039 1539
Out..
lnL = -320.798635
1540 lfun, 18480 eigenQcodon, 101640 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -320.817629 S = -320.798929 -0.008222
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:33
did 20 / 40 patterns 0:33
did 30 / 40 patterns 0:34
did 40 / 40 patterns 0:34
Time used: 0:34
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=82
NC_011896_1_WP_010907944_1_854_MLBR_RS03985 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
NC_002677_1_NP_301620_1_492_ML0814 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF
**************************************************
NC_011896_1_WP_010907944_1_854_MLBR_RS03985 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
NC_002677_1_NP_301620_1_492_ML0814 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500 LIHGAKIAYVEIGVADARRVGFGIGAESATNG
********************************
>NC_011896_1_WP_010907944_1_854_MLBR_RS03985 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG >NC_002677_1_NP_301620_1_492_ML0814 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG >NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG >NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG >NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG >NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500 GTGGAGGTCAAGATCGGTATCACAGACAGTCCGCGCGAGCTGACCTTCTC CAGTGCGCAGACACCTGGTGAAATCGAAGAGCTCGTTAGCGCCGCACTGC GCGAGGGCTTGGGTTTGCTGGTCCTGACCGACGAAAGGGGCCGTCGTTTC CTGATACACGGTGCCAAGATTGCCTATGTGGAGATCGGGGTCGCCGACGC TCGCCGGGTAGGCTTTGGAATCGGGGCCGAGTCAGCTACAAACGGG
>NC_011896_1_WP_010907944_1_854_MLBR_RS03985 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF LIHGAKIAYVEIGVADARRVGFGIGAESATNG >NC_002677_1_NP_301620_1_492_ML0814 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF LIHGAKIAYVEIGVADARRVGFGIGAESATNG >NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF LIHGAKIAYVEIGVADARRVGFGIGAESATNG >NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF LIHGAKIAYVEIGVADARRVGFGIGAESATNG >NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF LIHGAKIAYVEIGVADARRVGFGIGAESATNG >NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500 VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRF LIHGAKIAYVEIGVADARRVGFGIGAESATNG
#NEXUS
[ID: 0020960818]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907944_1_854_MLBR_RS03985
NC_002677_1_NP_301620_1_492_ML0814
NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155
NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085
NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430
NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907944_1_854_MLBR_RS03985,
2 NC_002677_1_NP_301620_1_492_ML0814,
3 NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155,
4 NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085,
5 NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430,
6 NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.071074,2:0.06877982,3:0.07070746,4:0.06783266,5:0.06893677,6:0.06708226);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.071074,2:0.06877982,3:0.07070746,4:0.06783266,5:0.06893677,6:0.06708226);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -335.47 -338.84
2 -335.47 -338.64
--------------------------------------
TOTAL -335.47 -338.75
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0814/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890745 0.088624 0.362279 1.461502 0.853113 1303.60 1402.30 1.000
r(A<->C){all} 0.170828 0.019717 0.000032 0.448799 0.135666 178.95 217.36 1.002
r(A<->G){all} 0.165598 0.020791 0.000051 0.464564 0.123036 159.63 206.90 1.002
r(A<->T){all} 0.159913 0.019150 0.000012 0.449125 0.123841 220.59 237.67 1.000
r(C<->G){all} 0.164214 0.019365 0.000061 0.443237 0.129383 217.59 223.00 1.002
r(C<->T){all} 0.168353 0.021172 0.000013 0.461217 0.132667 220.92 232.00 1.000
r(G<->T){all} 0.171093 0.020645 0.000056 0.463406 0.136720 171.21 208.60 1.002
pi(A){all} 0.194863 0.000629 0.147375 0.243571 0.194013 695.47 1098.23 1.000
pi(C){all} 0.264487 0.000761 0.210453 0.318323 0.264092 1219.35 1313.66 1.000
pi(G){all} 0.344294 0.000858 0.287954 0.402189 0.343767 1495.09 1498.05 1.000
pi(T){all} 0.196356 0.000621 0.150602 0.249390 0.195367 1465.70 1483.35 1.000
alpha{1,2} 0.410390 0.208659 0.000225 1.339720 0.252776 1159.89 1330.45 1.000
alpha{3} 0.457757 0.242920 0.000210 1.419612 0.300507 1163.39 1226.39 1.000
pinvar{all} 0.993110 0.000074 0.977593 0.999992 0.995784 982.06 1204.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0814/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 82
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 5 5 5 5 5 5 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 5 5 5 5 5 5 | ACC 2 2 2 2 2 2 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 2 2 2 2 2 2 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 3 3 3 3 3 3 | GCC 5 5 5 5 5 5 | GAC 3 3 3 3 3 3 | GGC 3 3 3 3 3 3
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 1 1 1 1 1 1
GTG 2 2 2 2 2 2 | GCG 1 1 1 1 1 1 | GAG 6 6 6 6 6 6 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907944_1_854_MLBR_RS03985
position 1: T:0.09756 C:0.19512 A:0.23171 G:0.47561
position 2: T:0.30488 C:0.21951 A:0.21951 G:0.25610
position 3: T:0.18293 C:0.37805 A:0.13415 G:0.30488
Average T:0.19512 C:0.26423 A:0.19512 G:0.34553
#2: NC_002677_1_NP_301620_1_492_ML0814
position 1: T:0.09756 C:0.19512 A:0.23171 G:0.47561
position 2: T:0.30488 C:0.21951 A:0.21951 G:0.25610
position 3: T:0.18293 C:0.37805 A:0.13415 G:0.30488
Average T:0.19512 C:0.26423 A:0.19512 G:0.34553
#3: NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155
position 1: T:0.09756 C:0.19512 A:0.23171 G:0.47561
position 2: T:0.30488 C:0.21951 A:0.21951 G:0.25610
position 3: T:0.18293 C:0.37805 A:0.13415 G:0.30488
Average T:0.19512 C:0.26423 A:0.19512 G:0.34553
#4: NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085
position 1: T:0.09756 C:0.19512 A:0.23171 G:0.47561
position 2: T:0.30488 C:0.21951 A:0.21951 G:0.25610
position 3: T:0.18293 C:0.37805 A:0.13415 G:0.30488
Average T:0.19512 C:0.26423 A:0.19512 G:0.34553
#5: NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430
position 1: T:0.09756 C:0.19512 A:0.23171 G:0.47561
position 2: T:0.30488 C:0.21951 A:0.21951 G:0.25610
position 3: T:0.18293 C:0.37805 A:0.13415 G:0.30488
Average T:0.19512 C:0.26423 A:0.19512 G:0.34553
#6: NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500
position 1: T:0.09756 C:0.19512 A:0.23171 G:0.47561
position 2: T:0.30488 C:0.21951 A:0.21951 G:0.25610
position 3: T:0.18293 C:0.37805 A:0.13415 G:0.30488
Average T:0.19512 C:0.26423 A:0.19512 G:0.34553
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 12
CTC 6 | CCC 0 | CAC 6 | CGC 18
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 30 | CCG 6 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 12
ATC 30 | ACC 12 | AAC 6 | AGC 6
ATA 6 | ACA 18 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 0 | ACG 0 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 12 | Asp D GAT 0 | Gly G GGT 24
GTC 18 | GCC 30 | GAC 18 | GGC 18
GTA 6 | GCA 6 | Glu E GAA 18 | GGA 6
GTG 12 | GCG 6 | GAG 36 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09756 C:0.19512 A:0.23171 G:0.47561
position 2: T:0.30488 C:0.21951 A:0.21951 G:0.25610
position 3: T:0.18293 C:0.37805 A:0.13415 G:0.30488
Average T:0.19512 C:0.26423 A:0.19512 G:0.34553
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -320.798815 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.674054 1.387539
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907944_1_854_MLBR_RS03985: 0.000004, NC_002677_1_NP_301620_1_492_ML0814: 0.000004, NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155: 0.000004, NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085: 0.000004, NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430: 0.000004, NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.67405
omega (dN/dS) = 1.38754
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.1 65.9 1.3875 0.0000 0.0000 0.0 0.0
7..2 0.000 180.1 65.9 1.3875 0.0000 0.0000 0.0 0.0
7..3 0.000 180.1 65.9 1.3875 0.0000 0.0000 0.0 0.0
7..4 0.000 180.1 65.9 1.3875 0.0000 0.0000 0.0 0.0
7..5 0.000 180.1 65.9 1.3875 0.0000 0.0000 0.0 0.0
7..6 0.000 180.1 65.9 1.3875 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -320.798780 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.660978 0.651725 0.164462
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907944_1_854_MLBR_RS03985: 0.000004, NC_002677_1_NP_301620_1_492_ML0814: 0.000004, NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155: 0.000004, NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085: 0.000004, NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430: 0.000004, NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.66098
MLEs of dN/dS (w) for site classes (K=2)
p: 0.65173 0.34827
w: 0.16446 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.2 65.8 0.4555 0.0000 0.0000 0.0 0.0
7..2 0.000 180.2 65.8 0.4555 0.0000 0.0000 0.0 0.0
7..3 0.000 180.2 65.8 0.4555 0.0000 0.0000 0.0 0.0
7..4 0.000 180.2 65.8 0.4555 0.0000 0.0000 0.0 0.0
7..5 0.000 180.2 65.8 0.4555 0.0000 0.0000 0.0 0.0
7..6 0.000 180.2 65.8 0.4555 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -320.798635 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999994 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907944_1_854_MLBR_RS03985: 0.000004, NC_002677_1_NP_301620_1_492_ML0814: 0.000004, NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155: 0.000004, NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085: 0.000004, NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430: 0.000004, NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99999 0.00000 0.00001
w: 0.00000 1.00000 1.00000
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907944_1_854_MLBR_RS03985)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -320.798635 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.264660
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907944_1_854_MLBR_RS03985: 0.000004, NC_002677_1_NP_301620_1_492_ML0814: 0.000004, NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155: 0.000004, NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085: 0.000004, NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430: 0.000004, NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.26466
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -320.798635 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.599979 1.492030
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907944_1_854_MLBR_RS03985: 0.000004, NC_002677_1_NP_301620_1_492_ML0814: 0.000004, NZ_LVXE01000001_1_WP_010907944_1_239_A3216_RS01155: 0.000004, NZ_LYPH01000001_1_WP_010907944_1_228_A8144_RS01085: 0.000004, NZ_CP029543_1_WP_010907944_1_872_DIJ64_RS04430: 0.000004, NZ_AP014567_1_WP_010907944_1_886_JK2ML_RS04500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.59998
(p1 = 0.00001) w = 1.49203
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.49203
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 183.2 62.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907944_1_854_MLBR_RS03985)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:34
Model 1: NearlyNeutral -320.79878 Model 2: PositiveSelection -320.798635 Model 0: one-ratio -320.798815 Model 7: beta -320.798635 Model 8: beta&w>1 -320.798635 Model 0 vs 1 6.999999993695383E-5 Model 2 vs 1 2.9000000006362825E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
