--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:49:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0825/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -639.78 -659.96
2 -639.36 -658.68
--------------------------------------
TOTAL -639.55 -659.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.232238 0.035631 0.031846 0.609553 0.168808 612.89 616.52 1.001
r(A<->C){all} 0.202089 0.022208 0.000195 0.486710 0.170792 232.37 272.26 1.006
r(A<->G){all} 0.277474 0.024890 0.000172 0.556336 0.263084 122.77 166.76 1.000
r(A<->T){all} 0.116373 0.012302 0.000041 0.342777 0.084200 242.02 295.08 1.000
r(C<->G){all} 0.142913 0.013211 0.000070 0.370268 0.116326 286.39 299.76 1.001
r(C<->T){all} 0.090105 0.009840 0.000063 0.296572 0.056288 104.59 136.73 1.002
r(G<->T){all} 0.171046 0.016886 0.000207 0.426114 0.140117 216.85 247.42 1.000
pi(A){all} 0.205239 0.000375 0.166135 0.242999 0.204414 1100.58 1180.25 1.000
pi(C){all} 0.333475 0.000497 0.290846 0.377103 0.333876 753.93 942.62 1.000
pi(G){all} 0.287276 0.000463 0.246734 0.330320 0.287076 1094.81 1297.90 1.000
pi(T){all} 0.174011 0.000317 0.140267 0.209674 0.173585 1460.33 1480.67 1.000
alpha{1,2} 0.439794 0.166669 0.000186 1.260930 0.320970 913.09 1073.12 1.001
alpha{3} 0.462258 0.200749 0.000163 1.348461 0.324655 1394.12 1411.49 1.000
pinvar{all} 0.757327 0.045655 0.260221 0.968774 0.841182 284.85 306.45 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -512.894365
Model 2: PositiveSelection -495.579097
Model 0: one-ratio -515.15946
Model 7: beta -512.894753
Model 8: beta&w>1 -495.579138
Model 0 vs 1 4.530189999999948
Model 2 vs 1 34.630536000000006
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.310
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.849 8.458 +- 3.336
2 R 0.999** 9.804 +- 1.010
4 T 0.993** 9.751 +- 1.218
5 S 1.000** 9.809 +- 0.984
6 N 0.753 7.591 +- 3.957
Model 8 vs 7 34.63123000000007
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.308
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.904 8.916 +- 2.842
2 R 1.000** 9.781 +- 1.021
4 T 0.997** 9.757 +- 1.122
5 S 1.000** 9.784 +- 1.010
6 N 0.835 8.275 +- 3.506
>C1
LRGTSNGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
THIVVDAVAHAGVDALoooooooooooooooooooooooo
>C2
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C3
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C4
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C5
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C6
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=164
C1 ------------------------LRGTSNGADGISRLADYPAPPPRETL
C2 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C3 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C4 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C5 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C6 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
:.* .:********************
C1 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C2 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C3 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C4 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C5 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C6 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
**************************************************
C1 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDALoooooooooo
C2 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C3 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C4 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C5 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C6 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
****************************************
C1 oooooooooooooo
C2 --------------
C3 --------------
C4 --------------
C5 --------------
C6 --------------
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4400]--->[4280]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.469 Mb, Max= 30.678 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LRGTSNGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C2 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C3 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C4 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C5 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C6 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
:.* .:********************************************
C1 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C2 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C3 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C4 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C5 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C6 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
**************************************************
C1 THIVVDAVAHAGVDAL
C2 THIVVDAVAHAGVDAL
C3 THIVVDAVAHAGVDAL
C4 THIVVDAVAHAGVDAL
C5 THIVVDAVAHAGVDAL
C6 THIVVDAVAHAGVDAL
****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:98 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 95.69 C1 C2 95.69
TOP 1 0 95.69 C2 C1 95.69
BOT 0 2 95.69 C1 C3 95.69
TOP 2 0 95.69 C3 C1 95.69
BOT 0 3 95.69 C1 C4 95.69
TOP 3 0 95.69 C4 C1 95.69
BOT 0 4 95.69 C1 C5 95.69
TOP 4 0 95.69 C5 C1 95.69
BOT 0 5 95.69 C1 C6 95.69
TOP 5 0 95.69 C6 C1 95.69
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 95.69
AVG 1 C2 * 99.14
AVG 2 C3 * 99.14
AVG 3 C4 * 99.14
AVG 4 C5 * 99.14
AVG 5 C6 * 99.14
TOT TOT * 98.56
CLUSTAL W (1.83) multiple sequence alignment
C1 --------------------------------------------------
C2 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C3 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C4 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C5 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C6 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C1 ----------------------TTGAGGGGCACGAGCAACGGCGCTGATG
C2 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C3 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C4 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C5 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C6 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
* ..*** .. .. .************
C1 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C2 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C3 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C4 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C5 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C6 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
**************************************************
C1 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C2 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C3 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C4 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C5 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C6 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
**************************************************
C1 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C2 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C3 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C4 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C5 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C6 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
**************************************************
C1 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C2 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C3 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C4 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C5 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C6 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
**************************************************
C1 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C2 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C3 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C4 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C5 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C6 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
**************************************************
C1 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C2 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C3 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C4 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C5 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C6 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
**************************************************
C1 ACGCTGGCGTGGATGCACTG------------------------------
C2 ACGCTGGCGTGGATGCACTG------------------------------
C3 ACGCTGGCGTGGATGCACTG------------------------------
C4 ACGCTGGCGTGGATGCACTG------------------------------
C5 ACGCTGGCGTGGATGCACTG------------------------------
C6 ACGCTGGCGTGGATGCACTG------------------------------
********************
C1 ------------------------------------------
C2 ------------------------------------------
C3 ------------------------------------------
C4 ------------------------------------------
C5 ------------------------------------------
C6 ------------------------------------------
>C1
--------------------------------------------------
----------------------TTGAGGGGCACGAGCAACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C2
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C3
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C4
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C5
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C6
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C1
ooooooooooooooooooooooooLRGTSNGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C2
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C3
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C4
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C5
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C6
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 492 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579798020
Setting output file names to "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 229252536
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0292705593
Seed = 1328124849
Swapseed = 1579798020
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 12 unique site patterns
Division 2 has 11 unique site patterns
Division 3 has 12 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -973.963061 -- -24.965149
Chain 2 -- -973.963061 -- -24.965149
Chain 3 -- -973.963061 -- -24.965149
Chain 4 -- -973.963061 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -973.934283 -- -24.965149
Chain 2 -- -973.963061 -- -24.965149
Chain 3 -- -973.934283 -- -24.965149
Chain 4 -- -973.963061 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-973.963] (-973.963) (-973.963) (-973.963) * [-973.934] (-973.963) (-973.934) (-973.963)
500 -- (-651.875) [-654.122] (-650.416) (-654.656) * (-660.429) [-649.723] (-642.966) (-655.765) -- 0:00:00
1000 -- (-643.233) [-640.125] (-642.508) (-643.324) * (-646.407) (-648.348) (-651.556) [-644.711] -- 0:00:00
1500 -- (-643.215) (-644.020) [-651.394] (-649.930) * (-648.727) [-639.455] (-650.181) (-645.498) -- 0:00:00
2000 -- [-638.371] (-644.334) (-641.603) (-656.874) * (-648.115) (-642.668) (-653.758) [-642.284] -- 0:00:00
2500 -- (-648.818) (-643.627) [-642.933] (-646.906) * [-646.483] (-646.649) (-643.524) (-646.498) -- 0:00:00
3000 -- (-648.796) (-643.004) [-643.232] (-645.639) * (-649.613) (-641.877) (-642.010) [-643.226] -- 0:05:32
3500 -- (-654.450) (-651.735) [-643.700] (-640.893) * (-643.275) (-648.867) (-653.923) [-642.120] -- 0:04:44
4000 -- (-650.042) (-643.618) (-644.352) [-643.252] * [-642.627] (-642.041) (-640.440) (-642.126) -- 0:04:09
4500 -- [-641.759] (-643.393) (-655.839) (-642.294) * (-648.329) [-643.040] (-639.418) (-643.075) -- 0:03:41
5000 -- (-646.345) [-644.213] (-648.247) (-645.625) * (-649.767) [-640.617] (-652.796) (-641.997) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-647.843) [-639.071] (-645.016) (-641.917) * (-649.293) (-641.545) [-648.162] (-644.672) -- 0:03:00
6000 -- [-649.532] (-648.018) (-645.972) (-645.098) * [-643.993] (-644.177) (-645.808) (-643.420) -- 0:02:45
6500 -- [-644.428] (-644.715) (-639.896) (-641.647) * (-647.244) [-646.049] (-647.011) (-644.368) -- 0:02:32
7000 -- (-647.994) (-640.355) [-645.877] (-649.903) * (-647.994) (-640.273) [-644.271] (-650.052) -- 0:02:21
7500 -- [-640.389] (-640.998) (-645.876) (-649.515) * (-637.207) (-648.136) (-651.961) [-650.968] -- 0:02:12
8000 -- (-654.348) [-644.844] (-639.854) (-638.043) * [-644.594] (-641.352) (-642.304) (-644.010) -- 0:02:04
8500 -- [-647.737] (-644.252) (-644.615) (-646.983) * (-643.438) (-646.641) (-648.951) [-637.989] -- 0:01:56
9000 -- (-645.396) (-641.563) (-644.065) [-642.468] * (-643.111) [-643.378] (-643.536) (-640.837) -- 0:01:50
9500 -- (-642.467) [-636.040] (-639.699) (-647.972) * [-648.709] (-648.482) (-645.762) (-647.803) -- 0:01:44
10000 -- (-645.883) (-641.431) [-642.370] (-645.311) * (-652.764) (-642.253) (-645.068) [-641.973] -- 0:01:39
Average standard deviation of split frequencies: 0.069448
10500 -- [-643.264] (-646.811) (-645.434) (-643.710) * (-651.943) (-644.115) (-638.270) [-640.916] -- 0:01:34
11000 -- (-645.199) (-642.031) [-642.473] (-646.088) * (-644.694) (-645.459) (-644.582) [-640.613] -- 0:01:29
11500 -- [-642.917] (-645.337) (-642.346) (-650.045) * (-657.988) (-649.372) [-643.986] (-645.575) -- 0:01:25
12000 -- (-649.485) (-641.105) [-643.023] (-640.037) * (-650.144) (-648.693) [-642.143] (-639.682) -- 0:01:22
12500 -- (-650.537) [-636.889] (-646.440) (-643.523) * (-657.035) (-640.097) [-641.829] (-642.935) -- 0:01:19
13000 -- (-648.249) [-638.099] (-648.705) (-649.154) * (-650.666) (-653.503) (-639.343) [-643.497] -- 0:01:15
13500 -- (-654.700) [-643.305] (-640.207) (-641.200) * (-651.828) [-648.205] (-644.729) (-639.287) -- 0:01:13
14000 -- (-650.484) (-642.359) [-644.732] (-645.806) * (-652.948) [-644.488] (-643.837) (-641.843) -- 0:01:10
14500 -- (-647.141) (-641.384) [-640.345] (-654.511) * (-645.167) [-645.192] (-641.465) (-648.462) -- 0:02:15
15000 -- (-666.178) (-640.277) [-640.276] (-642.417) * (-642.781) [-638.090] (-640.032) (-645.928) -- 0:02:11
Average standard deviation of split frequencies: 0.075983
15500 -- (-652.911) [-642.950] (-640.667) (-644.602) * (-644.896) (-648.693) [-636.694] (-637.587) -- 0:02:07
16000 -- (-659.496) (-641.345) (-653.428) [-648.196] * [-638.751] (-641.546) (-639.745) (-643.633) -- 0:02:03
16500 -- (-651.901) (-638.421) (-647.628) [-641.751] * (-646.217) [-651.754] (-645.962) (-648.862) -- 0:01:59
17000 -- (-647.521) [-640.992] (-644.565) (-642.455) * (-642.066) (-640.741) (-638.572) [-639.064] -- 0:01:55
17500 -- (-651.226) [-637.776] (-642.600) (-658.593) * (-639.387) [-637.475] (-637.530) (-649.284) -- 0:01:52
18000 -- (-647.011) [-639.085] (-649.072) (-651.096) * (-652.917) [-639.115] (-648.298) (-649.162) -- 0:01:49
18500 -- (-656.885) (-637.680) [-644.679] (-649.207) * [-645.939] (-655.296) (-648.499) (-646.805) -- 0:01:46
19000 -- (-655.510) [-639.745] (-645.137) (-641.655) * (-656.342) (-640.474) (-643.507) [-653.182] -- 0:01:43
19500 -- (-647.039) (-644.736) (-659.339) [-643.236] * (-656.987) (-642.913) [-652.884] (-647.000) -- 0:01:40
20000 -- (-648.013) [-639.342] (-642.509) (-640.906) * (-648.881) (-648.268) (-643.815) [-644.970] -- 0:01:38
Average standard deviation of split frequencies: 0.059559
20500 -- (-643.962) [-636.855] (-644.709) (-646.498) * [-639.796] (-661.473) (-643.490) (-644.546) -- 0:01:35
21000 -- (-645.593) (-644.130) (-643.587) [-647.079] * (-644.127) (-642.016) [-640.967] (-646.566) -- 0:01:33
21500 -- (-652.688) [-641.463] (-651.574) (-654.956) * (-643.052) (-643.596) [-640.099] (-643.558) -- 0:01:31
22000 -- (-649.272) [-644.785] (-651.903) (-651.519) * (-650.716) [-638.937] (-643.832) (-640.994) -- 0:01:28
22500 -- (-647.952) [-638.451] (-646.853) (-650.925) * [-645.969] (-653.905) (-644.766) (-644.563) -- 0:01:26
23000 -- (-649.931) [-643.649] (-654.000) (-649.113) * (-653.964) (-643.439) (-641.299) [-644.897] -- 0:01:24
23500 -- [-639.292] (-648.060) (-653.014) (-646.163) * (-645.496) (-644.425) [-641.650] (-640.831) -- 0:01:23
24000 -- [-647.053] (-642.543) (-657.918) (-655.082) * (-645.759) (-647.884) (-637.204) [-640.471] -- 0:01:21
24500 -- (-640.013) [-642.920] (-651.272) (-656.033) * (-641.671) (-643.476) (-641.736) [-643.437] -- 0:01:19
25000 -- (-646.427) (-644.112) (-660.434) [-647.896] * (-642.402) (-650.718) (-644.081) [-638.666] -- 0:01:18
Average standard deviation of split frequencies: 0.049860
25500 -- [-643.020] (-652.853) (-660.942) (-646.682) * [-641.451] (-647.192) (-644.941) (-644.472) -- 0:01:54
26000 -- (-641.500) [-644.622] (-654.149) (-654.560) * (-640.974) [-651.538] (-659.635) (-647.738) -- 0:01:52
26500 -- [-644.528] (-647.017) (-654.344) (-653.915) * [-641.121] (-645.525) (-655.976) (-640.310) -- 0:01:50
27000 -- (-641.172) [-645.273] (-640.140) (-657.134) * [-638.095] (-647.980) (-638.821) (-640.084) -- 0:01:48
27500 -- (-647.196) (-663.915) (-649.295) [-647.240] * [-638.879] (-642.468) (-646.305) (-643.336) -- 0:01:46
28000 -- (-660.889) (-645.238) [-647.370] (-656.788) * (-637.729) (-647.145) (-653.820) [-644.311] -- 0:01:44
28500 -- (-658.876) (-646.553) [-647.258] (-658.896) * [-639.714] (-642.137) (-655.739) (-639.334) -- 0:01:42
29000 -- (-656.876) [-639.698] (-653.689) (-659.798) * (-641.963) [-641.785] (-650.598) (-650.336) -- 0:01:40
29500 -- (-657.353) [-640.093] (-641.746) (-658.248) * (-641.923) [-638.671] (-656.379) (-648.781) -- 0:01:38
30000 -- (-652.655) (-644.469) [-646.349] (-668.669) * (-641.605) (-642.668) (-647.000) [-644.530] -- 0:01:37
Average standard deviation of split frequencies: 0.037731
30500 -- (-644.010) [-642.123] (-647.287) (-661.938) * (-648.228) [-644.302] (-646.819) (-646.538) -- 0:01:35
31000 -- (-657.200) [-643.306] (-649.248) (-657.442) * [-642.307] (-650.358) (-645.703) (-639.093) -- 0:01:33
31500 -- (-653.273) [-642.485] (-651.838) (-652.146) * (-644.591) [-646.141] (-650.255) (-646.785) -- 0:01:32
32000 -- (-655.181) (-641.670) [-650.502] (-646.893) * (-646.312) (-648.066) (-652.019) [-646.991] -- 0:01:30
32500 -- (-647.185) (-648.296) [-643.070] (-645.310) * (-639.342) [-644.114] (-645.314) (-648.182) -- 0:01:29
33000 -- (-655.910) [-639.396] (-644.083) (-652.978) * [-637.729] (-647.981) (-664.100) (-655.386) -- 0:01:27
33500 -- (-651.933) [-641.336] (-644.151) (-651.899) * [-637.478] (-643.021) (-652.963) (-653.619) -- 0:01:26
34000 -- (-656.989) [-642.839] (-644.006) (-657.967) * (-636.661) (-647.494) (-654.142) [-648.636] -- 0:01:25
34500 -- (-659.095) (-639.688) [-644.817] (-650.263) * [-639.016] (-642.110) (-646.418) (-653.223) -- 0:01:23
35000 -- (-655.189) [-642.554] (-650.896) (-655.512) * (-638.328) (-643.259) (-656.960) [-652.243] -- 0:01:22
Average standard deviation of split frequencies: 0.037974
35500 -- (-654.935) [-644.069] (-647.299) (-655.472) * (-643.991) [-646.336] (-656.200) (-652.695) -- 0:01:21
36000 -- (-652.015) [-641.493] (-651.234) (-645.643) * (-640.698) [-642.763] (-656.184) (-641.458) -- 0:01:20
36500 -- (-652.787) [-640.002] (-639.967) (-651.995) * (-643.094) [-643.477] (-654.654) (-649.095) -- 0:01:19
37000 -- [-644.635] (-642.500) (-641.421) (-654.900) * (-639.730) (-648.499) [-651.030] (-656.301) -- 0:01:44
37500 -- (-653.893) (-638.129) [-647.192] (-657.673) * [-639.936] (-646.678) (-644.325) (-653.900) -- 0:01:42
38000 -- (-653.873) (-643.080) [-642.296] (-651.511) * [-639.652] (-662.442) (-658.061) (-642.740) -- 0:01:41
38500 -- [-646.935] (-647.267) (-650.055) (-659.662) * [-637.700] (-645.414) (-661.979) (-646.773) -- 0:01:39
39000 -- (-641.676) [-646.492] (-643.688) (-660.129) * (-641.651) [-650.989] (-662.803) (-650.881) -- 0:01:38
39500 -- (-658.281) [-647.161] (-640.508) (-642.094) * [-640.701] (-643.895) (-648.049) (-642.864) -- 0:01:37
40000 -- [-647.950] (-646.952) (-645.872) (-654.101) * (-645.665) (-658.789) (-661.177) [-646.821] -- 0:01:36
Average standard deviation of split frequencies: 0.038436
40500 -- (-641.480) (-646.681) [-644.991] (-656.166) * [-644.737] (-657.132) (-652.054) (-643.704) -- 0:01:34
41000 -- [-646.004] (-646.106) (-643.487) (-660.992) * [-642.933] (-660.818) (-651.378) (-646.845) -- 0:01:33
41500 -- (-643.246) (-644.074) [-639.940] (-653.309) * (-652.869) (-658.049) (-657.775) [-648.724] -- 0:01:32
42000 -- (-653.603) (-647.837) [-644.443] (-648.872) * (-644.116) [-647.303] (-658.746) (-652.362) -- 0:01:31
42500 -- (-656.627) [-645.255] (-645.837) (-646.569) * (-642.433) (-649.805) (-655.114) [-643.115] -- 0:01:30
43000 -- (-646.760) (-649.545) [-641.620] (-644.889) * [-647.829] (-651.675) (-653.675) (-649.487) -- 0:01:29
43500 -- (-649.825) [-645.104] (-649.584) (-670.639) * [-646.064] (-649.084) (-651.419) (-647.216) -- 0:01:27
44000 -- (-656.582) [-644.308] (-658.045) (-660.971) * (-642.005) [-638.043] (-665.244) (-650.789) -- 0:01:26
44500 -- (-658.554) [-643.620] (-645.962) (-655.718) * (-638.803) [-643.986] (-650.770) (-647.100) -- 0:01:25
45000 -- (-645.794) (-651.043) [-639.312] (-650.924) * (-642.360) (-657.856) [-645.289] (-645.043) -- 0:01:24
Average standard deviation of split frequencies: 0.034470
45500 -- (-646.506) (-649.042) [-643.819] (-653.722) * (-642.686) (-650.444) [-646.338] (-649.223) -- 0:01:23
46000 -- (-657.776) (-644.755) [-645.791] (-659.791) * [-646.863] (-649.579) (-641.059) (-648.848) -- 0:01:22
46500 -- [-640.403] (-650.486) (-640.667) (-655.745) * [-643.638] (-657.153) (-657.434) (-648.262) -- 0:01:22
47000 -- (-648.894) [-643.376] (-647.589) (-657.732) * (-639.666) (-646.946) (-650.806) [-643.247] -- 0:01:21
47500 -- [-648.783] (-649.100) (-644.269) (-657.350) * (-645.760) [-648.845] (-652.242) (-646.418) -- 0:01:20
48000 -- [-641.284] (-647.720) (-644.313) (-656.571) * (-636.594) (-660.403) (-646.724) [-643.954] -- 0:01:19
48500 -- (-649.507) (-645.291) [-645.133] (-657.492) * (-643.077) (-662.300) (-654.643) [-649.874] -- 0:01:38
49000 -- (-644.051) (-644.220) [-637.629] (-665.954) * [-638.122] (-649.219) (-647.076) (-651.447) -- 0:01:37
49500 -- [-638.591] (-642.713) (-648.721) (-660.481) * (-638.872) (-660.633) (-655.506) [-646.055] -- 0:01:36
50000 -- (-638.432) [-644.207] (-642.690) (-661.648) * [-639.395] (-659.845) (-649.976) (-655.747) -- 0:01:35
Average standard deviation of split frequencies: 0.032564
50500 -- (-641.482) (-640.518) [-642.096] (-659.149) * [-641.852] (-657.259) (-647.221) (-640.718) -- 0:01:34
51000 -- (-649.330) [-638.689] (-642.067) (-665.838) * (-644.400) (-658.106) [-644.361] (-648.485) -- 0:01:33
51500 -- (-648.473) [-640.290] (-657.410) (-657.952) * (-643.226) (-657.376) [-641.000] (-650.464) -- 0:01:32
52000 -- (-651.549) [-638.418] (-636.840) (-653.580) * [-640.581] (-658.827) (-650.764) (-653.005) -- 0:01:31
52500 -- (-642.955) (-641.616) [-641.253] (-654.684) * [-646.373] (-653.217) (-662.890) (-650.431) -- 0:01:30
53000 -- [-647.059] (-644.398) (-660.715) (-656.291) * (-645.257) [-640.360] (-653.336) (-655.771) -- 0:01:29
53500 -- [-646.175] (-645.025) (-668.189) (-650.151) * (-652.056) (-642.357) (-643.476) [-646.774] -- 0:01:28
54000 -- [-644.452] (-644.845) (-654.271) (-663.904) * (-642.902) [-641.067] (-656.019) (-657.062) -- 0:01:27
54500 -- (-648.339) (-641.003) [-641.935] (-643.895) * (-654.558) [-636.636] (-657.503) (-647.813) -- 0:01:26
55000 -- (-645.652) (-641.839) [-662.378] (-644.507) * [-640.907] (-645.342) (-663.171) (-644.735) -- 0:01:25
Average standard deviation of split frequencies: 0.036773
55500 -- (-650.533) [-641.709] (-656.218) (-641.487) * (-645.632) (-645.152) (-655.207) [-640.302] -- 0:01:25
56000 -- (-659.638) [-645.459] (-658.172) (-639.745) * [-639.743] (-647.511) (-650.845) (-645.043) -- 0:01:24
56500 -- [-655.602] (-652.898) (-652.719) (-655.163) * [-644.642] (-649.209) (-659.379) (-643.897) -- 0:01:23
57000 -- (-662.391) [-648.050] (-654.762) (-647.630) * [-640.383] (-643.035) (-642.446) (-641.432) -- 0:01:22
57500 -- [-652.645] (-648.309) (-663.196) (-653.746) * (-640.172) (-646.862) (-646.059) [-641.709] -- 0:01:21
58000 -- (-662.487) [-642.590] (-653.899) (-658.543) * [-637.369] (-645.270) (-648.525) (-640.421) -- 0:01:21
58500 -- (-657.821) [-643.721] (-656.072) (-654.472) * (-656.793) [-654.382] (-648.533) (-646.757) -- 0:01:20
59000 -- (-664.000) [-638.705] (-656.384) (-662.390) * (-642.049) (-642.559) (-649.751) [-636.832] -- 0:01:19
59500 -- (-671.014) (-642.435) (-656.767) [-653.854] * (-638.822) [-640.975] (-657.489) (-642.905) -- 0:01:34
60000 -- (-655.401) [-641.731] (-648.731) (-662.013) * [-643.167] (-660.039) (-643.208) (-645.420) -- 0:01:34
Average standard deviation of split frequencies: 0.033824
60500 -- (-648.154) [-638.812] (-646.713) (-645.361) * (-654.333) (-646.429) (-642.069) [-649.397] -- 0:01:33
61000 -- (-659.293) [-636.057] (-641.583) (-655.940) * (-648.798) (-641.197) [-644.415] (-654.008) -- 0:01:32
61500 -- (-644.738) (-639.136) (-648.814) [-640.530] * (-641.903) [-636.888] (-652.065) (-654.154) -- 0:01:31
62000 -- (-658.913) [-642.682] (-663.366) (-638.855) * [-643.545] (-648.669) (-644.139) (-645.736) -- 0:01:30
62500 -- (-657.184) [-639.695] (-642.500) (-649.910) * [-644.971] (-644.708) (-646.672) (-651.087) -- 0:01:30
63000 -- (-650.925) (-642.331) [-645.129] (-639.918) * (-644.551) (-643.136) [-648.797] (-654.058) -- 0:01:29
63500 -- (-659.299) (-647.225) [-639.047] (-662.283) * (-641.474) (-655.913) [-646.255] (-646.284) -- 0:01:28
64000 -- (-650.497) [-644.277] (-643.143) (-654.530) * (-646.744) [-661.200] (-646.037) (-648.312) -- 0:01:27
64500 -- (-649.474) (-650.060) [-640.579] (-653.545) * (-639.817) [-647.533] (-649.128) (-658.967) -- 0:01:27
65000 -- (-643.959) [-639.391] (-642.373) (-637.416) * (-646.981) (-656.374) (-647.902) [-647.270] -- 0:01:26
Average standard deviation of split frequencies: 0.032651
65500 -- (-651.165) [-645.314] (-647.779) (-643.096) * (-649.407) (-651.544) [-652.904] (-647.582) -- 0:01:25
66000 -- (-646.749) [-641.278] (-643.115) (-640.819) * (-648.549) [-646.513] (-641.651) (-647.930) -- 0:01:24
66500 -- (-649.317) (-634.648) [-641.678] (-652.626) * (-646.814) (-658.617) (-645.486) [-641.293] -- 0:01:24
67000 -- (-654.583) [-647.343] (-646.189) (-650.909) * (-647.914) (-651.242) (-650.725) [-643.750] -- 0:01:23
67500 -- (-650.210) [-639.742] (-648.803) (-664.144) * [-644.364] (-654.133) (-653.262) (-644.323) -- 0:01:22
68000 -- (-656.948) (-643.352) (-652.532) [-637.497] * [-642.230] (-659.569) (-642.822) (-651.001) -- 0:01:22
68500 -- (-667.662) (-647.951) (-648.921) [-647.157] * (-646.033) (-657.679) (-646.406) [-656.274] -- 0:01:21
69000 -- (-649.843) (-643.273) [-644.011] (-645.431) * (-646.500) [-640.466] (-647.807) (-652.401) -- 0:01:20
69500 -- (-644.124) [-639.525] (-656.271) (-649.486) * (-652.714) (-665.161) (-642.361) [-656.490] -- 0:01:20
70000 -- (-652.632) [-640.205] (-661.628) (-638.766) * (-648.905) (-644.791) [-652.394] (-657.840) -- 0:01:19
Average standard deviation of split frequencies: 0.028685
70500 -- (-645.501) (-643.909) [-640.723] (-648.786) * [-641.189] (-646.556) (-642.534) (-656.701) -- 0:01:19
71000 -- (-639.146) (-640.872) [-645.326] (-642.486) * [-643.931] (-644.648) (-659.635) (-665.217) -- 0:01:31
71500 -- (-650.482) (-645.371) (-651.949) [-645.187] * [-646.994] (-650.682) (-645.921) (-651.769) -- 0:01:30
72000 -- (-665.422) (-641.249) [-651.896] (-649.375) * (-651.263) [-641.746] (-648.436) (-654.339) -- 0:01:30
72500 -- [-650.760] (-645.587) (-650.631) (-644.989) * (-646.767) (-642.874) (-658.175) [-656.155] -- 0:01:29
73000 -- (-673.345) [-642.626] (-648.331) (-647.678) * (-644.101) [-643.793] (-664.562) (-652.049) -- 0:01:28
73500 -- (-648.451) [-638.148] (-649.934) (-653.580) * (-645.438) (-650.051) [-649.288] (-653.204) -- 0:01:28
74000 -- (-658.072) [-644.218] (-655.771) (-644.104) * (-645.004) [-644.579] (-645.783) (-654.569) -- 0:01:27
74500 -- (-647.993) [-648.430] (-645.899) (-643.513) * (-649.752) [-638.648] (-646.229) (-656.368) -- 0:01:26
75000 -- (-642.801) (-639.923) [-643.957] (-646.719) * [-643.060] (-656.140) (-647.578) (-653.379) -- 0:01:26
Average standard deviation of split frequencies: 0.032786
75500 -- (-652.493) [-639.805] (-644.575) (-655.743) * (-638.586) [-645.525] (-652.786) (-645.441) -- 0:01:25
76000 -- (-650.778) (-645.582) (-644.332) [-654.931] * [-645.334] (-643.764) (-654.665) (-643.236) -- 0:01:25
76500 -- (-647.606) [-643.924] (-642.576) (-656.716) * [-640.871] (-647.464) (-655.815) (-643.395) -- 0:01:24
77000 -- (-640.801) (-643.085) [-648.385] (-657.890) * [-649.065] (-655.126) (-654.281) (-648.997) -- 0:01:23
77500 -- [-644.502] (-644.148) (-639.605) (-668.587) * [-640.883] (-650.142) (-649.642) (-642.930) -- 0:01:23
78000 -- (-644.474) [-641.117] (-647.403) (-659.534) * [-645.332] (-647.865) (-654.517) (-650.518) -- 0:01:22
78500 -- (-642.914) [-645.215] (-646.250) (-671.397) * (-649.950) [-649.094] (-651.643) (-662.617) -- 0:01:22
79000 -- (-651.276) (-640.933) [-647.361] (-660.854) * (-650.066) (-646.936) [-656.363] (-661.731) -- 0:01:21
79500 -- (-654.635) [-648.344] (-647.900) (-646.607) * (-652.069) (-644.266) [-648.315] (-656.587) -- 0:01:21
80000 -- (-648.042) [-651.792] (-640.330) (-659.771) * (-652.032) [-640.346] (-659.048) (-654.307) -- 0:01:20
Average standard deviation of split frequencies: 0.035388
80500 -- (-643.653) [-644.398] (-649.355) (-659.078) * (-647.393) [-654.072] (-646.347) (-655.854) -- 0:01:19
81000 -- (-655.039) (-646.500) [-647.002] (-647.749) * (-641.869) (-658.826) (-643.809) [-641.955] -- 0:01:19
81500 -- (-657.673) (-650.321) (-660.136) [-646.509] * (-652.604) (-656.543) (-646.162) [-641.916] -- 0:01:18
82000 -- (-656.120) [-642.640] (-646.045) (-643.283) * (-648.885) (-654.123) [-644.278] (-646.793) -- 0:01:29
82500 -- (-654.752) [-645.559] (-660.163) (-652.519) * (-645.138) [-647.470] (-649.694) (-647.105) -- 0:01:28
83000 -- (-648.458) [-638.230] (-656.375) (-651.738) * (-662.306) [-642.672] (-652.371) (-651.305) -- 0:01:28
83500 -- (-660.616) [-643.973] (-653.258) (-644.883) * (-651.432) [-645.505] (-655.273) (-647.597) -- 0:01:27
84000 -- (-650.214) [-642.150] (-652.186) (-656.095) * (-646.974) (-638.801) [-656.140] (-650.448) -- 0:01:27
84500 -- (-652.790) [-645.184] (-646.219) (-647.774) * (-653.274) [-643.257] (-657.141) (-645.136) -- 0:01:26
85000 -- (-654.511) [-644.601] (-647.170) (-639.969) * (-648.329) (-662.377) (-665.038) [-649.998] -- 0:01:26
Average standard deviation of split frequencies: 0.032023
85500 -- (-647.364) (-646.628) [-639.229] (-651.230) * (-656.179) (-654.405) (-655.233) [-650.668] -- 0:01:25
86000 -- (-667.888) (-647.875) [-646.094] (-644.008) * (-651.318) (-650.900) (-653.719) [-647.164] -- 0:01:25
86500 -- (-651.861) (-646.834) [-650.060] (-644.798) * [-646.214] (-656.413) (-645.969) (-640.980) -- 0:01:24
87000 -- (-652.989) (-644.002) (-642.941) [-641.992] * (-658.381) (-645.070) (-654.534) [-641.477] -- 0:01:23
87500 -- (-657.901) (-653.506) (-646.035) [-641.960] * (-656.209) (-656.475) (-657.455) [-649.805] -- 0:01:23
88000 -- [-641.152] (-648.566) (-642.814) (-649.801) * [-645.260] (-647.606) (-650.300) (-655.091) -- 0:01:22
88500 -- [-644.147] (-652.474) (-641.733) (-646.992) * (-651.650) (-643.856) [-646.103] (-660.253) -- 0:01:22
89000 -- (-648.287) (-649.425) [-645.122] (-646.277) * [-648.111] (-646.620) (-643.507) (-651.078) -- 0:01:21
89500 -- (-649.370) (-648.274) (-643.734) [-644.187] * (-655.553) [-652.686] (-644.228) (-648.265) -- 0:01:21
90000 -- (-648.148) (-656.371) [-643.488] (-644.728) * (-654.345) [-644.712] (-658.928) (-649.530) -- 0:01:20
Average standard deviation of split frequencies: 0.026257
90500 -- (-645.973) (-660.006) (-641.657) [-640.265] * (-654.661) (-659.120) [-646.367] (-646.423) -- 0:01:20
91000 -- (-648.559) (-652.502) (-642.998) [-637.776] * [-642.058] (-646.951) (-646.411) (-664.077) -- 0:01:19
91500 -- (-647.411) (-655.516) (-647.619) [-646.730] * (-643.659) [-642.846] (-652.064) (-647.939) -- 0:01:19
92000 -- (-647.544) (-651.880) (-643.363) [-639.158] * [-641.973] (-646.788) (-641.996) (-661.532) -- 0:01:18
92500 -- (-649.593) (-645.842) (-644.819) [-642.132] * (-646.806) (-647.207) (-651.357) [-643.162] -- 0:01:18
93000 -- (-643.569) (-649.858) (-647.548) [-637.685] * (-655.990) (-646.532) (-660.926) [-644.999] -- 0:01:18
93500 -- (-657.896) [-651.666] (-642.434) (-643.138) * (-659.085) [-650.797] (-648.201) (-643.172) -- 0:01:27
94000 -- (-662.218) [-642.703] (-658.005) (-639.809) * (-654.989) [-645.555] (-647.657) (-639.144) -- 0:01:26
94500 -- (-643.292) (-656.476) (-654.250) [-646.666] * (-662.386) (-654.503) (-645.099) [-635.356] -- 0:01:26
95000 -- (-646.607) [-646.843] (-646.992) (-644.037) * (-662.869) (-650.558) [-650.935] (-645.239) -- 0:01:25
Average standard deviation of split frequencies: 0.026025
95500 -- [-646.856] (-642.316) (-655.016) (-654.342) * (-659.154) (-646.652) (-641.506) [-649.933] -- 0:01:25
96000 -- (-645.205) (-652.097) [-642.778] (-655.842) * (-657.734) (-652.521) (-646.905) [-638.951] -- 0:01:24
96500 -- [-646.475] (-655.997) (-643.617) (-649.727) * (-664.281) (-652.924) [-650.279] (-641.266) -- 0:01:24
97000 -- (-648.695) [-641.744] (-650.799) (-656.801) * (-657.927) (-639.743) (-646.014) [-641.729] -- 0:01:23
97500 -- (-647.116) [-642.209] (-657.801) (-651.405) * (-666.597) [-641.638] (-652.967) (-641.267) -- 0:01:23
98000 -- [-653.649] (-654.963) (-645.667) (-663.339) * (-669.286) [-650.324] (-639.689) (-644.874) -- 0:01:22
98500 -- (-649.703) (-647.483) [-643.211] (-653.660) * (-646.368) (-644.737) (-645.804) [-645.012] -- 0:01:22
99000 -- (-653.334) (-647.572) (-651.518) [-646.735] * (-654.288) (-640.393) (-655.493) [-641.121] -- 0:01:21
99500 -- [-638.822] (-656.704) (-659.435) (-651.675) * (-648.794) [-649.425] (-653.671) (-638.208) -- 0:01:21
100000 -- (-642.888) (-659.194) [-638.470] (-660.802) * (-656.961) (-640.872) (-653.179) [-643.949] -- 0:01:21
Average standard deviation of split frequencies: 0.024585
100500 -- [-640.485] (-653.147) (-653.827) (-650.692) * (-651.368) (-647.735) (-653.053) [-636.316] -- 0:01:20
101000 -- (-647.995) (-656.047) (-657.612) [-640.387] * (-649.973) (-648.010) [-652.654] (-646.896) -- 0:01:20
101500 -- [-639.621] (-653.243) (-657.865) (-649.296) * (-651.301) (-644.884) (-652.790) [-643.528] -- 0:01:19
102000 -- (-637.921) (-663.287) [-643.945] (-651.123) * (-653.713) (-646.407) (-643.535) [-643.771] -- 0:01:19
102500 -- [-644.424] (-647.771) (-659.944) (-661.544) * (-649.613) [-641.437] (-651.323) (-643.088) -- 0:01:18
103000 -- [-639.604] (-656.043) (-663.373) (-660.535) * (-647.530) (-653.345) [-651.333] (-645.690) -- 0:01:18
103500 -- [-640.288] (-640.346) (-647.248) (-643.941) * (-645.559) [-642.627] (-654.219) (-641.000) -- 0:01:17
104000 -- (-641.273) (-646.586) (-669.191) [-649.325] * (-645.264) (-657.803) (-646.768) [-638.628] -- 0:01:17
104500 -- (-651.312) (-645.242) [-644.956] (-646.326) * (-646.313) (-653.734) (-655.446) [-635.651] -- 0:01:25
105000 -- [-640.155] (-647.814) (-651.005) (-646.016) * [-654.979] (-654.112) (-647.113) (-649.436) -- 0:01:25
Average standard deviation of split frequencies: 0.026048
105500 -- [-644.728] (-650.109) (-645.528) (-663.923) * [-644.366] (-640.659) (-658.523) (-647.390) -- 0:01:24
106000 -- (-648.253) [-652.720] (-659.858) (-652.738) * (-660.834) [-642.873] (-650.507) (-644.086) -- 0:01:24
106500 -- (-651.777) [-641.280] (-653.680) (-654.642) * (-647.411) (-654.627) (-652.062) [-637.689] -- 0:01:23
107000 -- (-652.824) [-640.289] (-660.624) (-644.845) * (-647.645) (-644.882) (-645.138) [-634.896] -- 0:01:23
107500 -- [-643.863] (-650.319) (-657.415) (-646.149) * (-647.485) (-638.654) (-662.713) [-638.079] -- 0:01:23
108000 -- (-645.338) (-658.899) (-653.342) [-643.564] * (-639.508) (-643.379) (-647.710) [-641.210] -- 0:01:22
108500 -- (-663.694) (-650.257) (-657.588) [-643.934] * (-651.972) (-653.448) (-656.112) [-641.133] -- 0:01:22
109000 -- (-645.714) [-647.207] (-653.414) (-641.142) * (-654.674) [-649.100] (-665.931) (-647.645) -- 0:01:21
109500 -- (-651.488) (-656.774) (-648.040) [-645.317] * (-656.442) (-647.826) (-655.736) [-640.958] -- 0:01:21
110000 -- (-647.474) [-657.744] (-649.440) (-653.173) * (-652.303) [-641.191] (-659.453) (-644.211) -- 0:01:20
Average standard deviation of split frequencies: 0.024885
110500 -- (-653.250) (-657.934) [-647.250] (-649.569) * (-642.625) (-642.758) (-658.157) [-637.993] -- 0:01:20
111000 -- (-655.859) (-651.099) [-643.597] (-653.222) * [-647.544] (-644.833) (-654.360) (-641.127) -- 0:01:20
111500 -- (-665.119) (-663.547) [-641.675] (-648.249) * (-653.775) (-643.831) (-650.011) [-643.793] -- 0:01:19
112000 -- (-651.943) (-661.671) (-647.478) [-648.148] * (-650.053) (-645.691) (-655.795) [-638.150] -- 0:01:19
112500 -- (-653.171) [-648.302] (-652.298) (-653.544) * (-652.211) (-641.565) (-651.002) [-640.109] -- 0:01:18
113000 -- (-658.348) (-649.276) [-648.578] (-656.636) * (-648.623) (-642.962) (-654.365) [-644.770] -- 0:01:18
113500 -- (-656.467) (-649.900) [-649.233] (-641.684) * (-641.625) (-650.732) (-642.437) [-640.933] -- 0:01:18
114000 -- (-661.350) (-655.792) [-652.847] (-647.906) * (-647.857) [-642.215] (-651.297) (-641.859) -- 0:01:17
114500 -- (-652.026) (-649.706) (-641.364) [-641.831] * (-651.332) (-643.073) (-647.638) [-638.766] -- 0:01:17
115000 -- (-662.241) (-650.309) [-646.357] (-639.557) * (-640.841) (-639.196) (-644.021) [-637.793] -- 0:01:16
Average standard deviation of split frequencies: 0.022577
115500 -- (-653.583) (-660.633) [-642.822] (-643.031) * (-654.480) (-645.199) (-646.277) [-643.944] -- 0:01:16
116000 -- [-642.776] (-654.405) (-641.806) (-655.303) * [-646.676] (-652.396) (-646.473) (-636.897) -- 0:01:23
116500 -- (-647.571) (-657.622) [-646.933] (-650.941) * (-650.103) (-650.860) [-642.651] (-642.552) -- 0:01:23
117000 -- [-642.516] (-648.661) (-646.811) (-651.167) * (-654.766) (-660.566) (-642.317) [-643.727] -- 0:01:23
117500 -- (-650.250) (-659.921) (-650.269) [-653.314] * [-654.292] (-660.273) (-651.663) (-649.580) -- 0:01:22
118000 -- (-657.764) (-654.740) [-638.968] (-645.611) * (-659.089) [-645.772] (-651.456) (-642.946) -- 0:01:22
118500 -- (-661.610) (-648.479) [-645.252] (-641.047) * (-661.932) (-652.486) (-654.089) [-646.091] -- 0:01:21
119000 -- (-659.850) (-648.385) [-639.725] (-651.937) * (-651.405) [-645.977] (-654.761) (-641.403) -- 0:01:21
119500 -- (-656.792) (-654.386) [-644.512] (-645.971) * (-643.846) [-640.177] (-648.186) (-649.049) -- 0:01:21
120000 -- (-658.617) (-651.494) [-644.891] (-646.183) * (-644.105) (-645.039) (-656.842) [-637.787] -- 0:01:20
Average standard deviation of split frequencies: 0.020401
120500 -- (-656.321) [-647.329] (-647.258) (-646.140) * [-642.577] (-647.911) (-655.990) (-639.490) -- 0:01:20
121000 -- (-656.517) (-646.216) [-643.490] (-651.707) * (-646.423) (-640.387) [-640.990] (-645.686) -- 0:01:19
121500 -- (-648.845) (-654.246) (-654.869) [-643.343] * (-646.521) [-652.884] (-663.157) (-644.723) -- 0:01:19
122000 -- (-643.136) (-660.512) (-643.460) [-646.689] * (-653.851) (-652.491) (-646.313) [-646.728] -- 0:01:19
122500 -- [-650.175] (-650.970) (-643.840) (-663.280) * (-649.896) (-660.375) (-656.584) [-637.368] -- 0:01:18
123000 -- [-648.688] (-652.827) (-648.043) (-654.553) * [-648.186] (-650.240) (-649.011) (-634.797) -- 0:01:18
123500 -- (-663.167) (-653.728) [-642.698] (-644.064) * (-642.651) (-648.402) (-645.877) [-646.322] -- 0:01:18
124000 -- (-655.918) (-657.221) (-659.766) [-647.548] * (-654.959) (-647.724) (-661.832) [-645.585] -- 0:01:17
124500 -- [-645.091] (-653.056) (-654.598) (-643.759) * (-649.563) (-655.643) (-653.660) [-644.386] -- 0:01:17
125000 -- (-661.103) (-660.154) (-660.150) [-647.334] * [-640.545] (-656.906) (-651.342) (-647.245) -- 0:01:17
Average standard deviation of split frequencies: 0.017771
125500 -- (-654.401) (-659.313) (-658.794) [-640.333] * (-644.388) (-657.252) (-641.743) [-642.517] -- 0:01:16
126000 -- (-645.016) (-642.911) [-638.995] (-651.853) * [-639.716] (-647.156) (-650.607) (-646.020) -- 0:01:16
126500 -- (-647.730) [-647.528] (-651.761) (-648.468) * (-647.310) (-646.989) (-646.285) [-642.922] -- 0:01:15
127000 -- [-655.865] (-663.629) (-655.153) (-640.599) * (-652.587) [-646.664] (-653.792) (-637.059) -- 0:01:22
127500 -- (-653.460) (-657.501) (-649.654) [-654.790] * (-663.284) (-660.931) (-649.342) [-640.441] -- 0:01:22
128000 -- (-654.249) (-649.747) (-661.127) [-648.000] * (-646.926) (-660.905) (-655.943) [-642.686] -- 0:01:21
128500 -- [-651.793] (-643.977) (-663.386) (-660.491) * (-664.425) (-652.023) (-649.132) [-639.893] -- 0:01:21
129000 -- (-649.680) [-644.919] (-654.867) (-658.077) * (-657.032) [-647.503] (-653.788) (-641.643) -- 0:01:21
129500 -- (-654.130) (-648.679) (-649.269) [-647.862] * [-651.482] (-647.889) (-647.974) (-644.411) -- 0:01:20
130000 -- (-648.811) (-644.720) (-650.551) [-648.329] * (-655.371) (-652.447) (-646.523) [-639.280] -- 0:01:20
Average standard deviation of split frequencies: 0.019948
130500 -- [-641.538] (-645.672) (-649.815) (-651.302) * (-655.833) (-650.596) (-657.367) [-635.664] -- 0:01:19
131000 -- [-653.066] (-645.379) (-652.989) (-649.636) * (-657.819) [-641.361] (-649.114) (-645.079) -- 0:01:19
131500 -- [-641.581] (-651.982) (-656.620) (-647.982) * (-659.452) (-648.682) [-640.767] (-641.709) -- 0:01:19
132000 -- [-638.923] (-646.101) (-655.074) (-650.408) * (-658.729) [-639.397] (-658.883) (-652.748) -- 0:01:18
132500 -- (-642.764) [-647.548] (-655.714) (-666.400) * (-655.602) [-642.083] (-665.529) (-639.952) -- 0:01:18
133000 -- (-643.025) [-649.557] (-651.995) (-660.830) * (-654.214) (-653.534) [-643.569] (-638.326) -- 0:01:18
133500 -- (-653.918) [-644.338] (-645.767) (-656.493) * (-656.907) (-651.443) [-649.559] (-642.212) -- 0:01:17
134000 -- (-648.369) (-656.277) (-659.249) [-643.972] * (-652.885) [-639.000] (-653.929) (-641.691) -- 0:01:17
134500 -- (-649.793) (-648.558) [-642.849] (-647.393) * [-649.954] (-647.794) (-666.362) (-640.775) -- 0:01:17
135000 -- (-650.974) (-654.202) [-651.600] (-644.362) * (-644.463) [-647.327] (-657.966) (-649.593) -- 0:01:16
Average standard deviation of split frequencies: 0.018758
135500 -- (-643.769) (-650.178) [-644.632] (-659.866) * (-643.933) (-654.933) (-663.778) [-641.704] -- 0:01:16
136000 -- [-644.728] (-653.004) (-649.207) (-652.281) * [-642.249] (-643.590) (-656.153) (-636.650) -- 0:01:16
136500 -- (-652.600) (-650.514) [-641.933] (-649.735) * (-643.528) [-642.628] (-649.202) (-639.720) -- 0:01:15
137000 -- (-654.241) [-643.102] (-643.583) (-651.495) * (-658.003) [-647.272] (-648.805) (-644.986) -- 0:01:15
137500 -- (-656.961) [-642.521] (-648.906) (-646.369) * (-668.125) (-653.167) (-661.175) [-639.461] -- 0:01:15
138000 -- (-650.679) (-658.906) (-652.016) [-642.826] * (-653.039) (-656.949) (-662.767) [-647.455] -- 0:01:14
138500 -- (-657.123) (-664.078) (-645.920) [-653.138] * (-650.150) (-654.453) (-656.482) [-643.895] -- 0:01:20
139000 -- (-660.254) (-654.177) (-650.834) [-651.553] * [-647.207] (-655.241) (-659.553) (-635.604) -- 0:01:20
139500 -- (-645.786) (-655.083) (-650.523) [-643.600] * (-642.371) (-643.383) (-651.891) [-644.348] -- 0:01:20
140000 -- (-650.698) (-655.973) (-646.014) [-640.606] * (-654.135) (-659.998) (-659.249) [-641.477] -- 0:01:19
Average standard deviation of split frequencies: 0.019122
140500 -- [-658.969] (-658.993) (-652.451) (-640.791) * (-652.226) [-648.828] (-660.071) (-641.228) -- 0:01:19
141000 -- [-649.655] (-647.524) (-648.125) (-646.794) * (-659.173) [-640.209] (-662.070) (-640.694) -- 0:01:19
141500 -- [-651.473] (-656.336) (-642.534) (-642.552) * [-650.197] (-641.718) (-655.366) (-637.822) -- 0:01:18
142000 -- (-646.956) (-645.719) (-654.914) [-650.868] * (-647.374) (-655.188) (-653.333) [-644.639] -- 0:01:18
142500 -- (-647.273) (-652.251) (-659.087) [-644.685] * [-640.992] (-648.051) (-649.778) (-643.141) -- 0:01:18
143000 -- (-647.318) (-652.520) (-653.089) [-640.120] * [-642.029] (-646.823) (-638.530) (-643.423) -- 0:01:17
143500 -- (-657.399) (-651.326) (-642.910) [-638.219] * [-648.334] (-650.019) (-644.709) (-640.313) -- 0:01:17
144000 -- (-654.578) [-647.076] (-647.248) (-656.807) * (-658.919) (-647.757) (-648.269) [-645.910] -- 0:01:17
144500 -- (-656.683) (-648.744) (-641.803) [-647.115] * (-657.209) (-655.101) (-643.412) [-639.051] -- 0:01:16
145000 -- (-644.317) (-657.821) (-648.547) [-642.903] * (-657.767) (-659.682) (-652.975) [-642.033] -- 0:01:16
Average standard deviation of split frequencies: 0.019183
145500 -- (-650.241) (-651.798) [-650.346] (-645.691) * (-666.821) [-647.915] (-647.564) (-640.514) -- 0:01:16
146000 -- (-657.747) (-652.428) (-649.299) [-650.328] * (-651.635) (-645.360) (-651.623) [-635.029] -- 0:01:16
146500 -- [-650.025] (-660.236) (-642.430) (-646.952) * (-657.763) (-649.938) (-649.769) [-644.662] -- 0:01:15
147000 -- (-644.377) (-651.696) [-649.281] (-657.360) * (-657.155) (-653.411) (-646.208) [-634.925] -- 0:01:15
147500 -- (-648.926) (-652.794) [-645.848] (-645.923) * (-654.750) (-643.393) (-645.353) [-641.034] -- 0:01:15
148000 -- (-651.201) [-646.353] (-649.611) (-652.856) * (-656.178) (-655.123) (-644.175) [-640.579] -- 0:01:14
148500 -- (-648.540) (-668.622) [-642.634] (-650.144) * (-662.087) (-656.063) (-648.468) [-638.921] -- 0:01:14
149000 -- (-645.772) (-647.804) (-651.201) [-645.409] * (-656.756) (-652.736) (-645.309) [-640.711] -- 0:01:14
149500 -- [-640.966] (-649.165) (-652.759) (-652.407) * (-660.452) (-665.684) (-652.007) [-643.174] -- 0:01:13
150000 -- [-647.747] (-652.795) (-648.529) (-645.111) * (-660.807) (-657.472) (-664.954) [-639.852] -- 0:01:19
Average standard deviation of split frequencies: 0.017035
150500 -- (-657.643) (-646.186) (-656.643) [-644.588] * (-642.645) (-659.605) (-652.543) [-640.420] -- 0:01:19
151000 -- (-655.648) (-656.400) (-645.108) [-644.000] * [-651.568] (-662.823) (-660.919) (-642.763) -- 0:01:18
151500 -- (-652.360) [-657.774] (-649.551) (-644.864) * [-642.905] (-657.759) (-651.102) (-648.643) -- 0:01:18
152000 -- [-642.793] (-651.198) (-649.587) (-643.035) * (-646.692) (-650.753) (-653.378) [-654.739] -- 0:01:18
152500 -- (-656.268) [-646.933] (-650.087) (-646.395) * (-647.399) (-644.721) (-651.496) [-641.188] -- 0:01:17
153000 -- [-651.244] (-643.803) (-652.692) (-638.020) * (-649.307) [-642.074] (-652.512) (-647.519) -- 0:01:17
153500 -- (-644.385) (-667.274) (-647.779) [-642.238] * (-650.809) (-643.777) (-643.988) [-640.904] -- 0:01:17
154000 -- (-648.421) (-648.434) (-648.504) [-639.567] * (-664.036) (-647.263) [-646.361] (-652.094) -- 0:01:16
154500 -- (-653.286) (-645.205) (-649.817) [-637.902] * (-660.434) (-637.627) (-651.107) [-642.072] -- 0:01:16
155000 -- (-653.591) (-646.816) (-644.794) [-638.080] * (-657.049) [-642.797] (-644.256) (-643.689) -- 0:01:16
Average standard deviation of split frequencies: 0.016284
155500 -- (-657.738) (-647.074) [-651.808] (-643.434) * (-647.355) (-642.710) [-646.733] (-640.585) -- 0:01:16
156000 -- (-653.342) (-647.680) (-646.023) [-636.307] * (-663.438) [-646.505] (-656.449) (-656.909) -- 0:01:15
156500 -- (-652.630) (-649.734) (-648.512) [-635.860] * (-657.001) [-640.500] (-649.061) (-650.312) -- 0:01:15
157000 -- (-654.759) (-651.521) (-657.425) [-641.602] * (-651.894) [-643.954] (-653.322) (-656.248) -- 0:01:15
157500 -- (-646.473) (-644.129) (-642.828) [-644.817] * [-643.201] (-645.060) (-648.087) (-650.971) -- 0:01:14
158000 -- (-647.085) (-649.847) [-647.721] (-645.339) * (-654.321) (-640.787) (-651.060) [-642.445] -- 0:01:14
158500 -- [-652.970] (-644.533) (-654.968) (-645.385) * (-639.934) (-657.880) [-647.071] (-641.162) -- 0:01:14
159000 -- (-649.575) (-652.587) [-650.742] (-652.319) * [-648.385] (-654.035) (-647.442) (-651.862) -- 0:01:14
159500 -- [-651.705] (-655.878) (-643.957) (-648.846) * (-650.421) (-653.691) [-646.672] (-643.749) -- 0:01:13
160000 -- (-647.750) (-654.350) (-647.811) [-641.880] * (-651.605) (-655.065) [-644.365] (-640.429) -- 0:01:13
Average standard deviation of split frequencies: 0.016626
160500 -- (-667.493) [-644.119] (-644.885) (-651.413) * (-656.059) (-651.802) [-643.692] (-648.863) -- 0:01:13
161000 -- (-657.427) [-648.691] (-638.047) (-652.377) * (-649.054) (-639.848) (-643.563) [-650.129] -- 0:01:12
161500 -- (-650.608) [-645.699] (-637.203) (-666.494) * (-664.398) (-659.753) [-643.998] (-641.583) -- 0:01:17
162000 -- (-641.069) [-640.984] (-646.530) (-641.278) * (-649.675) (-664.129) [-644.133] (-645.294) -- 0:01:17
162500 -- (-657.381) (-642.761) [-645.996] (-643.792) * [-646.444] (-647.187) (-654.383) (-658.260) -- 0:01:17
163000 -- (-663.476) [-650.124] (-642.428) (-651.291) * (-652.562) (-648.580) (-646.289) [-643.374] -- 0:01:17
163500 -- (-648.513) (-643.111) (-643.952) [-650.025] * (-649.832) (-651.613) [-642.654] (-647.979) -- 0:01:16
164000 -- (-652.883) [-643.743] (-658.136) (-651.915) * (-663.893) [-640.139] (-646.184) (-647.887) -- 0:01:16
164500 -- (-655.101) (-664.269) (-641.237) [-656.490] * [-649.837] (-644.638) (-646.040) (-647.542) -- 0:01:16
165000 -- (-651.413) (-653.341) (-657.839) [-642.864] * (-657.565) (-647.211) (-644.002) [-644.833] -- 0:01:15
Average standard deviation of split frequencies: 0.017985
165500 -- (-650.051) (-644.502) (-651.027) [-640.687] * (-645.306) [-646.629] (-643.847) (-652.699) -- 0:01:15
166000 -- (-657.963) [-641.261] (-656.747) (-640.838) * [-644.695] (-648.788) (-658.142) (-653.278) -- 0:01:15
166500 -- (-649.487) [-644.675] (-647.444) (-654.014) * (-644.256) (-654.677) [-641.576] (-649.560) -- 0:01:15
167000 -- [-652.910] (-654.324) (-646.627) (-653.237) * (-642.559) [-649.838] (-646.767) (-651.373) -- 0:01:14
167500 -- (-654.247) [-642.584] (-643.669) (-647.785) * [-648.644] (-640.649) (-648.677) (-649.659) -- 0:01:14
168000 -- (-649.084) [-643.793] (-644.008) (-646.471) * (-651.647) (-661.068) (-648.200) [-642.039] -- 0:01:14
168500 -- (-652.717) (-646.645) (-652.258) [-640.798] * (-644.610) (-658.761) [-639.369] (-650.774) -- 0:01:14
169000 -- (-651.860) (-654.459) [-651.216] (-649.085) * (-655.209) (-651.131) [-641.347] (-647.888) -- 0:01:13
169500 -- (-653.410) (-643.031) [-648.965] (-641.918) * (-651.278) (-654.937) [-639.632] (-645.491) -- 0:01:13
170000 -- (-655.489) (-644.906) [-638.874] (-647.445) * (-649.350) (-648.129) [-639.349] (-654.104) -- 0:01:13
Average standard deviation of split frequencies: 0.017954
170500 -- (-644.253) (-648.687) (-648.344) [-643.658] * (-655.745) (-647.780) [-644.095] (-654.922) -- 0:01:12
171000 -- (-646.826) (-649.493) (-644.974) [-637.957] * (-656.558) (-642.849) [-642.746] (-661.657) -- 0:01:12
171500 -- (-647.632) (-645.276) (-648.507) [-644.908] * (-654.842) [-651.414] (-651.045) (-650.985) -- 0:01:12
172000 -- (-657.112) (-649.727) (-649.068) [-640.657] * (-654.629) (-646.176) [-643.238] (-642.028) -- 0:01:12
172500 -- (-652.131) (-646.026) (-643.233) [-644.266] * (-643.530) (-645.847) (-646.981) [-640.686] -- 0:01:11
173000 -- (-653.925) (-645.426) (-658.891) [-642.888] * (-639.908) [-641.105] (-641.291) (-649.375) -- 0:01:16
173500 -- (-641.495) [-639.413] (-655.553) (-646.414) * (-656.703) (-649.977) (-641.298) [-640.595] -- 0:01:16
174000 -- [-646.989] (-641.465) (-656.634) (-647.222) * (-649.305) (-654.048) [-640.133] (-640.152) -- 0:01:15
174500 -- (-645.844) [-641.807] (-659.187) (-640.358) * (-645.239) (-655.183) [-640.052] (-652.010) -- 0:01:15
175000 -- (-641.949) (-651.213) (-647.935) [-636.221] * (-654.110) (-648.412) [-638.739] (-652.808) -- 0:01:15
Average standard deviation of split frequencies: 0.018749
175500 -- (-656.707) (-644.603) (-669.971) [-640.284] * (-659.111) [-648.540] (-637.957) (-654.426) -- 0:01:15
176000 -- (-664.272) (-650.107) (-661.666) [-639.771] * (-652.343) (-658.865) [-648.902] (-652.731) -- 0:01:14
176500 -- (-646.390) (-646.277) (-644.177) [-653.660] * [-645.656] (-663.381) (-648.144) (-652.512) -- 0:01:14
177000 -- (-652.558) (-645.337) [-649.158] (-641.038) * (-651.095) (-654.441) (-647.834) [-648.734] -- 0:01:14
177500 -- (-653.785) (-640.095) [-644.308] (-638.825) * (-651.856) (-650.361) [-642.900] (-641.321) -- 0:01:14
178000 -- (-648.251) (-640.357) (-652.662) [-642.151] * (-643.988) (-652.106) [-639.352] (-653.201) -- 0:01:13
178500 -- (-647.835) (-638.150) [-643.950] (-649.492) * (-645.884) (-651.935) (-641.094) [-644.121] -- 0:01:13
179000 -- (-661.634) (-644.778) (-647.611) [-639.471] * (-653.624) (-649.580) (-644.662) [-641.629] -- 0:01:13
179500 -- (-658.747) (-644.896) (-642.198) [-641.812] * (-661.463) (-662.131) (-642.017) [-638.070] -- 0:01:13
180000 -- (-657.648) [-642.191] (-649.343) (-639.311) * (-650.744) (-651.267) (-642.911) [-645.159] -- 0:01:12
Average standard deviation of split frequencies: 0.016883
180500 -- [-653.175] (-647.634) (-652.131) (-635.785) * [-641.935] (-650.642) (-643.547) (-646.140) -- 0:01:12
181000 -- (-653.542) [-649.264] (-652.236) (-639.948) * (-656.870) [-652.685] (-643.347) (-650.193) -- 0:01:12
181500 -- (-650.487) (-642.452) (-663.192) [-642.350] * (-668.713) (-654.566) [-639.655] (-644.724) -- 0:01:12
182000 -- (-647.775) [-636.901] (-658.173) (-643.778) * (-658.492) (-645.491) [-643.318] (-652.678) -- 0:01:11
182500 -- (-648.016) [-646.094] (-660.244) (-639.784) * (-648.323) (-655.878) [-638.076] (-655.519) -- 0:01:11
183000 -- (-647.094) (-644.266) (-645.369) [-640.823] * (-656.600) (-649.553) [-642.407] (-652.454) -- 0:01:11
183500 -- (-649.942) [-641.253] (-648.384) (-638.739) * (-657.989) [-646.149] (-641.654) (-654.727) -- 0:01:11
184000 -- (-659.297) (-638.162) (-648.918) [-642.980] * (-662.589) [-652.799] (-648.357) (-658.897) -- 0:01:10
184500 -- (-652.389) [-644.036] (-651.205) (-645.518) * (-651.400) (-657.288) [-642.943] (-659.629) -- 0:01:15
185000 -- (-648.953) (-640.522) [-648.365] (-640.123) * (-650.640) (-660.885) [-643.155] (-655.114) -- 0:01:14
Average standard deviation of split frequencies: 0.016896
185500 -- (-652.328) [-646.025] (-655.800) (-642.900) * (-653.968) (-656.632) (-648.076) [-644.370] -- 0:01:14
186000 -- (-656.609) [-639.194] (-650.078) (-644.274) * (-651.528) (-661.488) (-660.709) [-647.483] -- 0:01:14
186500 -- (-649.112) (-643.145) [-640.038] (-651.357) * (-657.525) (-660.362) (-647.911) [-642.648] -- 0:01:14
187000 -- (-646.272) [-646.826] (-653.493) (-640.403) * (-654.417) (-661.469) (-647.538) [-639.883] -- 0:01:13
187500 -- (-660.632) (-643.480) (-658.198) [-640.070] * (-645.759) (-660.218) (-645.899) [-645.163] -- 0:01:13
188000 -- (-656.497) (-641.457) (-657.291) [-640.411] * (-644.583) (-655.370) (-645.683) [-642.618] -- 0:01:13
188500 -- (-654.822) (-642.633) (-658.696) [-640.371] * [-644.415] (-652.537) (-645.395) (-645.749) -- 0:01:13
189000 -- (-647.630) (-654.073) (-659.529) [-645.071] * (-649.143) (-661.808) (-657.621) [-638.129] -- 0:01:12
189500 -- (-648.078) [-647.124] (-657.151) (-642.612) * (-650.695) (-649.999) (-655.227) [-639.052] -- 0:01:12
190000 -- (-646.092) [-651.783] (-653.317) (-653.916) * (-654.752) (-651.013) (-660.344) [-643.678] -- 0:01:12
Average standard deviation of split frequencies: 0.017889
190500 -- (-644.509) [-644.579] (-648.079) (-638.215) * (-651.597) (-649.470) (-655.919) [-637.997] -- 0:01:12
191000 -- (-655.200) (-657.110) [-647.340] (-638.743) * (-658.975) (-640.083) [-645.877] (-652.108) -- 0:01:12
191500 -- (-660.622) (-659.645) [-645.917] (-639.886) * (-654.457) (-642.077) [-644.847] (-642.028) -- 0:01:11
192000 -- (-659.757) (-658.300) (-642.692) [-642.193] * (-644.279) (-648.023) (-651.503) [-637.144] -- 0:01:11
192500 -- (-644.701) (-656.893) (-646.184) [-640.103] * (-653.407) (-649.793) (-656.776) [-640.144] -- 0:01:11
193000 -- (-645.889) [-643.811] (-645.716) (-643.106) * [-647.432] (-653.809) (-660.587) (-645.287) -- 0:01:11
193500 -- (-645.322) (-655.715) (-653.078) [-640.190] * (-649.527) (-649.407) (-658.112) [-641.199] -- 0:01:10
194000 -- (-650.789) (-663.366) (-640.075) [-638.115] * (-660.117) [-642.016] (-654.161) (-639.030) -- 0:01:10
194500 -- (-650.294) (-663.399) (-656.711) [-638.141] * (-658.803) (-643.156) (-649.113) [-642.077] -- 0:01:10
195000 -- (-655.410) (-658.167) [-649.737] (-652.475) * (-652.737) (-651.627) (-648.070) [-642.833] -- 0:01:10
Average standard deviation of split frequencies: 0.017826
195500 -- (-642.344) (-652.919) (-660.286) [-641.846] * (-643.754) (-638.692) (-652.069) [-641.482] -- 0:01:09
196000 -- (-657.572) (-648.712) (-653.084) [-638.679] * (-656.414) [-645.563] (-661.955) (-643.997) -- 0:01:13
196500 -- (-652.664) (-642.611) (-653.482) [-637.578] * (-653.539) [-647.928] (-658.175) (-642.235) -- 0:01:13
197000 -- (-655.315) [-641.824] (-657.135) (-642.146) * (-650.308) [-642.392] (-649.716) (-647.994) -- 0:01:13
197500 -- (-656.191) (-640.770) (-647.382) [-639.377] * (-655.049) [-647.341] (-653.842) (-645.054) -- 0:01:13
198000 -- (-661.779) (-654.214) (-651.433) [-648.328] * (-649.764) (-643.661) (-643.591) [-646.564] -- 0:01:12
198500 -- (-653.664) (-643.331) (-652.064) [-642.441] * [-647.796] (-645.228) (-650.221) (-648.184) -- 0:01:12
199000 -- (-651.281) (-639.982) [-641.682] (-643.734) * (-661.471) [-640.597] (-654.398) (-643.171) -- 0:01:12
199500 -- (-653.040) [-645.242] (-650.513) (-645.797) * (-656.291) (-646.837) (-650.525) [-649.878] -- 0:01:12
200000 -- (-661.521) (-652.875) [-646.614] (-642.207) * (-648.816) (-645.144) (-653.445) [-641.314] -- 0:01:12
Average standard deviation of split frequencies: 0.016859
200500 -- (-648.412) (-645.551) (-650.082) [-640.135] * (-657.843) (-647.525) [-648.693] (-643.953) -- 0:01:11
201000 -- [-652.535] (-659.052) (-651.289) (-639.609) * (-646.711) (-641.120) (-651.211) [-648.704] -- 0:01:11
201500 -- (-652.462) (-654.660) (-638.550) [-642.723] * (-651.463) (-641.431) (-653.442) [-650.187] -- 0:01:11
202000 -- (-645.238) (-659.687) [-647.374] (-651.931) * (-647.555) [-646.269] (-661.622) (-644.106) -- 0:01:11
202500 -- (-644.604) [-645.404] (-641.526) (-642.309) * (-654.000) (-647.288) (-656.012) [-640.280] -- 0:01:10
203000 -- (-645.050) [-649.116] (-653.779) (-643.628) * (-650.740) (-646.703) (-656.359) [-647.166] -- 0:01:10
203500 -- (-645.866) (-650.245) (-660.078) [-635.357] * (-665.155) (-649.112) (-656.422) [-645.022] -- 0:01:10
204000 -- (-645.387) (-661.333) (-657.186) [-641.636] * (-657.873) (-647.832) (-647.004) [-645.892] -- 0:01:10
204500 -- (-651.707) (-664.924) (-640.617) [-642.052] * (-654.478) [-642.495] (-661.807) (-655.036) -- 0:01:10
205000 -- [-652.320] (-650.788) (-652.679) (-639.525) * (-642.735) (-639.397) (-643.648) [-649.110] -- 0:01:09
Average standard deviation of split frequencies: 0.017230
205500 -- (-660.784) (-654.274) (-644.035) [-649.936] * (-652.560) [-644.587] (-640.417) (-640.630) -- 0:01:09
206000 -- (-653.540) [-657.895] (-653.344) (-649.752) * (-650.157) (-643.646) [-638.145] (-642.363) -- 0:01:09
206500 -- [-650.646] (-653.690) (-645.715) (-660.393) * (-658.939) (-640.661) (-643.490) [-640.379] -- 0:01:09
207000 -- (-653.167) (-642.936) [-640.495] (-649.353) * (-653.427) [-637.068] (-645.452) (-640.179) -- 0:01:08
207500 -- (-662.268) (-655.826) (-652.666) [-651.042] * (-643.775) (-640.027) (-647.327) [-638.107] -- 0:01:12
208000 -- (-656.255) [-652.866] (-645.485) (-649.537) * (-651.615) [-642.246] (-650.791) (-647.585) -- 0:01:12
208500 -- (-656.149) (-663.021) [-650.281] (-643.334) * (-649.684) (-637.989) (-655.075) [-642.709] -- 0:01:12
209000 -- (-648.132) (-663.886) [-645.456] (-643.903) * [-650.833] (-642.372) (-656.784) (-637.445) -- 0:01:11
209500 -- (-647.425) (-655.068) (-651.897) [-646.159] * (-650.806) (-642.097) (-653.891) [-638.003] -- 0:01:11
210000 -- (-644.331) [-648.073] (-655.257) (-643.152) * (-644.608) [-637.627] (-655.704) (-644.768) -- 0:01:11
Average standard deviation of split frequencies: 0.015927
210500 -- (-660.089) (-655.934) [-650.123] (-658.471) * (-650.595) (-663.526) [-647.858] (-645.746) -- 0:01:11
211000 -- (-652.716) (-644.060) [-656.225] (-655.970) * (-644.875) (-656.591) (-656.747) [-643.043] -- 0:01:11
211500 -- [-646.079] (-652.123) (-649.800) (-652.085) * [-646.468] (-655.955) (-656.063) (-646.623) -- 0:01:10
212000 -- (-643.423) (-643.588) (-650.419) [-646.855] * (-648.067) (-649.866) (-663.872) [-638.736] -- 0:01:10
212500 -- (-647.450) [-652.002] (-647.736) (-657.429) * (-651.938) (-653.041) (-655.489) [-643.002] -- 0:01:10
213000 -- [-644.528] (-648.918) (-656.911) (-645.833) * (-663.913) (-655.969) (-644.816) [-644.426] -- 0:01:10
213500 -- (-652.427) (-657.247) (-655.766) [-640.888] * (-664.019) (-653.838) (-653.493) [-642.317] -- 0:01:09
214000 -- (-655.204) (-652.483) (-650.939) [-646.239] * (-648.223) [-648.128] (-646.633) (-641.615) -- 0:01:09
214500 -- [-646.607] (-664.297) (-645.124) (-656.236) * (-651.186) (-654.515) [-640.838] (-642.007) -- 0:01:09
215000 -- (-653.637) (-655.890) (-649.096) [-643.644] * (-647.010) (-652.475) (-658.020) [-644.093] -- 0:01:09
Average standard deviation of split frequencies: 0.015519
215500 -- (-654.795) (-653.331) (-662.484) [-644.067] * (-653.820) (-646.576) [-644.530] (-637.607) -- 0:01:09
216000 -- (-646.428) (-656.594) [-642.536] (-641.609) * (-654.531) (-656.630) [-644.768] (-635.927) -- 0:01:08
216500 -- [-651.416] (-649.895) (-653.861) (-638.857) * (-658.937) (-667.322) (-654.918) [-640.900] -- 0:01:08
217000 -- [-646.999] (-655.756) (-650.163) (-645.470) * (-658.038) (-660.807) (-665.413) [-643.746] -- 0:01:08
217500 -- (-651.151) (-650.333) (-650.024) [-638.449] * (-659.145) [-653.887] (-651.690) (-640.288) -- 0:01:08
218000 -- (-642.023) (-650.345) (-644.920) [-641.400] * (-660.354) (-653.700) (-649.857) [-637.596] -- 0:01:08
218500 -- (-650.112) (-648.814) (-658.556) [-640.841] * (-644.301) (-651.721) (-652.665) [-645.167] -- 0:01:07
219000 -- (-646.285) [-647.153] (-645.290) (-640.280) * [-645.823] (-647.420) (-656.569) (-646.215) -- 0:01:11
219500 -- [-644.385] (-660.136) (-655.443) (-647.030) * (-657.686) (-644.907) (-652.333) [-649.792] -- 0:01:11
220000 -- (-642.742) (-653.787) (-650.347) [-641.460] * (-658.084) (-639.253) (-656.460) [-644.462] -- 0:01:10
Average standard deviation of split frequencies: 0.013055
220500 -- (-658.370) (-646.583) (-655.384) [-639.265] * (-645.141) (-659.423) [-645.037] (-652.362) -- 0:01:10
221000 -- (-657.718) (-656.869) (-647.343) [-654.679] * (-658.238) [-645.796] (-654.128) (-652.432) -- 0:01:10
221500 -- (-653.394) (-644.846) (-652.053) [-643.967] * (-660.933) [-650.530] (-644.472) (-648.696) -- 0:01:10
222000 -- (-662.995) (-643.125) (-662.779) [-639.350] * (-657.470) (-648.469) [-653.648] (-660.120) -- 0:01:10
222500 -- (-660.788) (-644.262) (-645.185) [-644.798] * [-650.529] (-648.764) (-652.436) (-651.709) -- 0:01:09
223000 -- (-660.767) (-644.384) (-647.561) [-641.303] * (-653.961) (-648.225) [-650.343] (-658.296) -- 0:01:09
223500 -- (-662.892) (-650.515) (-648.013) [-638.048] * (-649.023) [-647.629] (-658.908) (-655.029) -- 0:01:09
224000 -- (-652.753) (-644.259) [-640.822] (-656.140) * (-647.122) (-643.526) [-657.785] (-660.149) -- 0:01:09
224500 -- (-645.663) (-651.050) [-647.752] (-646.435) * (-653.537) (-654.498) [-644.100] (-655.063) -- 0:01:09
225000 -- (-653.692) (-650.752) (-639.349) [-640.334] * (-654.597) [-654.248] (-644.823) (-659.594) -- 0:01:08
Average standard deviation of split frequencies: 0.011704
225500 -- [-650.976] (-651.147) (-653.278) (-662.606) * (-651.860) (-648.369) [-642.035] (-653.416) -- 0:01:08
226000 -- (-650.916) (-649.985) (-658.469) [-642.658] * (-651.709) [-648.447] (-649.863) (-651.492) -- 0:01:08
226500 -- (-644.360) (-645.712) (-658.697) [-635.410] * (-645.474) [-640.314] (-649.589) (-656.808) -- 0:01:08
227000 -- (-659.882) [-648.365] (-655.604) (-640.431) * (-654.542) [-643.244] (-645.542) (-650.575) -- 0:01:08
227500 -- (-652.161) (-656.235) (-648.980) [-640.769] * (-672.930) (-649.824) [-644.132] (-655.560) -- 0:01:07
228000 -- (-657.910) [-646.497] (-652.296) (-642.163) * (-660.594) (-663.258) [-636.307] (-647.362) -- 0:01:07
228500 -- (-656.952) (-659.867) (-653.573) [-647.255] * (-660.246) (-653.396) [-640.588] (-654.165) -- 0:01:07
229000 -- [-643.250] (-647.498) (-658.648) (-645.310) * (-652.665) (-640.263) [-639.769] (-656.461) -- 0:01:07
229500 -- (-658.757) (-649.269) (-653.321) [-638.410] * (-651.865) (-647.213) [-640.652] (-650.144) -- 0:01:07
230000 -- (-660.291) (-648.794) (-647.255) [-645.724] * (-656.593) (-650.311) [-642.163] (-646.423) -- 0:01:06
Average standard deviation of split frequencies: 0.012376
230500 -- (-653.861) (-650.137) (-652.009) [-644.171] * (-654.270) [-641.655] (-642.538) (-649.974) -- 0:01:10
231000 -- (-649.437) [-644.909] (-649.561) (-639.801) * (-653.225) (-639.333) [-640.343] (-653.507) -- 0:01:09
231500 -- (-655.633) (-657.675) (-647.760) [-637.279] * (-648.103) [-640.575] (-640.328) (-652.707) -- 0:01:09
232000 -- (-647.381) [-639.874] (-652.425) (-643.142) * (-649.113) (-646.159) (-652.453) [-646.300] -- 0:01:09
232500 -- (-660.452) (-642.550) (-649.922) [-645.226] * (-649.427) (-644.686) (-647.539) [-641.816] -- 0:01:09
233000 -- (-639.894) (-650.556) (-641.532) [-646.916] * (-650.086) [-643.100] (-649.063) (-653.339) -- 0:01:09
233500 -- (-659.381) (-645.977) [-646.741] (-638.346) * (-643.381) [-648.341] (-656.345) (-644.365) -- 0:01:08
234000 -- (-663.982) (-646.212) (-651.563) [-644.255] * (-653.013) [-643.363] (-649.031) (-652.358) -- 0:01:08
234500 -- (-663.092) [-647.913] (-643.059) (-636.360) * [-644.843] (-646.894) (-647.402) (-638.646) -- 0:01:08
235000 -- (-654.780) (-646.169) [-644.133] (-642.603) * [-644.510] (-649.682) (-655.636) (-648.050) -- 0:01:08
Average standard deviation of split frequencies: 0.013277
235500 -- (-652.842) (-648.405) [-651.966] (-642.642) * (-658.491) [-645.521] (-654.295) (-651.216) -- 0:01:08
236000 -- (-667.361) (-642.622) [-650.058] (-649.570) * (-653.177) (-646.466) (-654.632) [-646.590] -- 0:01:07
236500 -- (-651.559) (-634.937) (-642.333) [-638.027] * [-653.161] (-647.818) (-659.932) (-655.023) -- 0:01:07
237000 -- (-656.797) [-643.004] (-643.352) (-645.030) * (-646.719) [-649.640] (-647.327) (-651.956) -- 0:01:07
237500 -- (-653.098) (-636.728) (-646.590) [-644.673] * [-642.221] (-645.904) (-651.149) (-649.109) -- 0:01:07
238000 -- (-658.866) (-645.333) [-648.476] (-649.028) * (-647.018) [-646.193] (-654.855) (-643.833) -- 0:01:07
238500 -- (-659.584) (-655.365) [-643.375] (-640.360) * (-644.354) (-637.986) (-646.658) [-647.347] -- 0:01:07
239000 -- [-645.894] (-648.802) (-648.972) (-643.421) * (-653.968) [-644.764] (-646.824) (-640.717) -- 0:01:06
239500 -- (-642.485) (-647.938) [-654.379] (-643.046) * (-656.893) (-644.215) (-654.401) [-645.020] -- 0:01:06
240000 -- (-648.984) (-646.159) (-647.381) [-643.933] * (-658.031) (-642.805) (-656.426) [-649.778] -- 0:01:06
Average standard deviation of split frequencies: 0.012444
240500 -- (-641.870) (-661.375) (-650.044) [-638.965] * (-658.680) [-640.092] (-645.260) (-643.950) -- 0:01:06
241000 -- (-645.724) (-666.816) (-646.279) [-638.312] * (-651.678) [-639.642] (-653.266) (-657.034) -- 0:01:06
241500 -- [-648.236] (-644.515) (-654.575) (-643.859) * (-655.274) [-641.256] (-651.342) (-654.529) -- 0:01:05
242000 -- [-645.676] (-655.987) (-654.271) (-648.062) * (-659.777) (-644.397) (-654.349) [-644.493] -- 0:01:08
242500 -- (-656.908) [-647.044] (-659.217) (-644.428) * (-655.117) [-640.543] (-641.253) (-657.758) -- 0:01:08
243000 -- [-650.386] (-652.324) (-651.845) (-638.264) * (-653.606) (-654.853) [-640.414] (-644.399) -- 0:01:08
243500 -- (-645.701) [-649.059] (-647.763) (-641.745) * (-656.756) [-641.549] (-658.548) (-645.111) -- 0:01:08
244000 -- (-648.005) (-646.261) (-652.434) [-641.345] * (-659.023) (-650.737) [-644.669] (-644.180) -- 0:01:08
244500 -- [-644.092] (-643.131) (-653.649) (-649.493) * (-659.468) (-642.234) [-649.682] (-645.792) -- 0:01:07
245000 -- (-648.498) [-646.892] (-654.335) (-653.345) * (-654.978) (-654.088) [-644.524] (-644.274) -- 0:01:07
Average standard deviation of split frequencies: 0.013307
245500 -- (-646.559) [-657.030] (-648.550) (-663.435) * [-645.268] (-655.350) (-644.253) (-641.392) -- 0:01:07
246000 -- (-643.294) [-646.842] (-654.182) (-653.056) * [-646.092] (-649.047) (-650.230) (-646.729) -- 0:01:07
246500 -- (-645.258) (-660.626) [-654.996] (-656.273) * (-655.165) (-656.129) (-642.113) [-646.053] -- 0:01:07
247000 -- (-659.932) (-656.029) [-654.518] (-651.726) * (-650.580) (-656.179) [-644.356] (-640.702) -- 0:01:07
247500 -- (-657.380) (-660.893) [-645.089] (-641.296) * (-665.414) (-661.473) (-646.284) [-642.862] -- 0:01:06
248000 -- (-654.911) (-655.057) (-653.946) [-641.320] * [-651.421] (-656.973) (-650.070) (-649.293) -- 0:01:06
248500 -- (-659.569) (-659.664) (-645.135) [-647.304] * (-658.265) (-656.917) [-641.399] (-645.677) -- 0:01:06
249000 -- [-654.114] (-652.598) (-643.989) (-642.624) * (-658.348) (-645.397) (-643.127) [-645.298] -- 0:01:06
249500 -- (-650.515) (-652.974) (-662.354) [-644.837] * (-657.711) (-643.733) [-640.273] (-648.865) -- 0:01:06
250000 -- (-640.731) (-660.983) (-650.023) [-650.730] * (-655.312) (-646.304) [-637.337] (-637.453) -- 0:01:06
Average standard deviation of split frequencies: 0.013263
250500 -- (-641.389) (-661.557) (-654.644) [-646.680] * (-664.269) (-646.800) (-643.276) [-640.229] -- 0:01:05
251000 -- (-649.028) (-656.659) (-655.947) [-643.633] * (-660.399) (-650.291) [-646.323] (-647.600) -- 0:01:05
251500 -- (-653.959) [-656.770] (-651.541) (-652.785) * (-651.005) (-647.326) [-635.766] (-647.482) -- 0:01:05
252000 -- [-646.085] (-662.436) (-650.009) (-642.812) * (-660.265) (-661.724) (-644.759) [-643.938] -- 0:01:05
252500 -- (-649.373) (-655.412) [-639.693] (-652.308) * (-659.210) [-650.109] (-654.232) (-646.036) -- 0:01:05
253000 -- (-652.352) (-654.928) [-642.347] (-649.334) * [-649.688] (-646.661) (-643.232) (-646.990) -- 0:01:04
253500 -- (-644.220) [-639.416] (-656.338) (-655.290) * (-650.747) (-648.854) [-643.204] (-649.763) -- 0:01:07
254000 -- (-651.358) (-655.506) [-643.400] (-641.055) * (-656.393) (-640.024) [-639.724] (-662.242) -- 0:01:07
254500 -- (-648.807) (-643.928) (-650.931) [-648.591] * (-649.297) (-646.367) (-643.103) [-656.660] -- 0:01:07
255000 -- [-647.914] (-653.840) (-647.667) (-652.200) * (-650.828) [-647.454] (-640.718) (-666.654) -- 0:01:07
Average standard deviation of split frequencies: 0.014220
255500 -- (-653.194) (-643.651) (-658.405) [-647.326] * (-656.310) (-641.765) [-642.664] (-659.957) -- 0:01:07
256000 -- (-651.653) [-649.728] (-651.275) (-651.320) * (-652.963) (-641.495) [-640.516] (-650.279) -- 0:01:06
256500 -- [-640.705] (-655.082) (-661.972) (-642.483) * (-664.809) [-645.392] (-645.281) (-657.077) -- 0:01:06
257000 -- (-654.824) (-653.733) [-645.232] (-639.216) * [-647.451] (-653.548) (-645.555) (-658.618) -- 0:01:06
257500 -- (-643.906) [-643.280] (-662.326) (-642.153) * (-656.429) (-657.558) (-642.307) [-651.448] -- 0:01:06
258000 -- (-651.935) (-656.887) (-645.751) [-642.543] * [-641.528] (-648.976) (-641.794) (-647.245) -- 0:01:06
258500 -- (-655.789) (-643.855) [-638.929] (-651.922) * (-640.788) (-654.254) [-647.114] (-648.810) -- 0:01:05
259000 -- (-658.359) (-645.251) (-643.086) [-643.416] * (-651.560) [-643.754] (-643.973) (-646.861) -- 0:01:05
259500 -- (-657.777) (-649.938) (-639.875) [-645.844] * (-652.702) [-641.236] (-645.072) (-643.840) -- 0:01:05
260000 -- (-654.403) (-650.206) [-645.770] (-649.143) * (-643.630) (-648.780) (-646.956) [-642.585] -- 0:01:05
Average standard deviation of split frequencies: 0.013936
260500 -- (-657.488) (-646.661) (-643.284) [-645.593] * [-648.862] (-665.331) (-644.546) (-642.608) -- 0:01:05
261000 -- [-658.079] (-665.275) (-641.601) (-661.640) * [-651.706] (-658.895) (-654.986) (-652.962) -- 0:01:05
261500 -- (-643.227) (-652.273) (-645.768) [-642.250] * (-657.170) (-652.132) [-644.552] (-658.766) -- 0:01:04
262000 -- (-647.853) (-646.386) (-654.650) [-640.996] * (-643.072) (-652.155) [-648.484] (-652.097) -- 0:01:04
262500 -- (-650.570) (-653.859) [-649.160] (-658.612) * (-659.597) (-658.906) [-640.910] (-655.590) -- 0:01:04
263000 -- (-645.919) (-655.965) [-647.958] (-665.354) * (-657.205) (-652.487) [-643.355] (-653.751) -- 0:01:04
263500 -- (-656.733) (-654.298) [-654.384] (-655.544) * [-645.514] (-644.115) (-647.263) (-644.401) -- 0:01:04
264000 -- (-657.614) (-650.184) (-648.828) [-649.604] * (-646.014) (-655.409) [-645.625] (-641.003) -- 0:01:04
264500 -- (-648.532) (-649.985) (-659.039) [-642.749] * [-646.473] (-653.396) (-652.029) (-645.833) -- 0:01:03
265000 -- (-656.393) (-662.737) [-656.142] (-662.764) * [-648.778] (-654.847) (-644.712) (-656.042) -- 0:01:06
Average standard deviation of split frequencies: 0.013135
265500 -- (-654.124) [-652.317] (-647.144) (-656.513) * (-658.187) (-650.600) (-642.086) [-646.784] -- 0:01:06
266000 -- (-644.765) (-646.940) [-643.721] (-655.919) * [-648.760] (-656.721) (-645.287) (-655.017) -- 0:01:06
266500 -- (-650.523) (-644.348) [-644.040] (-658.612) * (-644.340) (-660.282) [-649.368] (-647.219) -- 0:01:06
267000 -- (-656.035) (-650.937) (-649.400) [-643.473] * (-648.157) (-664.075) [-644.428] (-649.387) -- 0:01:05
267500 -- (-655.960) [-643.744] (-654.141) (-649.693) * (-650.590) (-654.215) [-640.443] (-650.704) -- 0:01:05
268000 -- [-657.502] (-652.310) (-655.218) (-657.172) * (-642.814) (-658.254) (-646.527) [-642.270] -- 0:01:05
268500 -- (-658.807) (-648.781) (-663.119) [-642.937] * (-657.526) (-657.791) [-642.729] (-649.236) -- 0:01:05
269000 -- (-647.149) [-644.820] (-657.842) (-650.740) * (-642.935) (-641.728) (-643.429) [-655.143] -- 0:01:05
269500 -- [-642.487] (-651.841) (-667.184) (-660.417) * (-651.786) [-639.388] (-655.622) (-643.463) -- 0:01:05
270000 -- (-645.229) [-646.185] (-643.535) (-661.181) * (-644.432) (-651.288) [-638.134] (-659.358) -- 0:01:04
Average standard deviation of split frequencies: 0.013318
270500 -- (-652.551) [-646.703] (-653.350) (-663.348) * [-642.874] (-640.552) (-660.066) (-658.475) -- 0:01:04
271000 -- (-658.157) [-641.082] (-656.109) (-643.460) * [-652.734] (-648.566) (-654.886) (-654.766) -- 0:01:04
271500 -- (-649.963) (-640.591) [-648.975] (-659.109) * (-650.063) (-659.414) (-647.910) [-642.180] -- 0:01:04
272000 -- (-651.227) (-653.261) [-641.509] (-651.836) * (-653.234) (-651.865) (-644.709) [-651.256] -- 0:01:04
272500 -- (-644.634) [-641.345] (-655.548) (-654.341) * (-645.351) (-642.223) (-660.103) [-652.222] -- 0:01:04
273000 -- (-650.397) (-664.766) (-653.496) [-640.614] * (-645.079) [-650.282] (-650.508) (-650.040) -- 0:01:03
273500 -- (-657.430) [-645.440] (-645.277) (-645.655) * (-657.521) (-639.573) [-647.894] (-651.346) -- 0:01:03
274000 -- (-648.686) [-644.458] (-649.386) (-658.934) * (-653.315) (-637.542) (-657.050) [-645.654] -- 0:01:03
274500 -- [-643.489] (-661.551) (-656.323) (-643.973) * (-649.874) (-648.963) (-664.871) [-653.040] -- 0:01:03
275000 -- [-639.229] (-659.187) (-659.199) (-651.376) * [-645.109] (-649.844) (-649.401) (-649.828) -- 0:01:03
Average standard deviation of split frequencies: 0.011554
275500 -- (-647.928) [-643.724] (-658.566) (-652.916) * (-648.496) (-651.148) (-645.050) [-649.679] -- 0:01:03
276000 -- (-645.862) (-652.099) (-650.141) [-654.068] * (-646.435) [-639.404] (-651.489) (-659.043) -- 0:01:02
276500 -- (-644.325) [-652.486] (-659.632) (-662.464) * [-645.656] (-648.189) (-662.803) (-660.719) -- 0:01:05
277000 -- (-643.352) (-652.885) [-651.051] (-650.927) * (-648.156) (-638.036) [-640.762] (-652.873) -- 0:01:05
277500 -- (-649.399) [-647.045] (-652.359) (-657.161) * (-639.770) [-653.598] (-647.965) (-644.680) -- 0:01:05
278000 -- (-653.927) (-653.750) (-651.879) [-653.390] * (-646.698) [-640.555] (-656.450) (-645.206) -- 0:01:04
278500 -- (-654.972) (-649.545) (-655.571) [-646.788] * [-643.755] (-652.723) (-654.770) (-657.560) -- 0:01:04
279000 -- (-658.844) (-637.049) (-652.647) [-638.745] * (-653.917) (-647.067) (-645.601) [-655.457] -- 0:01:04
279500 -- (-663.476) [-639.638] (-662.237) (-641.896) * (-645.536) (-647.304) [-639.693] (-655.241) -- 0:01:04
280000 -- (-649.404) (-644.893) (-647.612) [-642.453] * (-642.521) (-638.220) [-641.757] (-655.579) -- 0:01:04
Average standard deviation of split frequencies: 0.010812
280500 -- (-644.790) (-657.196) (-651.997) [-651.825] * (-646.377) [-638.386] (-642.884) (-658.877) -- 0:01:04
281000 -- (-656.460) (-649.551) (-652.611) [-651.852] * (-653.023) (-637.026) [-643.713] (-659.870) -- 0:01:03
281500 -- (-644.599) [-649.747] (-656.805) (-643.082) * (-649.187) [-640.519] (-652.508) (-657.899) -- 0:01:03
282000 -- (-654.132) [-647.906] (-649.041) (-648.459) * (-657.103) (-649.692) [-637.125] (-647.575) -- 0:01:03
282500 -- (-652.361) (-649.949) (-650.278) [-645.687] * [-651.176] (-645.914) (-649.484) (-652.045) -- 0:01:03
283000 -- [-641.475] (-657.723) (-646.810) (-646.004) * (-649.263) (-644.014) (-642.774) [-652.978] -- 0:01:03
283500 -- (-652.856) (-666.709) (-643.402) [-644.906] * (-662.160) (-648.316) (-641.379) [-646.069] -- 0:01:03
284000 -- (-658.518) (-651.874) (-644.916) [-644.254] * (-657.363) (-646.994) [-657.502] (-649.160) -- 0:01:03
284500 -- (-646.770) [-653.329] (-658.510) (-646.362) * [-659.272] (-649.960) (-648.190) (-656.334) -- 0:01:02
285000 -- (-652.034) [-646.401] (-646.450) (-649.782) * [-644.552] (-652.988) (-653.437) (-647.829) -- 0:01:02
Average standard deviation of split frequencies: 0.009581
285500 -- (-648.701) (-653.197) (-655.399) [-639.558] * (-644.474) (-656.847) [-647.881] (-657.874) -- 0:01:02
286000 -- [-647.803] (-664.635) (-652.604) (-652.865) * [-652.384] (-641.715) (-652.900) (-654.532) -- 0:01:02
286500 -- (-647.476) (-657.480) (-646.122) [-643.627] * (-662.325) (-653.996) (-657.461) [-642.248] -- 0:01:02
287000 -- (-652.454) [-649.290] (-647.883) (-647.162) * (-664.581) [-638.613] (-649.422) (-656.918) -- 0:01:02
287500 -- (-659.001) (-652.874) (-656.345) [-641.845] * (-646.448) [-647.608] (-655.490) (-649.140) -- 0:01:04
288000 -- (-647.450) (-665.016) (-647.460) [-643.465] * (-651.540) [-649.827] (-657.280) (-659.336) -- 0:01:04
288500 -- (-650.436) (-654.973) (-654.674) [-645.363] * (-647.506) [-645.641] (-647.042) (-663.635) -- 0:01:04
289000 -- (-650.985) [-643.505] (-653.439) (-654.700) * (-647.247) (-650.569) [-640.156] (-648.030) -- 0:01:03
289500 -- [-646.805] (-644.170) (-662.793) (-640.719) * (-656.311) (-651.188) (-651.866) [-645.145] -- 0:01:03
290000 -- (-652.385) (-649.770) (-659.777) [-645.473] * (-656.866) [-643.194] (-657.979) (-648.374) -- 0:01:03
Average standard deviation of split frequencies: 0.010238
290500 -- (-649.916) (-650.376) [-657.903] (-658.088) * (-650.993) (-660.468) [-649.427] (-651.627) -- 0:01:03
291000 -- (-652.753) (-650.066) (-657.384) [-653.713] * [-641.255] (-652.629) (-645.359) (-646.482) -- 0:01:03
291500 -- (-640.207) (-659.196) [-647.248] (-657.306) * [-637.759] (-646.766) (-647.874) (-645.278) -- 0:01:03
292000 -- (-650.243) (-648.334) (-654.274) [-644.614] * (-649.659) (-649.852) [-654.639] (-642.787) -- 0:01:03
292500 -- (-647.288) (-651.826) [-653.150] (-655.104) * (-654.112) (-641.251) (-665.486) [-649.961] -- 0:01:02
293000 -- (-655.042) [-652.558] (-661.444) (-646.082) * (-649.665) (-644.582) [-642.572] (-664.051) -- 0:01:02
293500 -- (-644.054) (-643.516) (-657.511) [-649.228] * [-642.891] (-644.930) (-646.686) (-667.107) -- 0:01:02
294000 -- (-640.585) [-654.730] (-649.404) (-658.264) * (-658.310) [-641.461] (-651.999) (-656.303) -- 0:01:02
294500 -- (-656.986) [-653.663] (-645.165) (-645.723) * (-653.415) [-641.173] (-647.159) (-670.929) -- 0:01:02
295000 -- [-642.584] (-647.921) (-647.313) (-666.900) * (-648.480) (-643.833) [-648.680] (-652.289) -- 0:01:02
Average standard deviation of split frequencies: 0.010551
295500 -- (-643.671) (-644.241) [-650.899] (-658.649) * (-661.271) [-639.394] (-659.239) (-645.793) -- 0:01:01
296000 -- (-646.649) (-650.614) [-647.306] (-656.327) * (-656.847) (-642.912) (-658.187) [-645.694] -- 0:01:01
296500 -- (-644.763) (-639.994) [-647.778] (-660.980) * [-647.602] (-650.676) (-659.816) (-647.404) -- 0:01:01
297000 -- (-646.810) (-654.421) [-643.853] (-647.433) * (-644.246) [-638.097] (-649.166) (-649.043) -- 0:01:01
297500 -- (-651.567) [-649.345] (-653.506) (-647.686) * [-644.772] (-645.152) (-645.765) (-645.933) -- 0:01:01
298000 -- [-655.490] (-655.855) (-647.868) (-644.311) * [-641.213] (-660.215) (-653.633) (-643.393) -- 0:01:01
298500 -- [-640.778] (-652.372) (-657.131) (-653.930) * (-646.348) (-647.173) [-638.946] (-654.031) -- 0:01:01
299000 -- [-656.076] (-651.277) (-645.225) (-660.032) * [-638.144] (-641.553) (-644.100) (-653.678) -- 0:01:03
299500 -- (-652.912) (-660.982) [-645.932] (-650.909) * (-638.367) (-647.901) [-642.996] (-654.969) -- 0:01:03
300000 -- [-649.587] (-653.870) (-640.314) (-647.926) * (-639.525) (-642.959) (-641.048) [-654.268] -- 0:01:03
Average standard deviation of split frequencies: 0.010387
300500 -- (-660.342) (-659.558) (-643.662) [-643.196] * (-638.891) [-638.867] (-644.237) (-654.410) -- 0:01:02
301000 -- (-657.480) (-657.054) (-651.161) [-638.066] * [-643.722] (-641.021) (-641.357) (-642.423) -- 0:01:02
301500 -- (-647.865) (-644.316) (-642.928) [-645.383] * (-641.884) (-637.877) (-651.223) [-643.671] -- 0:01:02
302000 -- (-641.527) (-656.688) [-649.009] (-643.933) * (-637.906) [-643.854] (-660.444) (-647.432) -- 0:01:02
302500 -- (-645.510) (-658.391) (-644.457) [-639.596] * (-645.593) [-642.785] (-656.992) (-650.904) -- 0:01:02
303000 -- (-645.651) (-652.081) (-662.763) [-641.982] * [-642.052] (-643.790) (-653.711) (-642.752) -- 0:01:02
303500 -- [-638.777] (-659.214) (-661.672) (-642.824) * [-636.750] (-646.674) (-654.585) (-643.815) -- 0:01:01
304000 -- [-648.397] (-660.861) (-647.812) (-641.709) * (-643.616) [-641.536] (-646.311) (-651.775) -- 0:01:01
304500 -- (-642.600) (-660.155) (-656.604) [-640.922] * [-642.380] (-649.363) (-645.607) (-653.081) -- 0:01:01
305000 -- (-650.078) (-655.739) (-648.044) [-641.805] * [-642.922] (-646.532) (-640.935) (-660.263) -- 0:01:01
Average standard deviation of split frequencies: 0.009334
305500 -- (-650.255) (-666.077) (-660.084) [-642.369] * [-642.932] (-653.882) (-647.914) (-660.505) -- 0:01:01
306000 -- (-654.341) [-654.598] (-649.017) (-645.386) * (-647.244) (-655.345) [-642.784] (-667.332) -- 0:01:01
306500 -- (-643.284) [-639.156] (-648.541) (-642.780) * (-643.269) (-658.593) [-651.727] (-664.100) -- 0:01:01
307000 -- (-646.286) [-647.974] (-653.255) (-643.904) * (-649.571) (-657.359) [-644.208] (-647.447) -- 0:01:00
307500 -- (-652.888) [-646.461] (-651.651) (-638.795) * (-647.460) (-649.417) [-648.498] (-649.760) -- 0:01:00
308000 -- (-639.978) [-640.674] (-646.938) (-649.307) * [-649.663] (-642.557) (-649.300) (-650.867) -- 0:01:00
308500 -- (-640.417) (-651.575) [-655.050] (-643.116) * [-646.300] (-655.866) (-654.968) (-645.012) -- 0:01:00
309000 -- (-636.405) (-648.792) (-644.648) [-647.010] * [-640.669] (-645.074) (-660.776) (-650.875) -- 0:01:00
309500 -- (-644.239) [-641.799] (-651.951) (-640.626) * (-647.000) (-648.329) [-644.300] (-641.540) -- 0:01:00
310000 -- [-639.695] (-643.905) (-648.800) (-653.770) * (-644.500) (-645.681) [-640.435] (-656.149) -- 0:01:00
Average standard deviation of split frequencies: 0.009997
310500 -- [-644.132] (-645.357) (-649.422) (-664.652) * (-648.253) (-647.074) [-646.447] (-650.577) -- 0:01:02
311000 -- (-647.364) (-649.083) [-644.144] (-648.625) * [-639.144] (-654.203) (-638.566) (-641.440) -- 0:01:02
311500 -- (-637.283) (-657.488) [-641.318] (-650.295) * [-647.924] (-660.274) (-646.326) (-651.373) -- 0:01:01
312000 -- (-646.741) (-647.609) (-642.314) [-649.132] * [-640.461] (-644.230) (-649.114) (-645.204) -- 0:01:01
312500 -- [-646.922] (-654.705) (-652.581) (-658.247) * [-639.506] (-646.356) (-645.504) (-653.824) -- 0:01:01
313000 -- (-641.368) [-640.338] (-646.954) (-660.854) * [-637.281] (-644.043) (-650.460) (-670.716) -- 0:01:01
313500 -- (-639.244) (-652.768) (-648.075) [-643.635] * [-640.896] (-644.416) (-655.218) (-642.572) -- 0:01:01
314000 -- [-646.639] (-648.723) (-643.486) (-656.709) * [-639.225] (-651.011) (-654.330) (-640.717) -- 0:01:01
314500 -- (-647.593) (-645.808) (-638.130) [-642.835] * [-641.892] (-647.308) (-654.472) (-647.218) -- 0:01:01
315000 -- (-648.255) (-650.571) [-645.953] (-654.179) * (-642.350) (-648.266) (-648.938) [-643.931] -- 0:01:00
Average standard deviation of split frequencies: 0.009828
315500 -- (-652.370) (-644.388) [-647.754] (-645.427) * (-646.079) (-651.023) (-645.670) [-642.054] -- 0:01:00
316000 -- [-650.622] (-637.675) (-645.596) (-653.903) * (-658.983) (-658.460) (-647.918) [-638.834] -- 0:01:00
316500 -- (-650.863) [-638.958] (-652.100) (-652.443) * [-648.323] (-656.865) (-654.679) (-640.551) -- 0:01:00
317000 -- (-644.629) [-647.914] (-665.324) (-654.459) * (-650.226) (-647.248) (-655.733) [-643.401] -- 0:01:00
317500 -- [-647.230] (-642.708) (-646.523) (-655.549) * (-656.362) (-661.990) (-641.712) [-646.881] -- 0:01:00
318000 -- (-645.715) [-637.951] (-649.500) (-663.172) * (-652.513) [-638.324] (-658.278) (-649.051) -- 0:01:00
318500 -- (-650.522) [-644.011] (-653.130) (-659.060) * [-646.477] (-648.751) (-658.210) (-648.802) -- 0:00:59
319000 -- [-645.235] (-651.156) (-647.447) (-654.391) * (-647.915) [-639.658] (-657.577) (-653.025) -- 0:00:59
319500 -- (-647.082) (-646.831) (-652.170) [-648.530] * (-652.078) [-638.504] (-652.438) (-654.524) -- 0:00:59
320000 -- [-649.581] (-670.441) (-658.454) (-641.871) * (-661.496) (-641.996) [-645.081] (-649.416) -- 0:00:59
Average standard deviation of split frequencies: 0.010031
320500 -- [-652.442] (-650.033) (-649.704) (-648.551) * (-653.666) [-643.206] (-655.634) (-654.114) -- 0:00:59
321000 -- (-641.154) (-647.197) [-650.139] (-650.870) * (-651.934) (-642.763) (-640.582) [-645.965] -- 0:00:59
321500 -- (-658.184) [-642.379] (-652.976) (-646.683) * (-661.906) (-648.904) (-649.225) [-650.787] -- 0:00:59
322000 -- (-654.480) [-647.334] (-654.848) (-655.651) * (-645.598) (-655.047) [-640.500] (-651.738) -- 0:01:01
322500 -- [-642.418] (-647.910) (-659.392) (-655.302) * (-643.961) (-652.550) [-636.470] (-649.336) -- 0:01:00
323000 -- (-645.258) (-660.825) (-646.666) [-645.179] * (-648.613) [-647.628] (-637.845) (-654.680) -- 0:01:00
323500 -- (-648.215) (-638.729) [-643.262] (-665.994) * (-643.406) (-653.386) [-649.428] (-650.319) -- 0:01:00
324000 -- (-652.133) (-642.351) [-655.198] (-657.114) * (-641.983) [-653.641] (-643.937) (-662.775) -- 0:01:00
324500 -- (-640.649) [-644.057] (-655.938) (-663.989) * (-652.120) (-654.724) [-641.699] (-648.472) -- 0:01:00
325000 -- (-644.845) [-644.016] (-656.728) (-647.336) * (-644.178) (-656.672) [-644.914] (-649.017) -- 0:01:00
Average standard deviation of split frequencies: 0.010888
325500 -- [-646.055] (-651.631) (-646.560) (-651.976) * (-651.920) (-657.891) [-644.561] (-642.577) -- 0:01:00
326000 -- (-641.901) (-655.721) (-653.475) [-645.405] * [-646.407] (-652.661) (-643.032) (-649.023) -- 0:00:59
326500 -- [-666.997] (-641.338) (-654.600) (-655.107) * (-646.610) (-643.591) [-639.631] (-643.357) -- 0:00:59
327000 -- (-659.378) (-639.580) [-645.720] (-656.447) * (-643.044) (-649.311) (-644.211) [-650.614] -- 0:00:59
327500 -- (-652.809) [-644.563] (-643.647) (-657.399) * (-648.959) (-651.570) [-647.981] (-645.707) -- 0:00:59
328000 -- (-660.750) [-643.598] (-660.759) (-648.192) * (-642.874) (-644.598) [-638.650] (-648.662) -- 0:00:59
328500 -- (-650.302) [-640.503] (-661.251) (-652.286) * (-646.440) (-649.702) [-638.136] (-649.677) -- 0:00:59
329000 -- (-644.211) [-648.985] (-653.456) (-641.657) * (-660.943) (-655.602) (-642.073) [-644.029] -- 0:00:59
329500 -- (-660.908) [-640.775] (-645.281) (-667.516) * (-656.570) (-656.821) [-639.535] (-644.894) -- 0:00:59
330000 -- (-662.110) [-640.320] (-643.607) (-647.858) * (-659.839) (-651.947) [-645.096] (-654.390) -- 0:00:58
Average standard deviation of split frequencies: 0.010566
330500 -- (-658.221) (-643.769) [-646.062] (-643.296) * (-658.218) (-656.671) [-642.617] (-647.221) -- 0:00:58
331000 -- (-660.195) [-638.287] (-660.146) (-655.300) * (-663.671) (-642.115) (-644.272) [-640.327] -- 0:00:58
331500 -- (-662.423) [-641.246] (-671.778) (-652.409) * [-648.564] (-658.683) (-646.251) (-645.795) -- 0:00:58
332000 -- (-651.472) [-641.044] (-674.117) (-654.892) * (-648.155) (-661.141) (-649.923) [-638.028] -- 0:00:58
332500 -- [-646.952] (-640.663) (-664.831) (-650.839) * (-645.597) [-651.052] (-643.208) (-652.568) -- 0:00:58
333000 -- [-642.323] (-639.582) (-657.469) (-657.572) * (-643.788) [-654.220] (-652.415) (-642.929) -- 0:00:58
333500 -- (-647.653) (-645.975) (-649.484) [-651.343] * (-657.470) [-645.139] (-660.013) (-653.733) -- 0:00:59
334000 -- (-645.788) [-641.210] (-645.556) (-654.541) * (-658.131) (-640.720) (-663.325) [-646.113] -- 0:00:59
334500 -- [-641.990] (-642.013) (-645.518) (-652.699) * [-646.272] (-651.290) (-657.996) (-649.055) -- 0:00:59
335000 -- (-660.662) [-643.389] (-646.155) (-656.325) * [-651.277] (-650.062) (-654.055) (-660.243) -- 0:00:59
Average standard deviation of split frequencies: 0.011224
335500 -- [-644.015] (-645.735) (-645.967) (-666.918) * (-657.121) (-644.050) [-645.650] (-655.022) -- 0:00:59
336000 -- (-657.419) [-646.781] (-649.970) (-653.219) * (-654.100) [-643.422] (-649.614) (-644.579) -- 0:00:59
336500 -- [-640.924] (-645.496) (-654.219) (-647.557) * (-653.674) [-647.712] (-656.695) (-653.954) -- 0:00:59
337000 -- [-646.180] (-646.642) (-671.610) (-655.114) * (-661.686) [-656.705] (-656.791) (-653.970) -- 0:00:59
337500 -- [-650.991] (-646.072) (-650.512) (-646.549) * (-646.877) (-649.162) [-651.550] (-653.323) -- 0:00:58
338000 -- (-645.998) (-646.610) [-646.607] (-655.277) * [-643.638] (-645.397) (-658.398) (-652.021) -- 0:00:58
338500 -- (-643.609) [-638.383] (-650.645) (-648.628) * (-644.917) [-642.315] (-660.812) (-650.306) -- 0:00:58
339000 -- (-648.642) (-642.338) [-646.055] (-643.593) * (-651.986) (-645.485) [-642.673] (-654.507) -- 0:00:58
339500 -- (-650.537) [-643.760] (-643.291) (-650.124) * [-642.489] (-664.652) (-645.431) (-651.155) -- 0:00:58
340000 -- (-639.143) [-644.517] (-651.212) (-657.030) * (-648.050) (-655.960) [-640.583] (-640.415) -- 0:00:58
Average standard deviation of split frequencies: 0.010840
340500 -- [-637.778] (-642.346) (-648.483) (-651.138) * [-647.327] (-663.833) (-650.026) (-649.915) -- 0:00:58
341000 -- (-641.530) (-651.248) [-650.261] (-650.213) * [-638.708] (-653.201) (-647.592) (-658.258) -- 0:00:57
341500 -- (-648.252) [-646.617] (-639.145) (-641.854) * (-641.183) (-656.467) [-653.695] (-642.964) -- 0:00:57
342000 -- (-646.200) (-651.578) [-646.157] (-650.490) * [-640.650] (-650.592) (-648.642) (-655.669) -- 0:00:57
342500 -- (-646.366) [-640.720] (-650.320) (-646.778) * [-645.005] (-660.062) (-649.002) (-651.134) -- 0:00:57
343000 -- (-649.085) [-648.426] (-654.250) (-664.031) * [-639.337] (-650.619) (-642.717) (-637.561) -- 0:00:57
343500 -- (-642.116) (-658.607) [-647.684] (-659.891) * (-650.844) [-646.820] (-654.774) (-657.845) -- 0:00:57
344000 -- (-648.317) (-650.673) [-648.482] (-651.454) * (-652.875) [-645.798] (-658.914) (-654.994) -- 0:00:57
344500 -- (-643.597) [-639.568] (-644.349) (-657.788) * (-640.717) [-644.177] (-646.837) (-662.312) -- 0:00:57
345000 -- [-641.812] (-656.393) (-653.476) (-660.683) * [-644.228] (-651.019) (-644.074) (-655.792) -- 0:00:58
Average standard deviation of split frequencies: 0.010975
345500 -- [-640.006] (-654.264) (-661.044) (-657.583) * (-655.686) (-642.378) [-642.724] (-652.340) -- 0:00:58
346000 -- [-643.681] (-654.161) (-643.385) (-650.923) * (-640.227) (-645.693) [-637.909] (-645.627) -- 0:00:58
346500 -- (-638.248) (-653.169) [-644.332] (-676.751) * (-656.428) (-651.815) (-664.536) [-642.823] -- 0:00:58
347000 -- (-643.284) (-649.341) [-651.465] (-656.751) * [-642.753] (-664.211) (-647.552) (-643.220) -- 0:00:58
347500 -- (-647.357) (-646.383) [-646.078] (-666.838) * (-651.238) (-649.754) (-650.775) [-646.699] -- 0:00:58
348000 -- (-640.576) [-649.304] (-645.517) (-659.479) * (-645.545) (-649.362) [-648.151] (-647.623) -- 0:00:58
348500 -- (-648.203) [-649.673] (-650.744) (-644.429) * (-653.874) (-651.994) (-658.490) [-644.652] -- 0:00:57
349000 -- [-645.035] (-667.763) (-655.635) (-642.979) * (-655.435) (-642.951) (-652.177) [-640.613] -- 0:00:57
349500 -- (-644.810) [-649.312] (-637.814) (-656.062) * (-655.842) (-659.022) (-658.963) [-646.385] -- 0:00:57
350000 -- (-647.470) (-645.239) [-642.037] (-657.066) * [-652.105] (-643.951) (-660.015) (-653.174) -- 0:00:57
Average standard deviation of split frequencies: 0.010605
350500 -- (-649.521) (-653.602) [-639.241] (-650.309) * (-657.889) (-644.338) (-646.446) [-642.519] -- 0:00:57
351000 -- [-645.076] (-651.879) (-642.499) (-658.205) * (-653.495) [-649.352] (-645.300) (-647.654) -- 0:00:57
351500 -- (-656.311) (-658.160) [-644.156] (-644.783) * [-643.889] (-645.419) (-647.652) (-653.248) -- 0:00:57
352000 -- (-647.397) [-648.683] (-641.243) (-653.223) * [-650.703] (-646.954) (-648.189) (-657.885) -- 0:00:57
352500 -- (-647.486) (-647.678) [-643.156] (-647.846) * (-643.953) (-657.313) [-643.379] (-654.749) -- 0:00:56
353000 -- (-650.681) [-640.220] (-646.929) (-655.050) * (-645.740) [-652.535] (-646.104) (-653.261) -- 0:00:56
353500 -- (-664.609) [-645.232] (-645.329) (-645.901) * (-655.103) (-664.832) (-649.278) [-638.665] -- 0:00:56
354000 -- (-654.338) (-655.470) [-638.898] (-659.600) * [-652.358] (-646.275) (-657.511) (-644.887) -- 0:00:56
354500 -- (-647.685) (-648.396) [-643.855] (-651.530) * (-639.599) (-654.747) (-652.484) [-646.051] -- 0:00:56
355000 -- [-642.769] (-654.748) (-643.226) (-642.159) * (-642.396) [-644.422] (-654.854) (-646.415) -- 0:00:56
Average standard deviation of split frequencies: 0.011139
355500 -- [-642.812] (-661.388) (-654.578) (-647.495) * (-644.316) (-661.808) (-650.453) [-636.999] -- 0:00:56
356000 -- [-640.331] (-657.725) (-652.776) (-640.822) * [-642.867] (-648.104) (-656.193) (-652.123) -- 0:00:57
356500 -- (-658.008) (-648.420) (-646.568) [-649.922] * (-646.185) (-650.316) (-648.893) [-641.876] -- 0:00:57
357000 -- [-650.182] (-652.654) (-648.983) (-650.543) * [-644.399] (-649.354) (-645.050) (-642.791) -- 0:00:57
357500 -- (-651.712) [-648.192] (-651.798) (-644.093) * (-639.755) [-645.344] (-656.394) (-637.509) -- 0:00:57
358000 -- (-646.714) (-651.668) (-654.153) [-643.462] * [-645.141] (-652.525) (-652.486) (-646.529) -- 0:00:57
358500 -- [-644.555] (-663.898) (-655.272) (-653.548) * [-641.949] (-641.859) (-657.332) (-660.208) -- 0:00:57
359000 -- (-651.122) (-656.785) [-656.225] (-654.112) * (-644.944) [-644.111] (-648.098) (-660.411) -- 0:00:57
359500 -- (-646.564) [-646.130] (-646.136) (-645.550) * (-640.584) [-641.848] (-657.533) (-660.995) -- 0:00:57
360000 -- (-643.952) [-641.589] (-658.229) (-654.156) * (-647.082) [-644.311] (-646.247) (-663.305) -- 0:00:56
Average standard deviation of split frequencies: 0.011763
360500 -- (-651.983) [-640.525] (-658.156) (-651.571) * (-636.022) (-649.454) (-657.128) [-654.724] -- 0:00:56
361000 -- (-654.413) (-651.472) [-646.889] (-647.486) * (-667.317) [-648.331] (-657.465) (-658.926) -- 0:00:56
361500 -- (-664.644) (-667.767) [-642.321] (-655.565) * (-661.369) [-647.315] (-645.278) (-654.759) -- 0:00:56
362000 -- [-647.956] (-651.801) (-644.280) (-652.001) * (-667.189) [-651.186] (-649.830) (-658.115) -- 0:00:56
362500 -- (-643.823) (-662.901) (-643.239) [-653.530] * [-646.913] (-656.455) (-646.790) (-656.167) -- 0:00:56
363000 -- (-651.716) (-660.030) [-650.885] (-644.892) * (-651.640) [-651.327] (-653.474) (-643.015) -- 0:00:56
363500 -- [-643.486] (-664.011) (-656.539) (-650.838) * [-645.163] (-661.341) (-646.193) (-650.222) -- 0:00:56
364000 -- [-649.326] (-649.195) (-656.022) (-646.704) * [-640.269] (-650.477) (-658.315) (-645.627) -- 0:00:55
364500 -- (-647.939) (-660.499) (-654.199) [-642.005] * (-640.098) (-650.406) (-661.564) [-644.465] -- 0:00:55
365000 -- [-652.733] (-655.724) (-648.754) (-657.472) * (-647.239) (-649.754) (-657.104) [-641.670] -- 0:00:55
Average standard deviation of split frequencies: 0.012397
365500 -- (-646.930) (-656.718) [-644.245] (-659.010) * [-639.258] (-655.543) (-649.757) (-645.739) -- 0:00:55
366000 -- (-656.944) (-650.256) [-641.700] (-661.484) * (-647.117) (-645.040) (-646.940) [-641.053] -- 0:00:55
366500 -- (-653.373) (-643.320) [-648.546] (-655.007) * (-647.812) (-643.633) [-638.683] (-648.685) -- 0:00:55
367000 -- (-655.829) (-641.500) [-643.541] (-661.571) * [-643.155] (-651.877) (-644.676) (-652.660) -- 0:00:55
367500 -- (-648.240) (-658.414) (-649.851) [-648.276] * [-645.715] (-653.956) (-644.517) (-652.090) -- 0:00:56
368000 -- [-647.559] (-653.155) (-646.057) (-651.626) * [-640.887] (-653.899) (-643.639) (-656.100) -- 0:00:56
368500 -- [-644.200] (-654.784) (-659.250) (-651.537) * [-644.304] (-659.682) (-657.961) (-649.704) -- 0:00:56
369000 -- (-647.139) (-650.356) [-659.485] (-646.081) * (-640.180) (-650.526) (-658.799) [-638.652] -- 0:00:56
369500 -- [-647.912] (-644.849) (-655.868) (-649.409) * [-637.098] (-662.416) (-655.188) (-657.117) -- 0:00:56
370000 -- (-639.021) (-639.251) [-648.801] (-640.921) * [-642.966] (-651.026) (-652.503) (-655.542) -- 0:00:56
Average standard deviation of split frequencies: 0.011684
370500 -- [-652.411] (-642.824) (-661.050) (-649.348) * (-646.976) [-642.449] (-660.898) (-659.992) -- 0:00:56
371000 -- (-642.352) (-644.196) [-642.099] (-660.071) * [-637.050] (-642.238) (-654.455) (-656.983) -- 0:00:55
371500 -- (-653.350) (-645.525) [-638.408] (-643.916) * (-645.364) [-646.776] (-654.877) (-654.120) -- 0:00:55
372000 -- (-648.483) [-643.048] (-648.566) (-650.728) * (-643.264) [-642.485] (-646.831) (-654.007) -- 0:00:55
372500 -- [-646.306] (-665.526) (-640.998) (-653.014) * (-647.323) (-642.551) [-642.023] (-655.179) -- 0:00:55
373000 -- [-657.004] (-648.736) (-661.149) (-646.556) * [-643.488] (-645.631) (-651.270) (-654.255) -- 0:00:55
373500 -- (-657.869) [-645.257] (-648.625) (-649.009) * [-643.348] (-651.406) (-661.733) (-651.897) -- 0:00:55
374000 -- (-661.808) [-643.736] (-650.956) (-652.148) * (-639.657) [-642.448] (-654.766) (-655.656) -- 0:00:55
374500 -- (-652.917) (-643.386) [-639.690] (-637.232) * [-640.811] (-651.902) (-649.726) (-642.380) -- 0:00:55
375000 -- (-655.212) (-642.698) (-646.594) [-646.873] * [-643.474] (-647.507) (-653.656) (-651.223) -- 0:00:55
Average standard deviation of split frequencies: 0.011519
375500 -- (-651.761) [-641.441] (-659.437) (-642.027) * [-653.985] (-650.254) (-654.141) (-650.411) -- 0:00:54
376000 -- [-641.082] (-644.611) (-652.420) (-659.809) * (-641.298) [-656.074] (-652.147) (-654.989) -- 0:00:54
376500 -- (-665.333) [-637.975] (-643.725) (-645.264) * [-640.234] (-658.283) (-654.685) (-654.859) -- 0:00:54
377000 -- (-652.798) (-640.877) (-647.430) [-655.926] * (-645.763) [-638.214] (-658.347) (-659.211) -- 0:00:54
377500 -- [-640.759] (-641.554) (-653.753) (-654.120) * [-641.931] (-646.441) (-663.663) (-649.088) -- 0:00:54
378000 -- (-646.702) [-647.821] (-652.735) (-647.191) * [-642.330] (-652.947) (-660.400) (-645.322) -- 0:00:54
378500 -- (-653.968) [-647.954] (-645.521) (-652.502) * [-641.550] (-660.063) (-643.933) (-655.310) -- 0:00:54
379000 -- (-664.051) [-642.395] (-643.203) (-649.399) * [-641.357] (-640.165) (-652.428) (-654.517) -- 0:00:55
379500 -- [-642.138] (-643.381) (-650.141) (-664.520) * (-638.184) [-644.615] (-659.051) (-655.017) -- 0:00:55
380000 -- [-637.593] (-642.878) (-650.638) (-653.928) * (-645.511) [-643.869] (-660.786) (-651.952) -- 0:00:55
Average standard deviation of split frequencies: 0.011145
380500 -- (-642.914) [-641.374] (-646.547) (-651.305) * [-645.301] (-648.330) (-661.230) (-651.814) -- 0:00:55
381000 -- (-648.701) (-646.117) [-644.742] (-648.077) * (-650.530) (-650.759) [-655.714] (-646.688) -- 0:00:55
381500 -- (-662.016) [-640.510] (-644.285) (-643.533) * [-650.319] (-654.300) (-650.553) (-643.010) -- 0:00:55
382000 -- (-663.616) (-638.101) [-643.398] (-653.791) * (-640.023) (-653.021) (-644.950) [-641.445] -- 0:00:55
382500 -- (-661.013) (-641.541) [-643.633] (-647.398) * (-648.456) (-647.656) (-644.641) [-640.787] -- 0:00:54
383000 -- (-642.503) [-640.254] (-646.004) (-643.177) * [-643.517] (-661.751) (-653.953) (-641.254) -- 0:00:54
383500 -- (-641.752) [-643.049] (-650.660) (-655.423) * (-648.827) (-645.176) (-643.403) [-640.337] -- 0:00:54
384000 -- (-648.151) [-645.564] (-655.493) (-646.963) * (-647.948) (-652.965) [-642.364] (-639.173) -- 0:00:54
384500 -- (-652.169) (-643.356) [-645.907] (-655.365) * (-648.046) (-658.706) (-642.625) [-648.714] -- 0:00:54
385000 -- (-648.394) [-640.620] (-650.509) (-651.459) * (-652.278) (-648.362) (-644.566) [-639.061] -- 0:00:54
Average standard deviation of split frequencies: 0.011063
385500 -- (-651.278) [-638.156] (-648.105) (-653.417) * (-658.794) (-645.765) (-652.081) [-640.038] -- 0:00:54
386000 -- (-642.895) [-637.605] (-646.855) (-646.879) * (-650.304) (-645.107) (-655.265) [-638.655] -- 0:00:54
386500 -- (-641.622) [-640.549] (-660.005) (-648.276) * (-660.737) (-650.328) (-656.089) [-641.107] -- 0:00:53
387000 -- (-646.266) (-653.386) [-650.858] (-646.527) * (-647.338) [-648.420] (-653.876) (-637.329) -- 0:00:53
387500 -- (-667.266) (-656.027) [-646.166] (-649.168) * (-646.925) (-646.592) (-648.288) [-639.692] -- 0:00:53
388000 -- (-656.100) (-640.070) [-646.939] (-650.233) * [-644.517] (-656.506) (-654.597) (-642.912) -- 0:00:53
388500 -- (-657.159) (-653.680) (-641.180) [-641.462] * (-653.880) (-659.872) (-653.902) [-641.986] -- 0:00:53
389000 -- (-657.201) [-650.566] (-645.257) (-643.717) * (-653.872) (-649.399) (-644.742) [-638.683] -- 0:00:53
389500 -- (-650.819) [-642.147] (-657.495) (-645.590) * (-653.099) (-643.623) [-640.189] (-646.994) -- 0:00:53
390000 -- (-656.279) (-651.865) [-648.925] (-648.276) * (-656.440) [-649.828] (-652.162) (-642.128) -- 0:00:53
Average standard deviation of split frequencies: 0.010292
390500 -- (-650.053) (-652.381) (-646.075) [-648.127] * (-652.760) (-657.689) [-651.292] (-651.420) -- 0:00:54
391000 -- [-653.463] (-655.027) (-648.266) (-640.534) * (-656.438) (-664.265) [-642.906] (-652.984) -- 0:00:54
391500 -- (-652.602) [-646.267] (-642.671) (-646.134) * (-658.597) (-658.147) [-651.835] (-655.276) -- 0:00:54
392000 -- (-656.847) (-644.609) (-653.713) [-649.060] * (-655.781) (-653.890) [-644.719] (-658.989) -- 0:00:54
392500 -- (-654.170) [-643.312] (-644.308) (-653.178) * (-645.843) [-656.011] (-648.845) (-648.173) -- 0:00:54
393000 -- (-664.680) (-648.327) [-645.194] (-647.763) * (-651.034) (-660.420) [-641.626] (-656.616) -- 0:00:54
393500 -- (-655.235) (-642.657) (-651.387) [-653.350] * (-651.287) (-657.632) [-642.375] (-649.737) -- 0:00:53
394000 -- (-642.558) (-656.001) [-653.371] (-657.279) * (-654.338) (-649.958) (-657.458) [-646.944] -- 0:00:53
394500 -- [-650.916] (-652.931) (-657.485) (-642.593) * (-657.757) (-650.728) (-656.982) [-643.429] -- 0:00:53
395000 -- [-647.791] (-650.459) (-648.690) (-650.269) * (-664.654) (-644.952) (-644.284) [-645.170] -- 0:00:53
Average standard deviation of split frequencies: 0.010119
395500 -- (-659.208) [-653.216] (-648.767) (-658.226) * (-642.038) (-664.191) (-653.605) [-645.724] -- 0:00:53
396000 -- [-649.830] (-658.878) (-660.900) (-647.565) * (-652.908) (-645.284) [-651.654] (-650.185) -- 0:00:53
396500 -- (-656.131) [-647.472] (-651.288) (-641.666) * (-651.017) (-645.445) (-652.578) [-646.129] -- 0:00:53
397000 -- (-655.236) (-651.350) [-649.372] (-641.223) * [-643.661] (-651.137) (-654.722) (-658.436) -- 0:00:53
397500 -- (-652.950) (-653.408) (-652.865) [-639.269] * [-644.133] (-651.262) (-647.642) (-657.736) -- 0:00:53
398000 -- (-647.363) (-651.056) [-639.305] (-645.171) * [-643.869] (-664.116) (-650.153) (-653.707) -- 0:00:52
398500 -- (-644.099) [-636.634] (-656.303) (-647.014) * (-649.545) (-659.217) [-643.534] (-658.309) -- 0:00:52
399000 -- (-644.223) (-650.665) [-642.857] (-646.357) * [-643.997] (-647.744) (-650.062) (-653.339) -- 0:00:52
399500 -- (-646.898) (-659.693) [-647.480] (-646.088) * (-641.541) [-652.981] (-650.338) (-656.450) -- 0:00:52
400000 -- (-647.823) (-652.421) [-650.871] (-647.416) * (-649.471) (-651.562) [-642.165] (-647.802) -- 0:00:52
Average standard deviation of split frequencies: 0.010451
400500 -- [-648.371] (-653.922) (-659.250) (-641.050) * (-639.480) [-657.420] (-642.044) (-648.076) -- 0:00:52
401000 -- (-640.885) (-655.820) (-648.794) [-642.263] * (-642.352) (-651.459) [-657.420] (-641.104) -- 0:00:52
401500 -- [-652.218] (-657.915) (-647.730) (-640.262) * (-645.561) (-654.834) [-638.427] (-656.341) -- 0:00:52
402000 -- [-645.209] (-654.945) (-648.742) (-636.967) * (-651.505) (-650.394) (-647.216) [-650.847] -- 0:00:53
402500 -- (-644.868) (-640.761) (-649.500) [-637.112] * (-653.108) (-647.418) (-651.203) [-643.826] -- 0:00:53
403000 -- [-643.666] (-658.743) (-642.310) (-650.893) * (-653.665) (-650.350) (-662.047) [-644.861] -- 0:00:53
403500 -- (-640.099) (-661.906) [-644.684] (-646.356) * (-647.363) [-644.475] (-650.507) (-643.756) -- 0:00:53
404000 -- (-642.869) (-654.321) (-650.494) [-640.797] * [-636.841] (-667.111) (-647.255) (-647.711) -- 0:00:53
404500 -- (-652.472) (-652.912) (-652.381) [-649.405] * [-638.643] (-646.421) (-641.098) (-652.108) -- 0:00:52
405000 -- (-660.339) (-645.796) [-649.918] (-649.347) * (-646.478) [-643.531] (-649.624) (-657.266) -- 0:00:52
Average standard deviation of split frequencies: 0.009031
405500 -- (-659.166) (-649.413) (-645.381) [-644.073] * (-648.527) [-639.060] (-649.850) (-656.126) -- 0:00:52
406000 -- (-644.656) (-651.959) (-650.474) [-640.741] * (-642.733) [-640.192] (-654.696) (-650.077) -- 0:00:52
406500 -- (-644.211) (-657.918) (-646.391) [-649.600] * (-640.924) (-646.651) (-657.376) [-646.701] -- 0:00:52
407000 -- (-647.719) (-662.024) (-651.208) [-645.807] * (-653.470) [-645.830] (-655.576) (-655.456) -- 0:00:52
407500 -- [-643.797] (-658.273) (-645.125) (-654.585) * (-658.964) [-639.460] (-660.415) (-646.178) -- 0:00:52
408000 -- (-649.042) (-654.353) [-647.314] (-650.405) * (-657.059) [-640.166] (-661.428) (-651.793) -- 0:00:52
408500 -- (-651.127) (-649.828) (-647.607) [-648.519] * (-658.723) (-640.341) (-639.973) [-640.008] -- 0:00:52
409000 -- (-664.988) (-650.226) (-654.297) [-650.045] * (-657.461) [-639.312] (-648.120) (-648.356) -- 0:00:52
409500 -- (-655.687) (-643.188) (-650.088) [-649.945] * (-662.978) [-637.936] (-647.660) (-650.391) -- 0:00:51
410000 -- (-651.463) (-658.486) (-650.797) [-653.060] * [-650.270] (-648.521) (-644.257) (-649.544) -- 0:00:51
Average standard deviation of split frequencies: 0.009048
410500 -- [-641.606] (-661.099) (-644.810) (-657.422) * [-640.413] (-659.212) (-652.383) (-652.424) -- 0:00:51
411000 -- (-640.589) (-655.259) [-650.085] (-652.426) * [-644.457] (-656.620) (-645.253) (-649.028) -- 0:00:51
411500 -- (-643.533) (-657.001) [-645.336] (-648.134) * (-651.284) (-669.085) (-641.848) [-643.314] -- 0:00:51
412000 -- [-638.912] (-660.023) (-649.638) (-644.901) * (-647.742) [-647.901] (-652.238) (-640.582) -- 0:00:51
412500 -- (-639.030) (-660.908) (-654.976) [-645.080] * (-655.530) (-650.426) [-643.568] (-646.076) -- 0:00:51
413000 -- [-642.683] (-642.995) (-651.639) (-645.407) * (-653.605) (-645.883) (-643.188) [-645.254] -- 0:00:51
413500 -- [-641.774] (-647.865) (-671.794) (-638.124) * (-642.297) (-646.999) [-643.138] (-654.403) -- 0:00:52
414000 -- (-649.754) [-641.910] (-656.736) (-640.796) * (-643.550) (-646.714) [-639.563] (-649.256) -- 0:00:52
414500 -- (-647.462) (-654.853) (-659.431) [-641.202] * (-646.999) (-652.759) (-655.007) [-650.918] -- 0:00:52
415000 -- (-655.956) (-639.434) (-656.980) [-640.377] * [-651.548] (-661.171) (-655.498) (-647.131) -- 0:00:52
Average standard deviation of split frequencies: 0.009349
415500 -- (-649.173) [-646.957] (-648.351) (-638.788) * [-641.881] (-653.079) (-662.446) (-651.020) -- 0:00:52
416000 -- (-647.046) (-651.329) (-653.603) [-642.814] * (-646.607) (-649.784) [-643.097] (-652.445) -- 0:00:51
416500 -- (-652.364) (-651.965) [-650.877] (-640.243) * (-644.980) [-644.161] (-647.372) (-655.322) -- 0:00:51
417000 -- [-650.469] (-639.597) (-649.921) (-643.804) * [-643.933] (-654.796) (-661.173) (-654.299) -- 0:00:51
417500 -- (-645.537) [-638.556] (-642.244) (-649.827) * [-645.096] (-659.147) (-658.040) (-646.439) -- 0:00:51
418000 -- [-650.666] (-646.987) (-645.925) (-653.122) * (-650.597) (-667.908) (-664.197) [-639.101] -- 0:00:51
418500 -- (-647.169) [-642.181] (-646.449) (-650.125) * (-646.170) (-657.855) (-644.217) [-645.071] -- 0:00:51
419000 -- (-645.545) [-646.312] (-653.620) (-642.267) * (-640.428) (-661.940) [-643.536] (-656.109) -- 0:00:51
419500 -- [-643.708] (-658.167) (-656.029) (-656.011) * (-644.397) (-656.370) (-647.830) [-656.072] -- 0:00:51
420000 -- [-642.930] (-658.515) (-646.569) (-655.511) * (-653.475) (-656.409) [-647.042] (-648.292) -- 0:00:51
Average standard deviation of split frequencies: 0.010015
420500 -- (-645.324) [-656.452] (-655.754) (-654.571) * (-643.154) (-661.713) [-636.266] (-646.905) -- 0:00:50
421000 -- (-651.502) (-655.483) [-643.326] (-643.798) * [-649.505] (-651.824) (-648.745) (-643.972) -- 0:00:50
421500 -- (-648.493) [-643.145] (-645.121) (-647.173) * [-637.965] (-642.123) (-651.369) (-661.021) -- 0:00:50
422000 -- (-648.319) (-652.701) [-643.103] (-637.741) * (-655.202) [-647.099] (-652.685) (-644.708) -- 0:00:50
422500 -- (-641.905) [-645.361] (-653.181) (-656.435) * (-650.281) (-660.281) [-645.223] (-652.075) -- 0:00:50
423000 -- (-650.131) [-646.287] (-650.545) (-644.036) * (-660.134) [-658.123] (-649.052) (-648.293) -- 0:00:50
423500 -- [-646.874] (-657.176) (-655.347) (-652.263) * (-650.335) (-655.717) [-647.919] (-661.602) -- 0:00:50
424000 -- (-660.143) (-659.496) [-650.510] (-643.624) * (-660.484) (-658.861) [-646.367] (-649.554) -- 0:00:50
424500 -- [-645.117] (-654.515) (-652.153) (-646.491) * (-657.873) (-658.010) [-647.652] (-647.775) -- 0:00:51
425000 -- (-637.265) (-661.311) (-649.479) [-646.185] * [-659.133] (-656.585) (-650.568) (-649.385) -- 0:00:51
Average standard deviation of split frequencies: 0.010675
425500 -- (-655.177) [-650.740] (-653.873) (-648.608) * (-650.672) (-652.215) (-642.594) [-640.870] -- 0:00:51
426000 -- (-656.728) (-648.338) (-656.985) [-645.235] * (-655.725) (-650.011) [-640.993] (-653.470) -- 0:00:51
426500 -- (-648.189) [-643.630] (-651.770) (-650.065) * (-653.289) [-648.572] (-653.106) (-655.780) -- 0:00:51
427000 -- [-643.513] (-653.911) (-652.498) (-651.021) * (-657.641) [-648.062] (-646.087) (-660.531) -- 0:00:50
427500 -- [-646.110] (-649.015) (-656.624) (-650.532) * (-661.777) (-648.851) [-640.271] (-661.780) -- 0:00:50
428000 -- [-648.076] (-653.156) (-656.930) (-639.923) * (-654.941) (-642.291) [-648.560] (-656.019) -- 0:00:50
428500 -- (-649.975) (-648.960) (-654.309) [-642.783] * (-658.146) (-650.946) (-644.326) [-646.441] -- 0:00:50
429000 -- (-652.813) (-654.917) [-648.745] (-657.345) * (-663.294) (-651.984) (-650.635) [-646.207] -- 0:00:50
429500 -- (-654.063) (-658.304) [-651.709] (-650.300) * (-658.504) (-646.546) [-639.329] (-651.801) -- 0:00:50
430000 -- [-650.567] (-650.755) (-647.819) (-647.361) * (-652.576) [-644.804] (-650.962) (-646.063) -- 0:00:50
Average standard deviation of split frequencies: 0.010399
430500 -- (-654.239) (-654.450) [-645.508] (-641.998) * (-646.165) (-642.805) (-658.515) [-653.403] -- 0:00:50
431000 -- (-648.729) (-659.714) [-643.903] (-653.921) * [-644.698] (-649.800) (-650.217) (-649.290) -- 0:00:50
431500 -- (-649.735) [-642.020] (-645.018) (-655.472) * (-647.589) [-649.690] (-649.907) (-649.915) -- 0:00:50
432000 -- (-650.559) [-649.916] (-644.843) (-661.132) * (-643.697) (-642.818) (-654.619) [-644.838] -- 0:00:49
432500 -- (-659.020) (-651.276) (-646.328) [-656.716] * (-652.869) (-646.110) (-648.633) [-646.842] -- 0:00:49
433000 -- (-649.120) (-654.152) [-648.945] (-646.643) * (-653.091) (-648.142) [-647.578] (-652.184) -- 0:00:49
433500 -- (-642.882) (-648.983) [-641.365] (-651.242) * (-660.901) (-659.318) [-643.054] (-645.650) -- 0:00:49
434000 -- (-656.760) (-644.329) [-639.887] (-645.005) * (-661.081) [-645.080] (-648.105) (-647.998) -- 0:00:49
434500 -- (-660.777) (-648.960) [-637.134] (-642.978) * (-651.296) (-652.394) (-646.047) [-644.316] -- 0:00:49
435000 -- (-662.934) (-654.932) (-645.332) [-650.737] * (-657.892) (-643.686) [-655.886] (-644.552) -- 0:00:49
Average standard deviation of split frequencies: 0.010430
435500 -- [-648.601] (-653.539) (-644.034) (-651.976) * (-655.651) (-646.137) [-644.315] (-659.449) -- 0:00:49
436000 -- (-646.575) (-644.908) (-640.772) [-655.430] * (-648.076) (-658.260) (-646.422) [-643.137] -- 0:00:50
436500 -- [-645.454] (-659.981) (-643.080) (-646.929) * (-648.693) (-654.368) [-643.100] (-643.965) -- 0:00:50
437000 -- (-649.513) [-647.447] (-644.483) (-643.248) * (-653.827) (-643.061) (-644.351) [-646.507] -- 0:00:50
437500 -- (-655.640) (-645.416) [-642.943] (-649.142) * (-654.566) (-646.679) [-648.029] (-649.152) -- 0:00:50
438000 -- (-660.149) [-655.984] (-645.499) (-656.816) * (-657.919) (-649.361) [-652.464] (-641.694) -- 0:00:50
438500 -- (-654.105) (-653.367) [-643.625] (-637.946) * [-647.124] (-655.566) (-664.854) (-637.610) -- 0:00:49
439000 -- (-656.629) [-645.027] (-647.704) (-646.128) * (-656.874) (-654.337) (-646.825) [-646.682] -- 0:00:49
439500 -- (-654.803) (-643.568) (-659.483) [-647.102] * (-663.826) (-648.097) (-647.104) [-640.806] -- 0:00:49
440000 -- [-641.710] (-653.157) (-659.929) (-645.146) * (-654.940) (-676.642) (-647.565) [-640.928] -- 0:00:49
Average standard deviation of split frequencies: 0.009360
440500 -- [-638.263] (-657.391) (-658.995) (-647.727) * [-651.529] (-649.347) (-641.757) (-652.329) -- 0:00:49
441000 -- (-645.907) (-654.577) (-649.581) [-646.938] * (-646.692) (-651.059) [-647.364] (-649.812) -- 0:00:49
441500 -- (-649.041) (-652.795) (-656.028) [-643.957] * (-645.843) (-645.805) [-644.789] (-651.876) -- 0:00:49
442000 -- (-643.452) (-650.094) (-644.669) [-652.198] * (-645.511) [-645.745] (-640.836) (-652.738) -- 0:00:49
442500 -- [-642.135] (-650.690) (-652.042) (-663.191) * (-662.393) [-641.095] (-643.184) (-650.589) -- 0:00:49
443000 -- [-644.720] (-657.365) (-646.382) (-657.081) * (-657.663) (-650.446) [-640.648] (-645.032) -- 0:00:49
443500 -- [-635.244] (-646.636) (-649.406) (-661.825) * (-648.089) [-652.736] (-638.581) (-645.066) -- 0:00:48
444000 -- (-641.651) (-649.012) [-647.914] (-651.047) * (-651.505) (-655.660) [-641.295] (-643.661) -- 0:00:48
444500 -- (-641.564) (-648.883) [-649.198] (-650.515) * (-654.449) (-646.241) [-641.723] (-640.928) -- 0:00:48
445000 -- [-637.701] (-644.665) (-651.585) (-656.727) * (-644.726) (-651.069) [-642.307] (-649.998) -- 0:00:48
Average standard deviation of split frequencies: 0.009711
445500 -- (-637.425) (-648.872) [-651.384] (-647.812) * (-663.734) (-658.309) [-643.049] (-641.287) -- 0:00:48
446000 -- (-639.447) (-648.253) (-653.521) [-645.851] * (-648.725) (-646.044) [-638.456] (-661.958) -- 0:00:48
446500 -- [-646.392] (-650.616) (-660.778) (-650.945) * (-644.185) (-654.099) [-644.227] (-656.701) -- 0:00:48
447000 -- (-638.951) (-657.191) (-646.519) [-644.932] * [-647.065] (-652.687) (-637.928) (-650.858) -- 0:00:48
447500 -- [-640.217] (-651.067) (-651.861) (-648.628) * (-659.655) (-642.159) [-647.236] (-658.186) -- 0:00:49
448000 -- (-646.335) (-660.135) [-648.593] (-649.323) * (-646.955) (-651.623) [-642.996] (-653.473) -- 0:00:49
448500 -- [-649.911] (-658.166) (-652.704) (-644.928) * (-660.827) (-659.995) (-639.916) [-643.597] -- 0:00:49
449000 -- [-642.967] (-662.159) (-648.703) (-650.442) * (-654.789) [-650.440] (-638.580) (-652.165) -- 0:00:49
449500 -- (-642.967) (-659.203) [-643.694] (-654.020) * (-661.853) [-648.269] (-643.829) (-652.688) -- 0:00:48
450000 -- (-648.235) [-651.921] (-650.622) (-665.363) * (-654.784) (-647.971) [-647.003] (-642.001) -- 0:00:48
Average standard deviation of split frequencies: 0.010091
450500 -- (-643.104) [-648.454] (-651.252) (-650.373) * (-658.560) (-650.387) [-644.704] (-653.369) -- 0:00:48
451000 -- [-639.653] (-647.636) (-644.249) (-656.228) * (-644.160) (-666.539) [-641.567] (-654.961) -- 0:00:48
451500 -- (-656.164) [-646.796] (-647.168) (-664.408) * (-652.278) (-651.924) (-643.500) [-653.225] -- 0:00:48
452000 -- (-646.280) [-646.509] (-655.401) (-661.607) * (-660.700) (-642.246) [-648.026] (-646.528) -- 0:00:48
452500 -- [-648.841] (-659.410) (-652.608) (-639.163) * (-642.935) (-650.452) [-642.717] (-648.419) -- 0:00:48
453000 -- [-652.050] (-644.072) (-662.792) (-649.390) * [-649.189] (-644.562) (-657.318) (-648.452) -- 0:00:48
453500 -- (-639.502) (-656.586) (-654.980) [-651.687] * (-646.708) (-643.939) (-655.524) [-654.250] -- 0:00:48
454000 -- (-646.698) (-649.036) (-642.479) [-650.735] * (-643.887) (-652.899) (-646.386) [-647.250] -- 0:00:48
454500 -- [-652.888] (-650.454) (-655.543) (-646.830) * [-646.026] (-647.128) (-655.998) (-655.909) -- 0:00:48
455000 -- (-645.264) [-647.275] (-644.600) (-643.181) * [-643.715] (-658.416) (-654.606) (-648.123) -- 0:00:47
Average standard deviation of split frequencies: 0.010912
455500 -- (-646.901) (-654.402) (-649.600) [-640.523] * (-659.002) (-654.949) [-642.032] (-652.958) -- 0:00:47
456000 -- (-647.864) (-653.323) (-651.068) [-638.005] * [-651.195] (-648.212) (-652.427) (-667.924) -- 0:00:47
456500 -- (-651.815) (-651.483) (-653.411) [-642.737] * (-650.319) [-643.130] (-649.682) (-648.431) -- 0:00:47
457000 -- [-643.026] (-643.580) (-664.261) (-642.234) * (-659.448) (-646.894) [-651.870] (-642.795) -- 0:00:47
457500 -- (-656.841) [-648.171] (-650.058) (-648.528) * (-656.466) (-649.804) [-643.274] (-653.400) -- 0:00:47
458000 -- (-653.856) [-645.471] (-650.723) (-663.515) * [-652.035] (-647.697) (-654.334) (-642.270) -- 0:00:47
458500 -- (-657.390) (-648.683) (-652.435) [-660.766] * (-657.181) [-651.344] (-646.714) (-643.757) -- 0:00:47
459000 -- (-655.589) (-649.130) [-647.410] (-646.867) * [-654.904] (-643.619) (-650.222) (-653.365) -- 0:00:48
459500 -- (-657.654) (-645.846) (-647.526) [-642.727] * (-658.222) (-654.547) (-648.410) [-642.949] -- 0:00:48
460000 -- (-656.515) (-655.251) [-647.163] (-658.327) * [-655.005] (-644.187) (-648.567) (-655.533) -- 0:00:48
Average standard deviation of split frequencies: 0.010858
460500 -- (-658.474) [-644.297] (-667.463) (-659.936) * (-656.150) [-642.392] (-651.277) (-655.155) -- 0:00:48
461000 -- (-640.828) [-653.130] (-660.986) (-648.122) * (-649.886) [-641.938] (-650.701) (-649.354) -- 0:00:47
461500 -- (-653.607) (-659.963) (-662.049) [-644.888] * (-647.715) [-643.717] (-654.928) (-660.050) -- 0:00:47
462000 -- (-649.685) [-646.988] (-655.203) (-644.303) * (-660.100) (-645.760) [-646.756] (-647.029) -- 0:00:47
462500 -- (-651.305) [-645.850] (-655.871) (-650.685) * (-665.472) [-645.185] (-652.977) (-650.159) -- 0:00:47
463000 -- (-645.936) (-646.373) (-653.801) [-649.441] * (-652.481) [-648.904] (-650.000) (-652.728) -- 0:00:47
463500 -- (-654.156) [-649.046] (-656.231) (-652.286) * (-647.195) (-645.799) [-643.094] (-645.450) -- 0:00:47
464000 -- (-656.144) (-648.396) (-658.231) [-644.467] * (-643.402) (-654.136) (-646.397) [-648.938] -- 0:00:47
464500 -- (-656.372) (-651.652) (-660.276) [-647.279] * (-648.078) [-650.465] (-648.989) (-659.784) -- 0:00:47
465000 -- (-656.886) (-657.401) (-645.845) [-642.236] * (-652.479) (-665.354) (-652.632) [-640.172] -- 0:00:47
Average standard deviation of split frequencies: 0.009530
465500 -- (-652.598) (-649.204) [-645.941] (-654.131) * (-650.876) (-651.021) (-660.296) [-640.025] -- 0:00:47
466000 -- (-656.417) (-646.366) [-643.897] (-657.337) * (-652.237) (-650.114) (-658.676) [-643.103] -- 0:00:46
466500 -- (-650.616) (-649.076) (-654.300) [-648.011] * (-653.419) (-655.352) (-659.183) [-649.203] -- 0:00:46
467000 -- [-637.796] (-648.518) (-643.988) (-656.447) * (-659.563) [-648.321] (-651.552) (-640.007) -- 0:00:46
467500 -- (-644.847) (-656.986) [-644.202] (-652.066) * (-655.857) (-651.910) (-655.816) [-650.288] -- 0:00:46
468000 -- (-644.234) (-656.867) [-644.068] (-643.973) * (-650.145) [-645.829] (-646.942) (-644.857) -- 0:00:46
468500 -- (-656.093) (-651.417) (-644.416) [-654.301] * (-658.113) [-647.506] (-645.542) (-647.255) -- 0:00:46
469000 -- [-649.763] (-653.410) (-653.639) (-655.532) * (-640.263) (-654.100) (-661.741) [-646.660] -- 0:00:46
469500 -- (-654.374) (-652.340) (-645.529) [-648.663] * [-645.885] (-647.815) (-671.272) (-639.455) -- 0:00:46
470000 -- (-662.662) [-642.444] (-649.364) (-668.103) * [-641.370] (-653.524) (-664.508) (-644.544) -- 0:00:47
Average standard deviation of split frequencies: 0.009404
470500 -- (-658.406) (-652.425) [-641.992] (-648.535) * (-652.917) (-649.450) (-666.462) [-650.731] -- 0:00:47
471000 -- [-652.911] (-655.614) (-646.810) (-668.832) * [-651.922] (-651.592) (-651.769) (-655.821) -- 0:00:47
471500 -- [-651.528] (-662.561) (-646.342) (-656.457) * [-641.535] (-656.109) (-652.777) (-650.614) -- 0:00:47
472000 -- (-654.002) (-657.076) [-643.023] (-665.919) * [-649.535] (-659.102) (-643.173) (-648.844) -- 0:00:46
472500 -- (-649.572) [-642.891] (-644.018) (-657.124) * [-644.251] (-654.386) (-642.212) (-652.120) -- 0:00:46
473000 -- (-650.750) (-658.930) (-644.967) [-642.604] * [-653.628] (-650.746) (-648.578) (-658.115) -- 0:00:46
473500 -- (-651.329) (-653.390) (-646.353) [-648.142] * [-644.828] (-653.492) (-649.256) (-646.234) -- 0:00:46
474000 -- (-647.249) (-654.187) (-649.275) [-641.816] * (-651.449) (-655.141) [-642.705] (-647.452) -- 0:00:46
474500 -- (-640.082) [-648.314] (-650.451) (-659.735) * [-647.010] (-645.273) (-654.166) (-654.569) -- 0:00:46
475000 -- (-642.563) (-647.625) [-645.573] (-660.801) * (-646.029) (-645.719) [-649.949] (-661.546) -- 0:00:46
Average standard deviation of split frequencies: 0.009787
475500 -- [-650.288] (-644.715) (-656.867) (-655.043) * (-647.836) [-649.266] (-649.242) (-653.635) -- 0:00:46
476000 -- (-650.274) (-652.925) [-639.771] (-655.751) * (-652.087) (-643.083) [-642.839] (-655.728) -- 0:00:46
476500 -- (-647.637) (-655.877) [-642.374] (-653.380) * (-655.254) [-646.360] (-649.829) (-657.809) -- 0:00:46
477000 -- [-641.288] (-651.346) (-645.837) (-653.589) * [-646.170] (-644.552) (-643.031) (-658.773) -- 0:00:46
477500 -- [-638.434] (-649.786) (-650.293) (-658.463) * (-654.289) [-645.445] (-654.657) (-658.889) -- 0:00:45
478000 -- [-638.304] (-663.949) (-649.096) (-648.123) * (-650.628) (-652.994) [-649.769] (-654.532) -- 0:00:45
478500 -- (-645.683) (-649.110) [-640.959] (-652.049) * [-646.355] (-649.771) (-657.810) (-652.721) -- 0:00:45
479000 -- (-646.389) (-660.958) (-646.457) [-647.245] * (-652.647) [-645.852] (-653.475) (-652.637) -- 0:00:45
479500 -- (-658.721) (-648.430) [-646.623] (-646.476) * (-651.772) (-660.662) (-653.110) [-648.508] -- 0:00:45
480000 -- (-657.462) (-644.436) (-651.834) [-642.456] * [-639.404] (-652.227) (-646.653) (-663.242) -- 0:00:45
Average standard deviation of split frequencies: 0.009807
480500 -- (-649.868) (-643.763) [-639.201] (-650.461) * (-654.115) (-646.231) (-653.409) [-643.471] -- 0:00:45
481000 -- (-663.343) (-654.010) [-642.979] (-648.588) * [-640.958] (-646.896) (-654.383) (-655.250) -- 0:00:45
481500 -- (-662.011) (-658.192) [-654.790] (-638.395) * (-652.543) [-649.203] (-647.181) (-655.197) -- 0:00:46
482000 -- (-649.654) (-654.004) [-642.005] (-639.723) * (-652.954) [-657.123] (-654.744) (-658.615) -- 0:00:46
482500 -- (-653.328) (-661.222) (-649.368) [-648.568] * (-662.234) (-656.617) [-635.117] (-652.036) -- 0:00:46
483000 -- [-643.870] (-663.189) (-648.760) (-647.057) * (-644.101) [-648.200] (-642.231) (-653.290) -- 0:00:46
483500 -- (-640.868) (-659.780) (-653.031) [-637.366] * [-647.002] (-646.874) (-652.800) (-652.639) -- 0:00:45
484000 -- (-640.148) (-650.147) (-648.797) [-641.842] * (-651.355) (-653.776) (-636.671) [-639.100] -- 0:00:45
484500 -- (-647.125) (-652.511) [-648.262] (-658.913) * (-652.668) (-657.148) [-637.448] (-661.809) -- 0:00:45
485000 -- [-647.947] (-646.442) (-658.701) (-660.656) * (-655.003) [-652.898] (-647.347) (-638.560) -- 0:00:45
Average standard deviation of split frequencies: 0.009547
485500 -- (-646.216) (-660.057) [-650.992] (-655.840) * (-648.261) (-658.197) [-638.090] (-643.630) -- 0:00:45
486000 -- (-642.816) (-650.281) [-642.170] (-663.290) * [-650.106] (-646.764) (-643.664) (-663.471) -- 0:00:45
486500 -- (-647.730) (-653.604) [-643.190] (-654.871) * (-651.318) [-650.208] (-648.397) (-661.544) -- 0:00:45
487000 -- [-646.865] (-648.598) (-658.740) (-653.945) * (-654.554) (-649.518) (-647.036) [-644.798] -- 0:00:45
487500 -- [-644.449] (-643.464) (-650.551) (-665.074) * [-643.784] (-659.874) (-658.270) (-650.508) -- 0:00:45
488000 -- (-645.842) (-648.971) [-654.462] (-656.924) * [-641.992] (-649.366) (-656.069) (-646.992) -- 0:00:45
488500 -- (-647.776) [-655.953] (-648.112) (-656.522) * (-646.611) (-642.111) (-658.256) [-641.466] -- 0:00:45
489000 -- (-659.490) (-650.062) [-649.793] (-657.659) * (-659.541) (-644.421) [-656.793] (-639.361) -- 0:00:44
489500 -- (-656.449) (-653.739) (-649.215) [-648.660] * (-645.841) [-641.686] (-676.316) (-644.493) -- 0:00:44
490000 -- (-655.198) (-653.648) (-651.474) [-641.854] * (-649.847) (-640.231) [-644.397] (-646.966) -- 0:00:44
Average standard deviation of split frequencies: 0.010012
490500 -- (-654.193) (-656.617) [-648.723] (-646.442) * (-653.967) (-647.327) (-637.100) [-643.727] -- 0:00:44
491000 -- (-652.896) [-644.861] (-660.079) (-657.529) * (-648.913) (-659.114) [-640.444] (-650.438) -- 0:00:44
491500 -- [-641.604] (-653.357) (-648.214) (-654.576) * (-648.329) (-656.766) (-647.343) [-640.947] -- 0:00:44
492000 -- (-659.250) [-645.210] (-647.774) (-656.817) * (-651.494) (-658.806) [-640.789] (-640.000) -- 0:00:44
492500 -- (-662.131) [-642.394] (-650.341) (-646.502) * (-652.827) (-658.122) [-638.733] (-644.631) -- 0:00:44
493000 -- (-652.466) (-655.468) [-654.603] (-656.709) * (-644.699) (-649.515) [-642.402] (-657.447) -- 0:00:45
493500 -- [-640.847] (-650.185) (-652.766) (-653.786) * (-644.609) (-661.542) [-639.123] (-660.074) -- 0:00:45
494000 -- (-645.397) [-645.088] (-648.355) (-654.780) * [-644.383] (-659.740) (-652.142) (-649.403) -- 0:00:45
494500 -- (-651.796) (-657.309) [-650.855] (-651.959) * [-641.454] (-654.919) (-642.557) (-655.614) -- 0:00:44
495000 -- (-647.082) [-647.434] (-657.919) (-649.369) * [-652.657] (-646.538) (-652.679) (-660.586) -- 0:00:44
Average standard deviation of split frequencies: 0.009304
495500 -- [-652.057] (-651.361) (-656.434) (-655.653) * (-647.091) (-647.257) [-643.174] (-658.464) -- 0:00:44
496000 -- (-649.991) [-649.594] (-654.127) (-649.888) * (-651.468) (-664.421) [-642.958] (-659.012) -- 0:00:44
496500 -- [-640.192] (-643.081) (-649.997) (-661.677) * (-658.918) [-654.633] (-654.199) (-650.384) -- 0:00:44
497000 -- [-643.732] (-644.431) (-649.061) (-650.376) * (-646.727) (-663.558) (-639.245) [-647.924] -- 0:00:44
497500 -- [-642.111] (-643.390) (-649.716) (-652.123) * [-646.466] (-663.412) (-653.682) (-654.888) -- 0:00:44
498000 -- (-658.067) (-644.955) [-641.816] (-647.733) * (-659.015) (-650.198) [-645.668] (-657.311) -- 0:00:44
498500 -- (-666.299) (-650.247) (-647.159) [-641.990] * (-654.891) [-649.097] (-642.277) (-649.678) -- 0:00:44
499000 -- [-662.468] (-655.771) (-654.491) (-647.144) * (-651.736) [-648.983] (-647.356) (-648.799) -- 0:00:44
499500 -- (-656.044) [-650.626] (-644.289) (-647.997) * (-643.030) [-649.118] (-642.851) (-649.207) -- 0:00:44
500000 -- (-650.151) [-644.122] (-647.615) (-645.586) * (-648.629) (-654.834) (-644.860) [-650.575] -- 0:00:44
Average standard deviation of split frequencies: 0.009259
500500 -- (-653.685) [-643.608] (-646.587) (-656.263) * [-656.334] (-647.281) (-638.961) (-652.981) -- 0:00:43
501000 -- (-644.976) (-656.745) [-647.303] (-655.486) * (-647.084) (-653.837) [-641.936] (-650.686) -- 0:00:43
501500 -- (-659.250) (-652.966) [-647.588] (-653.445) * (-649.295) (-652.528) [-637.217] (-645.483) -- 0:00:43
502000 -- [-646.045] (-647.828) (-644.425) (-652.425) * (-643.636) (-654.037) [-637.195] (-644.919) -- 0:00:43
502500 -- (-660.762) (-652.044) [-645.685] (-648.621) * (-644.100) (-663.292) (-649.422) [-658.273] -- 0:00:43
503000 -- (-646.615) (-651.483) [-644.285] (-647.994) * [-638.003] (-663.668) (-658.314) (-641.353) -- 0:00:43
503500 -- (-641.560) (-654.020) [-648.576] (-649.726) * (-640.044) [-654.746] (-647.746) (-649.369) -- 0:00:43
504000 -- (-642.126) (-648.570) [-645.225] (-655.750) * [-640.030] (-645.270) (-651.757) (-643.633) -- 0:00:43
504500 -- [-639.712] (-648.884) (-646.846) (-652.339) * (-644.546) (-646.842) [-639.743] (-652.236) -- 0:00:44
505000 -- [-649.018] (-649.161) (-656.615) (-659.121) * (-644.143) (-644.798) [-642.889] (-648.005) -- 0:00:44
Average standard deviation of split frequencies: 0.008540
505500 -- (-652.160) [-643.964] (-652.230) (-663.127) * (-643.185) [-644.376] (-655.044) (-660.488) -- 0:00:44
506000 -- (-654.064) (-649.610) [-648.099] (-655.733) * (-649.110) (-642.523) (-650.491) [-647.844] -- 0:00:43
506500 -- (-654.214) [-648.920] (-655.758) (-664.692) * (-660.836) [-641.050] (-643.020) (-660.212) -- 0:00:43
507000 -- (-660.283) (-645.478) (-649.796) [-643.337] * (-664.193) (-649.694) [-650.137] (-659.476) -- 0:00:43
507500 -- (-652.095) [-642.576] (-655.969) (-655.487) * (-656.361) [-646.453] (-649.178) (-660.091) -- 0:00:43
508000 -- (-656.774) [-650.309] (-651.853) (-645.777) * [-651.555] (-644.767) (-653.814) (-651.028) -- 0:00:43
508500 -- (-661.890) (-651.151) (-647.770) [-645.452] * (-655.985) [-648.406] (-653.834) (-648.496) -- 0:00:43
509000 -- (-646.280) [-653.287] (-651.554) (-654.694) * (-656.586) (-642.346) (-653.021) [-651.076] -- 0:00:43
509500 -- (-646.886) (-650.898) (-651.417) [-660.142] * (-646.804) [-647.036] (-653.955) (-651.098) -- 0:00:43
510000 -- (-655.556) (-651.128) [-650.890] (-651.419) * [-643.449] (-656.298) (-648.082) (-647.348) -- 0:00:43
Average standard deviation of split frequencies: 0.008634
510500 -- [-652.039] (-644.565) (-655.892) (-648.533) * [-646.902] (-660.466) (-647.293) (-642.085) -- 0:00:43
511000 -- (-649.459) [-655.018] (-658.978) (-648.830) * (-647.576) (-652.595) (-649.707) [-650.880] -- 0:00:43
511500 -- (-650.328) (-652.003) (-655.573) [-648.654] * (-645.346) (-657.326) [-641.345] (-649.721) -- 0:00:42
512000 -- (-645.871) [-648.908] (-660.743) (-648.764) * (-646.413) (-650.725) [-649.664] (-651.698) -- 0:00:42
512500 -- [-640.855] (-653.525) (-650.592) (-653.050) * [-642.926] (-648.021) (-646.603) (-648.965) -- 0:00:42
513000 -- (-650.618) [-643.963] (-654.579) (-657.839) * (-645.255) (-653.084) (-653.022) [-650.060] -- 0:00:42
513500 -- (-648.774) [-650.784] (-651.123) (-643.143) * [-648.730] (-644.433) (-649.255) (-666.588) -- 0:00:42
514000 -- (-649.943) [-637.113] (-659.756) (-644.971) * (-657.378) [-641.987] (-643.493) (-659.191) -- 0:00:42
514500 -- [-648.320] (-641.248) (-656.327) (-659.002) * [-661.457] (-649.607) (-648.788) (-656.441) -- 0:00:42
515000 -- (-648.681) (-644.210) (-656.567) [-643.458] * (-654.273) (-659.687) [-645.474] (-647.715) -- 0:00:42
Average standard deviation of split frequencies: 0.009297
515500 -- [-647.455] (-637.541) (-644.866) (-644.540) * (-658.530) [-641.511] (-647.143) (-648.524) -- 0:00:43
516000 -- (-654.766) [-649.627] (-648.313) (-649.137) * (-656.252) (-653.038) [-639.634] (-654.334) -- 0:00:43
516500 -- (-660.839) (-647.090) (-643.402) [-641.657] * (-655.038) [-649.806] (-642.646) (-654.952) -- 0:00:43
517000 -- (-661.839) (-648.823) (-647.438) [-645.985] * (-657.061) (-653.618) (-640.307) [-643.775] -- 0:00:42
517500 -- (-648.057) [-643.202] (-657.989) (-647.763) * (-651.297) [-649.405] (-643.777) (-652.380) -- 0:00:42
518000 -- (-649.337) [-646.153] (-656.975) (-646.611) * (-655.687) (-655.049) (-640.457) [-650.385] -- 0:00:42
518500 -- (-651.511) (-647.395) [-648.713] (-642.398) * (-659.051) [-654.024] (-643.186) (-650.840) -- 0:00:42
519000 -- (-651.057) (-655.851) (-645.153) [-654.452] * (-649.524) [-650.348] (-646.661) (-661.751) -- 0:00:42
519500 -- (-659.563) [-650.996] (-655.670) (-658.353) * (-658.815) [-654.296] (-642.239) (-649.037) -- 0:00:42
520000 -- (-654.790) (-656.352) [-655.486] (-654.803) * (-658.695) (-650.682) (-649.299) [-652.500] -- 0:00:42
Average standard deviation of split frequencies: 0.009107
520500 -- (-655.912) (-644.343) [-648.751] (-651.049) * (-658.027) (-649.892) [-637.241] (-655.657) -- 0:00:42
521000 -- (-652.390) (-650.448) [-644.320] (-653.470) * [-652.360] (-653.152) (-638.957) (-649.921) -- 0:00:42
521500 -- (-650.634) (-657.105) (-656.477) [-641.873] * (-648.449) (-651.986) [-645.159] (-654.385) -- 0:00:42
522000 -- (-649.281) (-654.140) (-652.009) [-643.064] * (-656.228) [-641.498] (-645.723) (-668.909) -- 0:00:42
522500 -- [-650.832] (-651.057) (-661.390) (-655.040) * (-654.427) (-649.369) [-642.872] (-650.349) -- 0:00:42
523000 -- (-648.944) (-648.897) (-659.325) [-649.182] * (-650.119) (-643.935) [-639.244] (-641.828) -- 0:00:41
523500 -- (-654.237) (-644.157) (-658.686) [-645.322] * (-647.445) [-653.955] (-647.827) (-641.874) -- 0:00:41
524000 -- (-658.311) (-649.805) (-659.352) [-645.832] * (-658.630) [-646.036] (-655.812) (-646.161) -- 0:00:41
524500 -- [-654.255] (-654.348) (-649.767) (-644.779) * (-652.684) (-650.523) [-645.099] (-652.801) -- 0:00:41
525000 -- (-656.340) (-647.719) (-659.050) [-646.272] * (-659.051) [-636.221] (-651.168) (-655.750) -- 0:00:41
Average standard deviation of split frequencies: 0.009331
525500 -- (-654.226) (-644.793) (-655.932) [-644.330] * (-647.410) (-646.808) [-647.773] (-648.096) -- 0:00:41
526000 -- (-664.844) [-642.006] (-658.509) (-641.776) * (-654.631) (-645.134) (-656.360) [-645.603] -- 0:00:41
526500 -- (-652.975) (-645.689) [-651.715] (-645.561) * (-654.432) [-643.980] (-653.697) (-641.172) -- 0:00:41
527000 -- (-645.604) (-645.892) [-640.884] (-652.173) * (-649.578) (-644.208) (-652.396) [-641.616] -- 0:00:42
527500 -- (-646.211) [-644.674] (-658.004) (-655.395) * [-653.015] (-641.188) (-656.762) (-653.489) -- 0:00:42
528000 -- (-655.520) (-656.369) [-649.161] (-663.817) * (-654.507) (-651.784) [-647.594] (-642.446) -- 0:00:42
528500 -- (-655.669) (-652.062) [-645.256] (-663.268) * (-651.332) (-648.487) [-646.932] (-645.827) -- 0:00:41
529000 -- (-657.404) [-644.443] (-656.538) (-649.936) * (-648.843) (-654.514) (-653.868) [-643.107] -- 0:00:41
529500 -- [-649.619] (-652.121) (-644.647) (-671.319) * [-643.514] (-646.185) (-645.982) (-654.152) -- 0:00:41
530000 -- (-659.235) (-652.776) (-651.096) [-645.920] * (-651.421) (-652.612) (-650.353) [-653.004] -- 0:00:41
Average standard deviation of split frequencies: 0.009249
530500 -- (-654.728) (-652.887) [-644.171] (-649.440) * (-657.007) (-650.663) [-644.911] (-655.109) -- 0:00:41
531000 -- (-655.076) (-650.364) [-646.208] (-661.162) * (-661.465) (-650.566) [-654.955] (-658.377) -- 0:00:41
531500 -- (-649.293) (-644.139) [-642.905] (-664.913) * [-644.026] (-657.621) (-660.817) (-661.779) -- 0:00:41
532000 -- (-654.542) (-653.626) [-645.714] (-666.593) * (-654.430) [-642.188] (-658.512) (-654.869) -- 0:00:41
532500 -- (-658.554) (-651.207) [-662.920] (-652.884) * (-654.625) [-646.694] (-642.007) (-649.656) -- 0:00:41
533000 -- (-654.866) (-653.685) [-645.310] (-662.292) * (-657.107) (-654.881) [-645.947] (-661.101) -- 0:00:41
533500 -- (-648.964) [-648.531] (-652.699) (-648.478) * [-651.395] (-654.542) (-655.575) (-649.690) -- 0:00:41
534000 -- (-648.068) (-651.706) [-640.707] (-657.129) * (-644.982) [-643.652] (-658.057) (-648.418) -- 0:00:41
534500 -- [-646.662] (-642.754) (-663.943) (-660.815) * [-644.158] (-658.387) (-658.267) (-657.886) -- 0:00:40
535000 -- (-649.230) (-655.175) (-656.832) [-654.829] * (-651.598) (-646.646) (-664.713) [-647.228] -- 0:00:40
Average standard deviation of split frequencies: 0.008795
535500 -- (-652.167) (-649.236) (-654.544) [-645.320] * (-648.502) [-645.269] (-660.679) (-643.324) -- 0:00:40
536000 -- (-650.720) [-649.819] (-642.197) (-652.465) * [-647.945] (-644.086) (-655.570) (-654.294) -- 0:00:40
536500 -- [-645.426] (-652.884) (-662.629) (-658.609) * (-641.782) [-643.671] (-659.965) (-654.135) -- 0:00:40
537000 -- (-643.067) (-655.990) (-653.775) [-642.781] * [-651.647] (-649.976) (-652.361) (-650.031) -- 0:00:40
537500 -- [-640.510] (-653.124) (-639.838) (-642.358) * (-645.017) (-640.757) [-643.740] (-651.417) -- 0:00:40
538000 -- (-647.032) (-657.807) [-646.925] (-647.085) * (-645.526) (-655.317) (-653.646) [-646.118] -- 0:00:41
538500 -- [-641.450] (-645.992) (-641.055) (-655.501) * (-651.056) (-648.549) [-645.952] (-649.298) -- 0:00:41
539000 -- (-647.177) (-650.998) [-636.557] (-637.775) * (-657.531) [-644.006] (-652.730) (-646.011) -- 0:00:41
539500 -- [-644.355] (-643.526) (-641.791) (-641.839) * (-645.362) [-648.129] (-662.520) (-650.194) -- 0:00:40
540000 -- (-652.164) [-642.859] (-645.583) (-654.114) * [-644.669] (-649.890) (-650.700) (-644.736) -- 0:00:40
Average standard deviation of split frequencies: 0.008411
540500 -- (-656.882) [-643.060] (-643.227) (-662.551) * (-638.463) (-652.757) [-643.232] (-643.128) -- 0:00:40
541000 -- (-653.951) (-642.402) [-646.515] (-646.937) * (-669.713) (-654.090) (-655.215) [-644.846] -- 0:00:40
541500 -- (-660.454) [-639.279] (-645.968) (-654.549) * [-643.419] (-656.398) (-653.921) (-642.011) -- 0:00:40
542000 -- (-660.437) (-648.203) (-647.132) [-643.550] * (-651.387) (-647.621) (-653.094) [-642.534] -- 0:00:40
542500 -- [-649.052] (-649.822) (-643.932) (-650.285) * (-648.232) (-651.225) (-652.986) [-647.479] -- 0:00:40
543000 -- (-647.275) (-647.239) [-646.548] (-642.580) * (-661.649) (-648.618) [-638.175] (-652.319) -- 0:00:40
543500 -- (-661.673) (-648.270) [-639.306] (-655.319) * (-646.368) (-648.817) [-636.841] (-639.252) -- 0:00:40
544000 -- (-657.036) (-641.386) [-642.529] (-664.020) * (-645.883) (-657.326) [-642.744] (-652.143) -- 0:00:40
544500 -- (-645.994) [-641.763] (-645.162) (-653.358) * (-647.286) (-664.851) [-645.917] (-652.773) -- 0:00:40
545000 -- (-650.650) [-638.909] (-650.392) (-646.436) * [-649.274] (-652.255) (-649.290) (-653.446) -- 0:00:40
Average standard deviation of split frequencies: 0.008278
545500 -- (-649.632) (-643.479) (-646.847) [-646.677] * (-651.243) (-655.962) [-645.404] (-645.825) -- 0:00:39
546000 -- (-650.397) (-647.472) [-640.634] (-648.121) * (-650.418) (-642.746) [-652.816] (-655.856) -- 0:00:39
546500 -- (-647.591) [-642.086] (-642.807) (-652.270) * (-651.886) (-657.450) (-645.876) [-642.818] -- 0:00:39
547000 -- (-652.258) [-641.780] (-644.948) (-657.212) * (-643.300) (-660.279) [-643.404] (-644.135) -- 0:00:39
547500 -- (-658.969) [-637.093] (-650.436) (-652.010) * (-654.784) (-654.522) (-649.974) [-646.176] -- 0:00:39
548000 -- (-640.628) (-642.175) [-648.623] (-656.019) * (-648.418) (-644.264) [-643.771] (-642.159) -- 0:00:39
548500 -- (-647.875) [-640.253] (-658.237) (-658.302) * [-653.212] (-653.857) (-650.308) (-639.661) -- 0:00:39
549000 -- (-652.051) (-639.372) (-650.052) [-645.407] * (-656.751) (-653.586) (-652.020) [-642.543] -- 0:00:39
549500 -- (-649.731) (-659.155) [-657.365] (-656.122) * (-645.655) (-656.844) (-645.027) [-651.590] -- 0:00:40
550000 -- [-645.235] (-645.975) (-655.062) (-656.816) * [-644.477] (-657.103) (-657.745) (-651.050) -- 0:00:40
Average standard deviation of split frequencies: 0.007956
550500 -- [-643.797] (-641.583) (-663.796) (-639.963) * (-651.141) (-659.808) [-639.684] (-644.761) -- 0:00:40
551000 -- [-643.699] (-646.281) (-658.173) (-653.134) * (-652.711) (-640.998) (-638.557) [-637.806] -- 0:00:39
551500 -- (-639.731) (-648.524) [-645.968] (-657.677) * (-655.197) (-642.023) [-642.516] (-651.940) -- 0:00:39
552000 -- (-651.206) (-642.260) [-649.000] (-653.544) * [-656.299] (-648.935) (-639.319) (-644.424) -- 0:00:39
552500 -- (-640.710) (-653.825) [-646.892] (-651.761) * (-654.745) (-653.743) (-647.848) [-648.815] -- 0:00:39
553000 -- (-648.830) [-650.626] (-651.824) (-653.553) * (-652.865) (-649.621) (-648.373) [-639.838] -- 0:00:39
553500 -- (-638.629) (-657.166) [-641.928] (-646.040) * (-651.287) [-641.773] (-658.278) (-643.344) -- 0:00:39
554000 -- (-651.754) (-659.214) [-639.499] (-656.999) * (-644.012) [-653.895] (-659.136) (-658.172) -- 0:00:39
554500 -- (-649.914) (-662.717) [-640.653] (-644.648) * (-651.132) [-644.968] (-659.143) (-654.595) -- 0:00:39
555000 -- (-657.325) (-652.011) [-639.483] (-644.468) * (-664.008) [-643.025] (-659.783) (-647.993) -- 0:00:39
Average standard deviation of split frequencies: 0.007431
555500 -- (-662.015) [-645.388] (-637.536) (-660.095) * (-650.471) [-639.232] (-653.991) (-649.100) -- 0:00:39
556000 -- (-654.349) (-653.811) [-638.739] (-659.473) * (-649.102) (-653.355) (-645.365) [-645.028] -- 0:00:39
556500 -- (-649.705) (-662.094) (-637.668) [-643.271] * (-650.301) (-655.333) (-653.358) [-637.534] -- 0:00:39
557000 -- [-642.884] (-648.272) (-646.554) (-653.053) * (-645.508) (-648.826) (-649.267) [-645.394] -- 0:00:38
557500 -- (-644.151) [-646.799] (-640.565) (-652.514) * [-646.520] (-643.498) (-657.423) (-640.873) -- 0:00:38
558000 -- [-643.176] (-656.877) (-643.633) (-658.251) * [-642.720] (-642.445) (-649.240) (-671.763) -- 0:00:38
558500 -- [-645.471] (-657.547) (-637.656) (-660.152) * (-653.842) [-641.597] (-642.473) (-655.125) -- 0:00:38
559000 -- (-643.223) (-658.600) [-641.131] (-655.650) * (-655.453) [-646.475] (-659.758) (-644.084) -- 0:00:38
559500 -- (-640.607) (-667.113) [-642.874] (-655.755) * (-651.426) (-640.870) (-665.055) [-641.224] -- 0:00:38
560000 -- (-643.273) (-656.227) [-647.925] (-654.443) * (-661.252) [-642.258] (-649.442) (-639.516) -- 0:00:38
Average standard deviation of split frequencies: 0.007122
560500 -- (-638.265) (-654.693) [-645.065] (-647.284) * (-652.882) [-639.283] (-639.328) (-642.274) -- 0:00:38
561000 -- [-637.619] (-656.069) (-638.214) (-655.892) * (-657.292) (-647.804) [-639.286] (-650.244) -- 0:00:39
561500 -- (-640.380) (-651.989) [-638.982] (-647.499) * (-668.782) (-649.510) [-640.330] (-645.104) -- 0:00:39
562000 -- (-651.218) (-661.653) [-637.664] (-652.907) * (-650.095) (-665.047) [-643.668] (-651.203) -- 0:00:38
562500 -- (-640.808) (-644.951) [-641.161] (-651.264) * (-655.968) (-656.833) [-641.072] (-657.635) -- 0:00:38
563000 -- (-638.386) (-647.668) [-640.658] (-669.142) * (-651.748) (-655.814) [-643.347] (-648.080) -- 0:00:38
563500 -- [-642.600] (-662.891) (-647.174) (-651.171) * [-650.196] (-657.462) (-647.091) (-647.416) -- 0:00:38
564000 -- [-646.128] (-652.023) (-644.294) (-662.864) * (-649.883) (-648.685) (-654.126) [-648.433] -- 0:00:38
564500 -- (-649.336) [-653.707] (-653.784) (-657.189) * (-654.965) (-653.910) (-656.645) [-654.361] -- 0:00:38
565000 -- (-641.553) (-657.910) (-643.150) [-651.084] * (-660.085) (-653.998) [-648.524] (-646.686) -- 0:00:38
Average standard deviation of split frequencies: 0.006712
565500 -- [-638.113] (-657.912) (-637.966) (-653.675) * [-650.073] (-642.723) (-654.776) (-659.656) -- 0:00:38
566000 -- (-641.793) [-644.766] (-647.829) (-650.060) * (-650.731) [-648.646] (-646.369) (-656.060) -- 0:00:38
566500 -- (-652.505) (-652.235) [-638.083] (-650.519) * (-659.265) [-642.209] (-647.529) (-661.138) -- 0:00:38
567000 -- (-651.693) [-652.116] (-649.101) (-655.311) * (-643.823) (-645.071) [-638.436] (-655.703) -- 0:00:38
567500 -- (-648.870) (-655.708) (-646.479) [-649.159] * (-645.970) [-641.938] (-642.206) (-658.570) -- 0:00:38
568000 -- [-650.343] (-661.739) (-650.268) (-641.828) * (-645.133) [-643.783] (-648.788) (-656.653) -- 0:00:38
568500 -- [-645.326] (-655.196) (-652.995) (-648.351) * (-646.620) [-639.923] (-645.493) (-661.620) -- 0:00:37
569000 -- (-657.733) (-651.104) (-654.690) [-649.823] * (-654.513) (-647.110) [-645.509] (-655.017) -- 0:00:37
569500 -- (-651.530) [-653.164] (-647.489) (-665.378) * (-662.514) (-655.898) [-638.973] (-644.711) -- 0:00:37
570000 -- (-658.085) (-643.590) [-646.358] (-664.239) * (-661.760) (-642.239) [-648.718] (-648.893) -- 0:00:37
Average standard deviation of split frequencies: 0.006706
570500 -- (-638.245) [-647.988] (-651.876) (-654.999) * (-660.481) (-649.751) [-642.406] (-654.128) -- 0:00:37
571000 -- (-652.013) [-655.736] (-645.182) (-658.139) * (-654.867) (-658.251) [-636.140] (-652.536) -- 0:00:37
571500 -- (-646.934) [-642.851] (-654.277) (-657.207) * (-647.860) (-653.324) (-639.009) [-647.124] -- 0:00:37
572000 -- (-650.917) (-649.302) (-656.890) [-639.981] * [-648.758] (-655.164) (-645.439) (-650.119) -- 0:00:38
572500 -- (-647.501) (-653.348) (-650.884) [-649.119] * (-650.326) (-650.085) [-642.751] (-642.180) -- 0:00:38
573000 -- (-644.845) (-658.523) (-660.108) [-646.661] * (-661.270) [-641.056] (-639.288) (-641.481) -- 0:00:38
573500 -- [-643.260] (-653.725) (-651.425) (-643.253) * (-658.271) [-649.965] (-642.629) (-659.751) -- 0:00:37
574000 -- (-661.021) (-652.628) [-648.529] (-641.181) * (-652.650) (-651.357) [-638.852] (-643.777) -- 0:00:37
574500 -- (-659.341) (-649.201) [-644.149] (-656.779) * (-652.308) [-644.118] (-641.293) (-649.952) -- 0:00:37
575000 -- (-643.435) [-649.640] (-642.328) (-652.794) * [-646.261] (-646.159) (-644.313) (-664.566) -- 0:00:37
Average standard deviation of split frequencies: 0.005831
575500 -- [-651.190] (-649.328) (-652.521) (-648.922) * (-659.353) (-641.585) [-636.118] (-656.559) -- 0:00:37
576000 -- (-651.064) (-657.033) [-637.190] (-657.989) * (-656.587) (-646.472) [-639.707] (-659.462) -- 0:00:37
576500 -- (-645.207) (-660.287) [-642.449] (-643.178) * (-665.311) (-652.980) (-643.708) [-644.096] -- 0:00:37
577000 -- (-652.118) (-663.027) [-636.188] (-655.146) * (-642.752) (-668.789) [-641.344] (-639.663) -- 0:00:37
577500 -- (-650.460) [-647.611] (-649.725) (-655.990) * (-645.459) (-650.326) [-639.308] (-643.165) -- 0:00:37
578000 -- (-649.892) (-658.144) [-647.843] (-649.475) * (-654.434) (-643.310) (-640.588) [-639.405] -- 0:00:37
578500 -- (-646.602) (-664.741) [-654.128] (-648.245) * (-645.665) (-656.609) [-645.846] (-640.618) -- 0:00:37
579000 -- [-639.920] (-654.730) (-644.145) (-647.828) * (-642.591) (-646.134) [-637.836] (-651.668) -- 0:00:37
579500 -- (-662.410) (-654.043) (-658.176) [-646.665] * (-662.018) (-652.444) (-656.302) [-644.441] -- 0:00:37
580000 -- [-645.299] (-653.878) (-655.518) (-645.093) * (-651.902) (-650.505) (-645.744) [-638.554] -- 0:00:36
Average standard deviation of split frequencies: 0.006241
580500 -- (-657.333) (-654.352) (-645.772) [-640.653] * (-647.308) [-639.435] (-655.280) (-640.155) -- 0:00:36
581000 -- (-657.727) (-647.913) [-645.406] (-643.949) * (-647.516) (-648.765) [-640.225] (-641.264) -- 0:00:36
581500 -- (-642.739) [-645.889] (-645.346) (-641.165) * (-662.224) (-654.813) (-644.320) [-648.328] -- 0:00:36
582000 -- (-652.324) (-654.682) (-653.215) [-645.222] * (-651.491) (-644.358) (-654.830) [-647.078] -- 0:00:36
582500 -- (-656.166) (-649.089) [-644.068] (-642.254) * (-650.293) [-642.124] (-651.392) (-650.333) -- 0:00:36
583000 -- (-660.291) (-640.043) (-654.587) [-639.251] * (-650.098) (-648.852) [-645.159] (-665.029) -- 0:00:36
583500 -- (-646.702) (-645.492) (-646.075) [-640.273] * (-652.371) (-650.460) [-646.338] (-659.844) -- 0:00:37
584000 -- (-653.544) (-653.934) (-641.917) [-656.986] * [-653.806] (-655.179) (-652.582) (-664.427) -- 0:00:37
584500 -- (-650.571) (-650.683) [-639.789] (-659.332) * (-654.029) (-664.582) [-640.887] (-652.410) -- 0:00:36
585000 -- [-643.623] (-646.493) (-645.299) (-657.774) * (-647.125) (-653.992) [-641.181] (-653.544) -- 0:00:36
Average standard deviation of split frequencies: 0.006938
585500 -- (-654.925) [-644.479] (-646.103) (-653.724) * (-651.881) (-643.824) (-648.827) [-651.013] -- 0:00:36
586000 -- (-644.415) (-649.318) [-636.737] (-657.389) * (-653.537) (-659.297) [-645.712] (-645.014) -- 0:00:36
586500 -- (-644.229) (-654.135) (-644.693) [-657.436] * (-659.414) (-656.078) [-642.300] (-646.257) -- 0:00:36
587000 -- (-649.393) [-641.179] (-647.052) (-647.286) * (-647.702) (-655.752) [-651.594] (-655.667) -- 0:00:36
587500 -- [-646.601] (-642.760) (-647.224) (-658.443) * (-662.314) [-649.983] (-652.464) (-648.037) -- 0:00:36
588000 -- (-661.129) [-640.906] (-647.577) (-652.600) * (-655.841) [-649.711] (-640.574) (-649.458) -- 0:00:36
588500 -- (-662.912) (-647.290) (-648.699) [-637.949] * [-642.197] (-643.732) (-640.940) (-654.570) -- 0:00:36
589000 -- (-666.884) [-644.301] (-649.715) (-634.603) * (-645.968) (-652.176) (-645.471) [-646.767] -- 0:00:36
589500 -- (-646.755) (-642.504) (-655.691) [-639.517] * (-651.833) (-655.725) [-643.961] (-638.020) -- 0:00:36
590000 -- (-650.807) (-642.424) (-662.106) [-638.214] * (-658.828) (-646.467) [-649.058] (-650.562) -- 0:00:36
Average standard deviation of split frequencies: 0.006834
590500 -- (-649.357) (-649.252) (-646.617) [-636.997] * (-649.540) [-649.267] (-643.374) (-652.219) -- 0:00:36
591000 -- (-649.824) (-665.948) (-649.512) [-639.168] * (-661.226) (-648.380) [-642.842] (-651.027) -- 0:00:35
591500 -- (-658.265) (-656.584) (-663.853) [-639.312] * (-659.174) (-652.894) [-639.835] (-657.679) -- 0:00:35
592000 -- (-649.804) (-650.977) [-647.097] (-647.099) * (-651.706) (-645.882) (-642.154) [-651.616] -- 0:00:35
592500 -- (-657.999) (-643.586) [-642.265] (-645.351) * [-651.772] (-653.858) (-640.757) (-644.353) -- 0:00:35
593000 -- (-659.445) (-646.138) [-643.728] (-643.695) * (-649.699) (-649.819) (-643.474) [-649.129] -- 0:00:35
593500 -- (-649.142) [-644.664] (-652.655) (-646.519) * [-643.879] (-661.415) (-642.269) (-642.865) -- 0:00:35
594000 -- (-648.335) (-650.348) (-650.871) [-642.005] * (-657.600) (-649.333) [-643.984] (-646.579) -- 0:00:35
594500 -- (-668.656) (-648.079) [-649.341] (-641.028) * (-656.284) [-642.115] (-647.573) (-659.342) -- 0:00:35
595000 -- (-651.089) (-642.367) (-642.165) [-640.678] * (-648.032) (-664.466) (-643.029) [-651.137] -- 0:00:36
Average standard deviation of split frequencies: 0.007415
595500 -- (-644.158) (-656.459) [-639.908] (-639.946) * (-644.901) (-654.494) [-645.987] (-658.746) -- 0:00:36
596000 -- (-654.800) (-640.696) (-641.748) [-638.179] * (-654.713) (-652.044) [-645.966] (-651.338) -- 0:00:35
596500 -- (-650.172) (-653.311) [-644.780] (-639.118) * (-648.774) (-647.194) (-649.574) [-649.569] -- 0:00:35
597000 -- (-649.591) (-661.161) [-655.473] (-641.702) * [-651.657] (-655.485) (-645.391) (-646.141) -- 0:00:35
597500 -- (-648.039) (-648.848) (-651.139) [-639.232] * (-656.581) (-648.668) (-647.642) [-643.151] -- 0:00:35
598000 -- [-650.712] (-663.179) (-653.056) (-642.339) * (-645.868) (-653.402) (-640.247) [-642.174] -- 0:00:35
598500 -- (-655.314) (-661.209) [-650.934] (-645.043) * (-649.123) (-663.880) (-649.604) [-643.467] -- 0:00:35
599000 -- [-660.623] (-659.291) (-645.625) (-643.539) * [-644.640] (-655.613) (-651.538) (-654.637) -- 0:00:35
599500 -- (-657.194) (-654.810) (-644.986) [-652.610] * (-658.429) (-652.183) (-656.485) [-648.883] -- 0:00:35
600000 -- (-659.617) (-643.917) [-639.758] (-638.733) * (-660.171) [-644.209] (-660.689) (-646.070) -- 0:00:35
Average standard deviation of split frequencies: 0.007652
600500 -- (-648.389) (-650.976) (-641.661) [-656.070] * (-654.653) [-643.689] (-650.320) (-647.135) -- 0:00:35
601000 -- (-651.359) (-647.996) [-640.155] (-653.185) * (-660.771) [-646.355] (-655.904) (-648.039) -- 0:00:35
601500 -- [-643.879] (-645.877) (-664.975) (-659.894) * (-656.963) [-642.223] (-654.230) (-641.333) -- 0:00:35
602000 -- (-652.034) (-656.942) [-640.350] (-649.236) * (-651.746) [-642.264] (-649.922) (-642.036) -- 0:00:35
602500 -- [-643.949] (-660.140) (-653.348) (-655.377) * (-651.174) (-654.869) (-657.338) [-646.595] -- 0:00:34
603000 -- (-652.504) (-658.515) (-647.681) [-638.524] * (-659.253) (-653.770) [-644.541] (-648.461) -- 0:00:34
603500 -- (-653.059) (-658.483) [-650.661] (-651.816) * (-665.076) [-650.711] (-646.283) (-645.946) -- 0:00:34
604000 -- [-650.682] (-660.388) (-655.842) (-657.521) * (-656.378) [-651.484] (-650.451) (-643.178) -- 0:00:34
604500 -- (-652.646) [-647.330] (-655.354) (-660.560) * (-660.816) (-651.018) (-643.945) [-643.973] -- 0:00:34
605000 -- (-648.649) [-650.570] (-652.584) (-660.485) * (-648.926) (-647.701) (-648.187) [-646.511] -- 0:00:34
Average standard deviation of split frequencies: 0.008654
605500 -- (-651.366) (-648.908) [-644.466] (-653.139) * (-650.640) (-651.046) [-646.252] (-650.783) -- 0:00:34
606000 -- (-646.857) [-645.894] (-642.463) (-653.079) * (-658.313) [-642.370] (-649.442) (-650.920) -- 0:00:34
606500 -- (-653.227) [-649.499] (-644.419) (-643.410) * (-652.543) [-642.009] (-646.588) (-658.482) -- 0:00:35
607000 -- (-660.104) (-651.614) (-642.142) [-648.457] * (-651.678) [-646.804] (-653.559) (-656.359) -- 0:00:34
607500 -- (-655.739) (-651.432) [-643.065] (-652.864) * [-652.754] (-651.081) (-661.966) (-656.698) -- 0:00:34
608000 -- [-646.063] (-654.868) (-647.327) (-641.990) * (-646.312) [-640.002] (-659.456) (-655.915) -- 0:00:34
608500 -- (-659.510) [-652.560] (-642.489) (-647.574) * (-648.931) (-651.098) [-651.479] (-639.085) -- 0:00:34
609000 -- (-658.595) (-652.250) [-637.679] (-646.146) * (-644.879) [-646.922] (-655.592) (-653.434) -- 0:00:34
609500 -- (-655.060) (-653.026) (-641.745) [-646.151] * (-649.538) [-640.955] (-659.563) (-645.157) -- 0:00:34
610000 -- [-642.575] (-661.239) (-649.698) (-653.522) * (-642.202) [-646.686] (-659.744) (-654.898) -- 0:00:34
Average standard deviation of split frequencies: 0.009360
610500 -- [-658.000] (-654.144) (-650.790) (-668.552) * (-641.807) [-645.254] (-652.109) (-642.740) -- 0:00:34
611000 -- (-653.888) (-645.694) [-648.119] (-654.070) * (-654.121) (-646.478) [-657.608] (-650.740) -- 0:00:34
611500 -- [-653.231] (-642.907) (-647.419) (-646.724) * (-652.584) [-647.621] (-652.044) (-656.483) -- 0:00:34
612000 -- (-638.419) (-647.971) [-652.809] (-657.671) * (-658.189) (-647.275) [-643.499] (-651.476) -- 0:00:34
612500 -- (-649.955) [-647.738] (-649.968) (-651.701) * (-648.391) [-638.884] (-649.297) (-654.492) -- 0:00:34
613000 -- [-639.239] (-645.439) (-650.792) (-653.083) * (-644.570) (-656.386) [-651.520] (-656.032) -- 0:00:34
613500 -- (-653.418) (-650.853) [-653.042] (-644.879) * (-659.907) (-654.119) [-645.716] (-650.803) -- 0:00:34
614000 -- (-654.798) [-640.220] (-658.194) (-643.754) * (-640.925) [-641.850] (-644.799) (-654.649) -- 0:00:33
614500 -- [-638.545] (-648.125) (-660.020) (-657.431) * [-642.626] (-651.998) (-655.419) (-651.122) -- 0:00:33
615000 -- (-646.328) [-645.684] (-647.445) (-650.364) * [-640.571] (-645.839) (-649.805) (-643.550) -- 0:00:33
Average standard deviation of split frequencies: 0.009040
615500 -- (-657.658) [-644.567] (-654.880) (-642.596) * [-648.486] (-653.786) (-647.270) (-645.906) -- 0:00:33
616000 -- (-658.710) (-655.121) [-640.988] (-656.207) * (-660.821) (-647.367) (-655.454) [-641.603] -- 0:00:33
616500 -- (-655.141) (-649.025) (-654.456) [-640.937] * (-648.396) [-649.893] (-650.160) (-662.058) -- 0:00:33
617000 -- [-650.274] (-646.512) (-646.705) (-640.668) * (-655.876) (-649.912) (-653.361) [-640.159] -- 0:00:33
617500 -- [-647.342] (-640.290) (-648.514) (-644.508) * (-651.769) (-652.681) [-648.578] (-642.863) -- 0:00:33
618000 -- (-648.743) (-643.671) (-651.627) [-639.549] * (-653.100) (-651.938) (-651.199) [-659.203] -- 0:00:33
618500 -- (-646.061) [-637.960] (-648.393) (-650.136) * (-647.186) (-655.782) (-658.567) [-651.062] -- 0:00:33
619000 -- (-641.383) (-649.094) (-657.355) [-642.779] * (-646.820) (-651.879) (-654.781) [-650.745] -- 0:00:33
619500 -- (-651.328) [-650.371] (-645.577) (-656.766) * (-656.839) (-661.078) [-650.154] (-642.064) -- 0:00:33
620000 -- [-640.552] (-647.605) (-655.438) (-662.247) * (-649.184) [-647.340] (-650.212) (-653.934) -- 0:00:33
Average standard deviation of split frequencies: 0.009019
620500 -- (-659.101) (-664.245) (-641.162) [-646.116] * (-653.929) (-649.510) (-647.454) [-642.200] -- 0:00:33
621000 -- (-641.780) [-643.606] (-644.793) (-645.772) * (-648.031) [-647.870] (-664.399) (-637.030) -- 0:00:33
621500 -- (-646.262) (-650.038) (-646.451) [-643.327] * (-649.279) [-646.986] (-649.367) (-664.863) -- 0:00:33
622000 -- [-645.689] (-651.277) (-658.118) (-644.406) * (-657.418) (-653.586) (-649.497) [-655.234] -- 0:00:33
622500 -- (-656.420) (-655.200) (-646.948) [-646.197] * (-654.395) (-637.934) (-652.863) [-648.822] -- 0:00:33
623000 -- (-660.920) (-643.962) (-646.975) [-642.214] * (-656.455) (-647.793) (-641.769) [-642.996] -- 0:00:33
623500 -- (-642.482) [-646.567] (-661.033) (-644.461) * (-643.353) (-645.863) (-644.146) [-641.198] -- 0:00:33
624000 -- (-659.856) (-645.697) (-645.061) [-640.076] * (-642.996) (-648.160) (-649.771) [-648.137] -- 0:00:33
624500 -- (-651.243) (-644.794) (-646.874) [-638.132] * [-646.157] (-657.799) (-648.696) (-646.621) -- 0:00:33
625000 -- (-660.958) (-648.747) (-645.648) [-642.751] * (-648.779) (-649.971) [-641.492] (-644.855) -- 0:00:33
Average standard deviation of split frequencies: 0.008754
625500 -- (-653.571) [-636.687] (-647.090) (-652.135) * (-639.804) (-653.836) [-648.132] (-643.195) -- 0:00:32
626000 -- [-651.411] (-649.743) (-646.476) (-647.803) * [-638.232] (-656.345) (-641.768) (-647.272) -- 0:00:32
626500 -- (-644.785) [-647.501] (-673.187) (-639.915) * [-640.603] (-665.996) (-656.740) (-644.006) -- 0:00:32
627000 -- (-648.437) (-657.337) (-648.382) [-646.575] * [-649.406] (-643.379) (-644.351) (-644.653) -- 0:00:32
627500 -- (-653.286) (-653.125) (-647.003) [-645.331] * [-647.960] (-656.404) (-652.149) (-652.382) -- 0:00:32
628000 -- (-647.263) [-643.822] (-640.621) (-641.452) * (-647.809) (-659.445) (-650.025) [-640.881] -- 0:00:32
628500 -- [-642.341] (-654.978) (-654.775) (-643.640) * (-647.948) (-664.454) (-656.609) [-645.591] -- 0:00:32
629000 -- (-642.951) (-644.860) [-650.590] (-647.278) * (-652.059) (-657.503) (-661.260) [-641.905] -- 0:00:32
629500 -- [-643.927] (-652.022) (-645.237) (-642.336) * (-653.653) [-648.446] (-651.786) (-653.689) -- 0:00:32
630000 -- (-643.328) (-651.603) (-649.018) [-646.735] * (-644.926) (-649.646) [-634.564] (-642.348) -- 0:00:32
Average standard deviation of split frequencies: 0.009189
630500 -- (-644.341) [-647.158] (-646.317) (-650.243) * (-650.667) (-656.573) (-645.106) [-642.739] -- 0:00:32
631000 -- (-661.396) [-644.030] (-656.583) (-646.934) * (-653.622) (-654.807) (-650.417) [-639.703] -- 0:00:32
631500 -- (-655.302) (-656.996) (-657.746) [-657.837] * (-655.972) (-661.137) (-652.379) [-644.369] -- 0:00:32
632000 -- (-656.701) (-652.205) [-642.100] (-650.206) * (-649.750) [-656.335] (-657.378) (-654.351) -- 0:00:32
632500 -- (-649.770) (-649.203) [-646.754] (-649.975) * (-656.229) (-652.095) (-645.256) [-650.360] -- 0:00:32
633000 -- (-654.684) (-647.463) [-653.013] (-643.162) * (-662.077) (-655.421) (-641.361) [-647.650] -- 0:00:32
633500 -- [-649.749] (-643.760) (-645.624) (-650.152) * (-652.860) (-662.331) [-636.719] (-644.317) -- 0:00:32
634000 -- [-658.096] (-646.059) (-650.993) (-651.480) * (-657.471) (-655.352) [-639.346] (-649.881) -- 0:00:32
634500 -- (-643.546) (-652.230) [-639.850] (-653.367) * (-653.163) (-653.073) [-640.864] (-655.677) -- 0:00:32
635000 -- (-644.302) [-660.020] (-639.570) (-655.310) * (-656.430) (-642.547) [-639.801] (-653.819) -- 0:00:32
Average standard deviation of split frequencies: 0.007829
635500 -- (-642.540) (-650.652) (-657.222) [-646.632] * (-647.888) (-649.818) [-638.264] (-654.108) -- 0:00:32
636000 -- [-638.302] (-663.555) (-646.930) (-660.766) * (-651.689) (-660.844) (-644.214) [-643.003] -- 0:00:32
636500 -- (-647.549) [-642.018] (-647.310) (-652.233) * [-645.979] (-661.616) (-637.534) (-656.495) -- 0:00:31
637000 -- (-647.177) (-652.740) [-649.367] (-661.040) * (-659.266) (-660.050) [-637.799] (-643.888) -- 0:00:31
637500 -- (-656.439) [-646.091] (-644.393) (-650.642) * (-646.689) (-646.414) [-644.076] (-646.870) -- 0:00:31
638000 -- [-658.810] (-653.793) (-642.055) (-653.144) * (-643.103) (-658.017) [-645.184] (-650.961) -- 0:00:31
638500 -- (-654.795) (-645.733) (-649.306) [-641.528] * (-651.901) (-662.855) [-637.201] (-645.518) -- 0:00:31
639000 -- (-648.320) (-656.091) (-653.657) [-644.697] * [-640.441] (-657.859) (-642.203) (-655.136) -- 0:00:31
639500 -- (-650.063) (-643.859) [-649.265] (-638.139) * (-645.083) (-669.684) [-641.205] (-658.203) -- 0:00:31
640000 -- (-661.784) (-646.330) (-660.968) [-639.872] * (-640.790) (-652.781) [-639.394] (-652.488) -- 0:00:31
Average standard deviation of split frequencies: 0.008570
640500 -- (-661.992) (-644.551) (-652.283) [-641.736] * [-641.180] (-659.624) (-648.843) (-658.205) -- 0:00:31
641000 -- (-647.328) (-657.898) [-643.036] (-652.124) * [-642.188] (-647.293) (-658.132) (-654.590) -- 0:00:31
641500 -- (-652.152) (-650.115) (-649.934) [-644.462] * [-636.253] (-654.384) (-645.071) (-653.785) -- 0:00:31
642000 -- (-664.093) [-647.707] (-654.245) (-643.072) * (-642.340) (-651.295) [-642.611] (-657.080) -- 0:00:31
642500 -- (-651.803) (-648.806) [-642.562] (-644.812) * [-643.048] (-643.956) (-649.861) (-657.121) -- 0:00:31
643000 -- (-657.309) (-654.006) [-636.750] (-642.592) * [-637.589] (-648.717) (-646.072) (-660.667) -- 0:00:31
643500 -- (-651.878) (-653.330) (-658.765) [-645.845] * (-638.568) (-651.223) (-654.010) [-640.495] -- 0:00:31
644000 -- (-657.528) (-644.743) (-645.490) [-640.596] * (-647.925) (-658.898) [-645.891] (-649.158) -- 0:00:31
644500 -- (-647.854) (-647.367) [-639.085] (-646.959) * (-659.688) (-644.743) (-661.268) [-650.190] -- 0:00:31
645000 -- (-647.400) (-644.085) [-641.956] (-657.900) * (-652.095) (-651.796) (-661.189) [-652.539] -- 0:00:31
Average standard deviation of split frequencies: 0.008413
645500 -- (-653.616) (-644.152) (-658.044) [-638.886] * (-648.647) (-650.025) (-651.236) [-641.728] -- 0:00:31
646000 -- (-664.142) (-644.860) [-639.382] (-653.698) * [-644.270] (-653.068) (-652.750) (-662.594) -- 0:00:31
646500 -- (-645.189) (-652.313) (-645.034) [-651.798] * (-643.924) [-649.771] (-642.360) (-655.707) -- 0:00:31
647000 -- (-647.870) (-648.231) [-644.947] (-641.955) * (-653.069) (-648.671) [-640.255] (-659.209) -- 0:00:31
647500 -- (-651.770) (-644.598) [-645.022] (-661.685) * (-665.580) [-646.692] (-648.765) (-664.127) -- 0:00:31
648000 -- [-647.509] (-651.167) (-651.965) (-640.103) * (-651.604) [-644.304] (-647.261) (-655.042) -- 0:00:30
648500 -- (-655.503) (-653.133) (-650.170) [-638.770] * (-660.492) (-657.062) (-645.825) [-652.250] -- 0:00:30
649000 -- (-660.603) (-655.913) [-642.542] (-645.867) * (-655.153) (-646.660) [-641.943] (-656.935) -- 0:00:30
649500 -- (-649.301) [-643.622] (-643.924) (-668.982) * (-653.692) [-644.401] (-651.291) (-665.155) -- 0:00:30
650000 -- [-644.864] (-655.948) (-661.536) (-659.393) * (-659.603) [-651.238] (-642.999) (-655.402) -- 0:00:30
Average standard deviation of split frequencies: 0.008950
650500 -- (-659.412) (-654.114) (-646.760) [-640.537] * (-669.295) (-659.723) (-643.513) [-649.752] -- 0:00:30
651000 -- [-654.126] (-643.894) (-654.772) (-641.532) * (-658.272) (-652.446) [-647.671] (-651.899) -- 0:00:30
651500 -- [-651.331] (-650.276) (-655.575) (-643.235) * (-650.820) (-640.083) [-650.640] (-650.921) -- 0:00:30
652000 -- [-641.023] (-648.854) (-649.253) (-647.241) * [-644.554] (-658.559) (-652.995) (-645.856) -- 0:00:30
652500 -- (-654.354) (-651.061) (-659.579) [-642.827] * [-643.572] (-661.806) (-648.748) (-648.123) -- 0:00:30
653000 -- [-641.540] (-649.679) (-660.395) (-647.878) * (-638.861) (-657.041) [-642.800] (-657.257) -- 0:00:30
653500 -- [-640.371] (-658.542) (-641.886) (-653.619) * (-644.173) [-645.819] (-650.336) (-649.430) -- 0:00:30
654000 -- (-637.260) (-652.107) [-637.981] (-646.580) * (-643.357) (-644.433) [-642.057] (-659.017) -- 0:00:30
654500 -- (-658.336) (-656.865) (-648.765) [-638.451] * (-641.537) [-643.848] (-652.741) (-642.463) -- 0:00:30
655000 -- [-641.314] (-645.217) (-652.648) (-646.533) * [-638.163] (-645.135) (-663.993) (-647.806) -- 0:00:30
Average standard deviation of split frequencies: 0.008201
655500 -- [-644.552] (-660.916) (-643.904) (-645.628) * [-635.457] (-647.370) (-654.543) (-663.390) -- 0:00:30
656000 -- [-650.655] (-656.797) (-654.106) (-654.457) * [-643.936] (-653.912) (-659.453) (-653.892) -- 0:00:30
656500 -- (-656.662) (-647.232) (-655.522) [-641.324] * [-647.286] (-644.376) (-661.635) (-667.348) -- 0:00:30
657000 -- (-657.636) (-640.674) [-648.688] (-638.864) * (-639.368) [-646.847] (-647.435) (-649.668) -- 0:00:30
657500 -- (-659.171) (-641.266) (-650.094) [-641.237] * [-639.679] (-648.090) (-657.356) (-644.869) -- 0:00:30
658000 -- (-655.541) (-645.815) (-650.033) [-641.891] * (-643.194) (-649.512) (-654.115) [-649.038] -- 0:00:30
658500 -- (-645.755) (-645.274) (-650.900) [-640.609] * (-645.391) [-644.485] (-656.796) (-642.604) -- 0:00:30
659000 -- (-644.949) (-646.603) [-642.673] (-637.483) * [-635.749] (-655.442) (-646.617) (-640.654) -- 0:00:30
659500 -- (-647.154) (-646.794) (-645.715) [-643.040] * (-648.967) [-646.147] (-652.263) (-653.497) -- 0:00:29
660000 -- [-643.169] (-659.218) (-645.557) (-644.991) * [-645.088] (-654.109) (-652.412) (-659.966) -- 0:00:29
Average standard deviation of split frequencies: 0.008101
660500 -- (-641.784) (-652.724) (-666.003) [-644.592] * [-640.936] (-653.997) (-649.736) (-652.901) -- 0:00:29
661000 -- (-645.632) (-646.804) (-642.596) [-643.734] * (-640.154) (-652.697) [-651.402] (-649.434) -- 0:00:29
661500 -- (-648.869) (-659.137) (-652.912) [-640.247] * (-641.890) (-650.261) [-647.839] (-648.432) -- 0:00:29
662000 -- (-649.913) (-646.777) (-671.694) [-640.144] * [-641.593] (-641.687) (-647.069) (-645.535) -- 0:00:29
662500 -- (-665.581) (-650.857) (-662.865) [-646.802] * [-638.235] (-642.769) (-657.321) (-642.957) -- 0:00:29
663000 -- (-645.354) (-644.840) (-660.593) [-641.599] * (-641.931) [-643.023] (-659.995) (-649.639) -- 0:00:29
663500 -- [-642.384] (-652.622) (-667.469) (-638.470) * (-639.262) [-638.939] (-657.065) (-647.158) -- 0:00:29
664000 -- [-645.175] (-657.987) (-650.508) (-645.453) * [-642.950] (-654.412) (-642.863) (-646.916) -- 0:00:29
664500 -- [-642.012] (-653.638) (-650.148) (-649.269) * (-637.817) [-638.338] (-641.059) (-649.327) -- 0:00:29
665000 -- [-639.734] (-656.492) (-658.883) (-667.151) * [-638.311] (-646.783) (-663.555) (-654.017) -- 0:00:29
Average standard deviation of split frequencies: 0.007911
665500 -- (-641.186) (-648.576) (-645.873) [-643.027] * [-643.219] (-657.573) (-661.407) (-652.058) -- 0:00:29
666000 -- (-647.409) [-647.507] (-643.568) (-648.640) * [-638.351] (-648.309) (-657.725) (-650.064) -- 0:00:29
666500 -- (-652.936) [-639.507] (-645.312) (-650.500) * [-636.005] (-649.878) (-647.794) (-653.613) -- 0:00:29
667000 -- [-653.949] (-646.050) (-652.820) (-647.333) * [-639.311] (-647.661) (-661.657) (-645.026) -- 0:00:29
667500 -- (-643.319) [-641.200] (-656.814) (-648.655) * [-638.594] (-644.299) (-662.344) (-646.093) -- 0:00:29
668000 -- (-652.740) [-645.089] (-665.111) (-647.048) * (-641.098) [-649.210] (-659.152) (-652.104) -- 0:00:29
668500 -- [-648.859] (-645.769) (-657.682) (-658.771) * (-640.319) [-643.282] (-654.829) (-662.333) -- 0:00:29
669000 -- (-641.912) (-643.925) [-649.860] (-663.626) * [-636.227] (-657.296) (-657.098) (-665.459) -- 0:00:29
669500 -- [-640.702] (-651.334) (-651.538) (-645.055) * [-638.831] (-639.947) (-647.434) (-651.690) -- 0:00:29
670000 -- (-640.029) [-648.645] (-664.028) (-657.709) * [-641.357] (-644.322) (-656.809) (-660.586) -- 0:00:29
Average standard deviation of split frequencies: 0.007690
670500 -- [-642.150] (-644.228) (-654.232) (-648.209) * (-650.390) [-646.414] (-642.780) (-660.384) -- 0:00:28
671000 -- [-643.941] (-651.560) (-653.801) (-657.089) * (-642.156) (-654.348) [-649.971] (-648.963) -- 0:00:28
671500 -- (-658.696) (-649.544) (-647.929) [-642.882] * [-642.826] (-644.819) (-655.832) (-650.573) -- 0:00:28
672000 -- (-658.142) (-639.543) (-650.866) [-647.680] * (-648.811) [-645.281] (-651.448) (-650.154) -- 0:00:28
672500 -- (-653.629) [-639.624] (-656.038) (-650.149) * [-644.940] (-643.854) (-655.642) (-646.504) -- 0:00:28
673000 -- [-646.874] (-653.084) (-653.692) (-660.756) * (-644.404) (-638.354) (-654.929) [-646.675] -- 0:00:28
673500 -- (-666.927) [-643.523] (-640.624) (-651.022) * (-647.501) (-642.144) [-654.731] (-646.294) -- 0:00:28
674000 -- (-657.370) (-654.359) [-647.008] (-654.391) * (-646.018) [-640.189] (-650.681) (-653.589) -- 0:00:28
674500 -- (-661.364) (-653.477) [-641.419] (-654.591) * (-649.096) [-640.519] (-647.645) (-664.075) -- 0:00:28
675000 -- (-659.997) (-665.346) (-651.567) [-651.443] * (-649.059) (-650.036) [-646.600] (-661.693) -- 0:00:28
Average standard deviation of split frequencies: 0.007384
675500 -- (-643.439) (-659.330) [-642.435] (-656.985) * (-647.501) [-641.131] (-649.699) (-660.248) -- 0:00:28
676000 -- (-661.535) [-643.184] (-651.666) (-652.485) * (-647.427) (-644.046) [-647.268] (-657.889) -- 0:00:28
676500 -- (-649.022) (-642.181) [-643.113] (-642.873) * [-645.712] (-661.762) (-656.488) (-651.073) -- 0:00:28
677000 -- [-656.504] (-647.581) (-649.419) (-653.660) * (-658.598) [-651.075] (-664.514) (-644.613) -- 0:00:28
677500 -- (-653.311) (-653.933) (-654.987) [-656.677] * (-653.535) [-658.119] (-655.957) (-644.486) -- 0:00:28
678000 -- (-667.151) (-651.329) [-642.858] (-648.375) * (-646.491) (-654.283) (-656.455) [-645.185] -- 0:00:28
678500 -- (-654.607) (-657.312) (-653.661) [-647.377] * (-654.816) (-647.744) (-653.132) [-648.442] -- 0:00:28
679000 -- (-647.845) [-639.423] (-663.148) (-651.307) * (-643.095) [-649.460] (-644.732) (-645.576) -- 0:00:28
679500 -- (-648.047) (-656.342) (-660.279) [-652.588] * (-651.084) (-659.062) (-642.517) [-649.504] -- 0:00:28
680000 -- (-661.509) [-651.088] (-649.914) (-647.407) * (-655.571) (-657.292) (-646.403) [-652.704] -- 0:00:28
Average standard deviation of split frequencies: 0.007252
680500 -- (-649.615) [-656.648] (-654.126) (-644.824) * (-648.364) (-661.666) [-650.822] (-642.288) -- 0:00:28
681000 -- (-657.866) (-649.310) (-648.302) [-643.849] * (-645.486) (-644.403) (-652.636) [-643.438] -- 0:00:28
681500 -- [-643.313] (-652.896) (-649.251) (-653.671) * (-653.096) (-650.508) (-652.413) [-647.545] -- 0:00:28
682000 -- [-641.689] (-661.598) (-655.970) (-644.909) * (-649.167) (-652.433) (-655.737) [-641.542] -- 0:00:27
682500 -- (-655.774) (-648.546) [-649.481] (-652.806) * (-656.831) (-647.513) (-647.842) [-648.756] -- 0:00:27
683000 -- (-652.958) [-651.301] (-646.680) (-655.455) * (-652.344) [-644.563] (-643.230) (-650.613) -- 0:00:27
683500 -- (-641.399) [-649.167] (-655.072) (-664.466) * (-648.085) (-660.601) [-641.978] (-653.430) -- 0:00:27
684000 -- (-656.737) (-638.333) (-652.595) [-649.487] * (-646.925) (-653.502) (-647.367) [-645.302] -- 0:00:27
684500 -- (-649.653) (-654.502) (-655.035) [-647.196] * (-658.601) (-649.971) [-637.712] (-648.907) -- 0:00:27
685000 -- (-651.217) (-650.158) [-641.313] (-642.162) * (-644.606) (-652.347) [-635.058] (-647.546) -- 0:00:27
Average standard deviation of split frequencies: 0.006485
685500 -- (-649.611) (-649.647) [-644.082] (-653.099) * (-652.266) [-648.952] (-645.462) (-663.195) -- 0:00:27
686000 -- [-645.613] (-650.130) (-653.951) (-644.760) * (-644.280) (-654.245) (-645.913) [-654.059] -- 0:00:27
686500 -- (-646.372) (-652.593) (-656.363) [-647.324] * (-655.482) (-658.336) [-635.907] (-654.525) -- 0:00:27
687000 -- [-647.837] (-659.190) (-660.387) (-664.069) * (-661.555) (-643.693) (-640.769) [-642.751] -- 0:00:27
687500 -- [-652.184] (-658.114) (-653.880) (-658.257) * (-648.364) (-656.131) (-648.658) [-640.098] -- 0:00:27
688000 -- (-653.063) (-656.561) (-662.232) [-643.419] * (-642.520) (-655.812) (-646.482) [-639.330] -- 0:00:27
688500 -- (-652.629) [-641.225] (-655.720) (-651.551) * (-656.280) (-652.938) (-655.040) [-652.207] -- 0:00:27
689000 -- [-640.577] (-658.963) (-656.315) (-644.338) * (-662.529) (-641.648) [-647.473] (-655.754) -- 0:00:27
689500 -- [-637.536] (-658.074) (-648.661) (-640.041) * (-659.077) (-646.383) [-640.059] (-649.609) -- 0:00:27
690000 -- [-640.284] (-639.804) (-659.374) (-651.669) * (-646.667) (-644.885) (-655.845) [-652.339] -- 0:00:27
Average standard deviation of split frequencies: 0.006612
690500 -- (-641.013) [-648.202] (-651.944) (-650.737) * (-647.489) (-640.486) [-641.728] (-649.371) -- 0:00:27
691000 -- (-643.130) (-661.975) (-642.928) [-648.275] * (-654.246) [-636.744] (-652.518) (-648.505) -- 0:00:27
691500 -- (-639.028) (-653.148) [-643.853] (-649.105) * (-650.616) [-645.459] (-655.182) (-655.224) -- 0:00:27
692000 -- (-640.694) (-646.470) (-641.492) [-637.303] * (-650.859) [-641.819] (-648.150) (-647.130) -- 0:00:27
692500 -- (-648.506) (-640.167) (-646.971) [-642.025] * (-643.012) (-644.466) (-660.260) [-641.027] -- 0:00:27
693000 -- [-638.017] (-644.562) (-645.710) (-644.682) * (-655.818) [-647.671] (-660.831) (-644.294) -- 0:00:27
693500 -- (-651.428) [-640.249] (-643.889) (-642.339) * [-651.433] (-645.513) (-654.107) (-655.677) -- 0:00:26
694000 -- (-654.636) [-638.965] (-663.500) (-644.159) * (-650.548) [-644.264] (-656.951) (-648.075) -- 0:00:26
694500 -- (-656.614) (-649.555) (-649.787) [-641.105] * (-652.671) (-649.917) (-650.533) [-655.083] -- 0:00:26
695000 -- (-651.552) (-642.590) [-641.807] (-641.131) * (-653.792) (-644.149) [-645.091] (-643.782) -- 0:00:26
Average standard deviation of split frequencies: 0.006646
695500 -- (-663.537) (-651.550) (-643.105) [-640.702] * (-652.424) (-652.049) (-662.325) [-641.406] -- 0:00:26
696000 -- (-655.436) (-647.068) (-637.912) [-643.076] * (-643.729) (-655.479) [-646.396] (-648.093) -- 0:00:26
696500 -- (-639.201) (-649.990) (-636.256) [-644.228] * [-643.904] (-655.388) (-643.511) (-655.518) -- 0:00:26
697000 -- (-649.685) (-665.563) [-640.728] (-640.130) * (-650.123) [-652.094] (-656.779) (-652.480) -- 0:00:26
697500 -- (-658.409) (-646.498) [-636.756] (-641.675) * (-653.014) (-661.148) (-644.129) [-641.921] -- 0:00:26
698000 -- (-647.454) [-641.830] (-635.718) (-639.665) * (-646.652) (-643.483) [-644.457] (-649.107) -- 0:00:26
698500 -- (-653.460) (-641.301) [-638.650] (-659.525) * [-644.497] (-657.045) (-659.149) (-644.753) -- 0:00:26
699000 -- (-659.321) [-645.967] (-650.664) (-656.570) * (-665.986) [-643.353] (-648.422) (-650.433) -- 0:00:26
699500 -- (-663.454) (-642.532) [-647.579] (-659.951) * (-652.594) (-662.049) [-651.974] (-645.191) -- 0:00:26
700000 -- (-642.931) (-647.299) [-639.662] (-652.853) * (-651.297) (-661.849) (-657.372) [-646.276] -- 0:00:26
Average standard deviation of split frequencies: 0.007317
700500 -- (-648.760) (-642.974) [-640.168] (-657.407) * (-655.158) (-657.780) (-660.928) [-648.993] -- 0:00:26
701000 -- (-647.355) (-648.525) [-651.077] (-656.053) * (-649.729) (-650.723) (-657.378) [-636.564] -- 0:00:26
701500 -- (-652.804) (-644.727) (-658.938) [-643.504] * (-651.405) (-651.265) [-640.867] (-655.046) -- 0:00:26
702000 -- (-648.552) (-651.934) (-655.983) [-654.411] * (-651.854) (-643.039) [-642.529] (-656.052) -- 0:00:26
702500 -- (-644.965) (-658.839) (-655.004) [-648.656] * (-644.581) (-647.885) (-659.295) [-644.549] -- 0:00:26
703000 -- [-643.497] (-662.098) (-652.244) (-648.044) * [-643.087] (-650.384) (-643.258) (-649.882) -- 0:00:26
703500 -- [-647.869] (-660.008) (-644.489) (-655.627) * [-648.400] (-657.139) (-647.681) (-648.930) -- 0:00:26
704000 -- (-655.071) (-658.771) [-650.368] (-648.982) * (-648.569) [-650.955] (-650.284) (-645.182) -- 0:00:26
704500 -- (-655.557) (-644.359) [-645.608] (-642.861) * (-652.363) (-651.054) (-646.012) [-642.815] -- 0:00:26
705000 -- (-652.545) (-656.687) (-649.779) [-643.895] * (-645.594) (-654.899) (-646.970) [-641.094] -- 0:00:25
Average standard deviation of split frequencies: 0.008052
705500 -- (-651.922) [-651.579] (-640.846) (-658.687) * (-649.970) (-652.374) (-649.994) [-645.363] -- 0:00:25
706000 -- [-645.347] (-646.975) (-641.688) (-657.564) * (-650.727) [-648.246] (-663.673) (-641.881) -- 0:00:25
706500 -- [-645.538] (-652.974) (-653.244) (-659.175) * [-641.159] (-654.289) (-657.562) (-646.463) -- 0:00:25
707000 -- [-642.281] (-657.109) (-648.666) (-653.980) * (-645.232) (-644.716) (-656.707) [-648.345] -- 0:00:25
707500 -- (-649.632) [-646.605] (-643.569) (-638.150) * (-640.179) (-662.506) (-648.366) [-649.538] -- 0:00:25
708000 -- (-660.507) [-642.842] (-652.703) (-642.646) * [-644.770] (-656.715) (-657.886) (-646.687) -- 0:00:25
708500 -- [-643.399] (-642.099) (-647.281) (-648.516) * (-650.777) (-648.467) [-640.959] (-653.653) -- 0:00:25
709000 -- (-652.976) (-645.739) (-654.240) [-643.702] * (-656.343) (-641.736) (-646.966) [-646.092] -- 0:00:25
709500 -- (-658.192) (-648.893) (-650.282) [-645.978] * [-645.359] (-650.288) (-648.668) (-654.351) -- 0:00:25
710000 -- (-647.749) (-647.488) (-652.901) [-647.158] * [-637.543] (-647.453) (-648.553) (-641.431) -- 0:00:25
Average standard deviation of split frequencies: 0.007089
710500 -- (-651.804) (-654.590) [-652.381] (-653.484) * [-639.393] (-657.868) (-652.386) (-641.814) -- 0:00:25
711000 -- (-647.125) (-653.516) (-653.113) [-645.444] * (-644.073) [-645.505] (-649.454) (-659.132) -- 0:00:25
711500 -- (-638.397) (-659.583) (-644.922) [-642.957] * [-640.993] (-652.827) (-656.459) (-646.960) -- 0:00:25
712000 -- (-645.317) (-658.044) (-647.487) [-650.718] * (-640.771) (-655.172) [-637.115] (-660.115) -- 0:00:25
712500 -- (-652.315) [-645.854] (-661.218) (-654.762) * (-646.607) (-649.967) [-639.018] (-656.763) -- 0:00:25
713000 -- [-655.803] (-650.403) (-656.406) (-646.567) * (-645.568) (-651.932) [-647.461] (-647.716) -- 0:00:25
713500 -- [-643.020] (-645.441) (-653.829) (-637.404) * (-653.714) [-643.332] (-649.941) (-648.003) -- 0:00:25
714000 -- (-662.207) (-648.600) [-647.145] (-640.547) * (-663.853) (-647.581) [-639.787] (-652.348) -- 0:00:25
714500 -- [-652.934] (-654.143) (-649.990) (-649.193) * [-642.015] (-641.590) (-653.894) (-648.661) -- 0:00:25
715000 -- (-661.479) (-650.094) (-656.174) [-644.088] * (-646.030) (-659.468) [-652.893] (-644.443) -- 0:00:25
Average standard deviation of split frequencies: 0.007436
715500 -- (-660.176) (-645.222) (-646.951) [-640.695] * (-665.695) (-656.675) [-653.016] (-649.596) -- 0:00:25
716000 -- (-652.864) [-643.973] (-651.027) (-648.776) * (-661.763) (-658.163) [-641.656] (-645.818) -- 0:00:24
716500 -- (-651.951) (-654.915) (-653.123) [-639.147] * (-657.352) (-657.501) [-636.207] (-659.102) -- 0:00:24
717000 -- (-651.625) (-654.290) (-656.885) [-646.717] * (-659.167) (-644.887) [-645.238] (-650.543) -- 0:00:24
717500 -- [-652.322] (-649.343) (-649.983) (-651.648) * (-656.347) (-643.852) [-646.538] (-645.728) -- 0:00:24
718000 -- (-654.438) [-647.397] (-645.102) (-654.527) * [-648.272] (-646.884) (-645.732) (-657.357) -- 0:00:24
718500 -- (-651.979) (-660.122) [-640.345] (-642.812) * (-653.852) (-650.641) [-639.821] (-646.829) -- 0:00:24
719000 -- (-656.809) (-661.605) (-648.789) [-645.458] * (-657.347) (-645.965) [-644.999] (-661.216) -- 0:00:24
719500 -- (-640.257) (-642.713) (-660.008) [-641.955] * (-649.306) (-650.371) (-666.900) [-641.456] -- 0:00:24
720000 -- (-650.713) (-645.097) [-645.095] (-649.241) * (-644.995) (-639.045) (-662.589) [-642.788] -- 0:00:24
Average standard deviation of split frequencies: 0.006367
720500 -- (-650.738) (-653.121) (-653.496) [-640.734] * (-649.464) (-637.325) (-658.382) [-648.357] -- 0:00:24
721000 -- (-660.482) (-646.859) [-643.662] (-638.911) * [-647.489] (-659.157) (-645.248) (-645.206) -- 0:00:24
721500 -- (-641.666) (-648.346) (-647.978) [-639.838] * (-665.826) (-644.729) (-655.688) [-655.612] -- 0:00:24
722000 -- (-664.793) (-652.576) (-642.447) [-644.918] * (-651.669) [-649.803] (-655.376) (-645.363) -- 0:00:24
722500 -- [-651.160] (-655.751) (-653.845) (-647.074) * (-646.027) (-650.595) (-652.946) [-640.328] -- 0:00:24
723000 -- (-641.725) (-656.991) (-640.910) [-644.441] * [-644.156] (-646.818) (-646.306) (-648.478) -- 0:00:24
723500 -- (-640.653) (-654.993) (-649.425) [-642.944] * (-645.616) [-645.039] (-657.641) (-653.062) -- 0:00:24
724000 -- (-645.794) (-650.408) (-663.725) [-646.289] * (-648.661) [-642.868] (-652.987) (-659.143) -- 0:00:24
724500 -- [-649.163] (-648.618) (-650.594) (-646.521) * (-640.281) [-646.990] (-651.224) (-661.925) -- 0:00:24
725000 -- (-653.474) [-640.779] (-647.616) (-657.842) * [-639.677] (-644.316) (-660.766) (-656.349) -- 0:00:24
Average standard deviation of split frequencies: 0.006722
725500 -- (-654.745) [-639.700] (-650.460) (-652.759) * (-645.374) [-642.380] (-658.319) (-648.871) -- 0:00:24
726000 -- (-651.087) [-639.603] (-652.147) (-654.268) * [-649.924] (-647.044) (-658.923) (-652.398) -- 0:00:24
726500 -- [-643.693] (-640.171) (-647.474) (-653.259) * (-650.690) [-642.204] (-654.076) (-656.308) -- 0:00:24
727000 -- (-649.016) [-642.423] (-654.422) (-648.895) * (-656.390) (-650.368) (-655.719) [-661.073] -- 0:00:24
727500 -- (-652.949) [-644.161] (-654.208) (-641.566) * [-647.243] (-657.575) (-650.260) (-643.245) -- 0:00:23
728000 -- (-651.569) (-645.642) (-659.738) [-643.120] * (-653.329) (-657.659) (-653.981) [-647.001] -- 0:00:23
728500 -- (-653.264) [-644.405] (-654.683) (-640.241) * (-646.955) [-644.680] (-648.848) (-654.099) -- 0:00:23
729000 -- (-643.196) [-640.278] (-657.822) (-656.670) * (-643.784) [-649.525] (-657.021) (-651.315) -- 0:00:23
729500 -- (-652.523) [-649.768] (-643.599) (-646.302) * [-643.135] (-649.913) (-661.077) (-649.605) -- 0:00:23
730000 -- (-655.023) [-647.941] (-653.432) (-660.706) * (-651.757) (-655.637) (-649.277) [-644.183] -- 0:00:23
Average standard deviation of split frequencies: 0.006490
730500 -- (-673.516) [-636.364] (-652.157) (-639.282) * (-643.123) (-646.998) [-652.696] (-643.622) -- 0:00:23
731000 -- (-651.243) [-643.731] (-648.103) (-647.739) * (-642.221) (-640.573) [-651.904] (-641.140) -- 0:00:23
731500 -- [-646.342] (-641.525) (-653.932) (-643.974) * (-644.513) [-644.210] (-652.160) (-661.788) -- 0:00:23
732000 -- (-651.089) [-647.851] (-653.095) (-643.321) * [-643.216] (-649.470) (-648.233) (-649.527) -- 0:00:23
732500 -- [-648.977] (-661.405) (-646.481) (-645.880) * [-638.312] (-657.637) (-644.485) (-648.051) -- 0:00:23
733000 -- [-642.138] (-649.917) (-648.021) (-656.608) * (-640.965) (-647.519) [-644.820] (-646.366) -- 0:00:23
733500 -- [-638.922] (-651.581) (-656.903) (-651.284) * (-641.117) [-644.847] (-648.710) (-653.674) -- 0:00:23
734000 -- [-645.155] (-643.529) (-651.662) (-653.340) * [-646.796] (-651.396) (-649.773) (-659.850) -- 0:00:23
734500 -- (-638.538) [-646.023] (-657.479) (-648.786) * (-647.776) (-659.548) (-660.907) [-645.020] -- 0:00:23
735000 -- [-641.503] (-648.714) (-657.756) (-652.894) * [-637.044] (-663.126) (-654.042) (-652.057) -- 0:00:23
Average standard deviation of split frequencies: 0.006669
735500 -- [-634.916] (-649.996) (-646.881) (-646.381) * (-647.867) (-649.516) [-647.886] (-660.063) -- 0:00:23
736000 -- (-642.991) (-651.698) [-657.381] (-656.661) * [-643.832] (-645.232) (-655.186) (-646.650) -- 0:00:23
736500 -- [-643.512] (-667.421) (-656.031) (-658.421) * (-653.999) (-640.267) (-653.034) [-642.129] -- 0:00:23
737000 -- [-643.391] (-660.302) (-653.197) (-654.508) * (-642.352) (-662.437) [-645.564] (-652.341) -- 0:00:23
737500 -- (-638.317) (-654.786) [-645.593] (-645.691) * [-643.581] (-643.005) (-650.839) (-658.503) -- 0:00:23
738000 -- [-638.781] (-661.039) (-646.904) (-645.702) * (-658.281) (-653.822) [-642.858] (-641.675) -- 0:00:23
738500 -- [-637.749] (-660.221) (-648.745) (-649.368) * (-649.522) (-653.170) [-651.857] (-650.223) -- 0:00:23
739000 -- [-641.838] (-654.994) (-657.830) (-646.786) * (-652.826) (-652.808) (-658.889) [-648.687] -- 0:00:22
739500 -- [-647.140] (-658.135) (-656.723) (-647.072) * (-659.228) [-650.307] (-650.311) (-642.335) -- 0:00:22
740000 -- (-650.037) (-660.855) [-644.045] (-645.381) * (-648.021) (-648.122) (-659.546) [-642.195] -- 0:00:22
Average standard deviation of split frequencies: 0.006152
740500 -- [-652.422] (-653.022) (-648.452) (-650.186) * (-646.611) (-648.056) (-654.250) [-637.041] -- 0:00:22
741000 -- (-658.291) (-649.845) (-639.718) [-643.813] * (-658.928) (-653.312) (-655.160) [-645.611] -- 0:00:22
741500 -- (-643.096) (-655.558) [-641.842] (-657.971) * (-651.523) (-656.999) (-658.791) [-645.511] -- 0:00:22
742000 -- (-643.374) [-652.267] (-645.187) (-652.571) * (-646.528) [-649.923] (-654.397) (-647.419) -- 0:00:22
742500 -- [-638.538] (-663.936) (-660.310) (-648.899) * (-650.750) [-647.225] (-646.963) (-653.680) -- 0:00:22
743000 -- [-639.787] (-658.153) (-660.245) (-653.020) * (-650.948) (-661.445) (-649.073) [-643.824] -- 0:00:22
743500 -- [-639.668] (-659.490) (-657.826) (-648.639) * (-651.925) (-647.148) [-646.155] (-659.709) -- 0:00:22
744000 -- [-639.118] (-649.343) (-664.072) (-645.152) * [-643.656] (-647.763) (-651.056) (-655.809) -- 0:00:22
744500 -- [-637.301] (-652.475) (-657.245) (-653.293) * (-643.536) (-658.197) [-651.359] (-655.741) -- 0:00:22
745000 -- (-645.143) (-646.049) (-656.608) [-643.831] * (-645.371) (-647.980) [-646.453] (-661.517) -- 0:00:22
Average standard deviation of split frequencies: 0.006477
745500 -- [-651.424] (-644.550) (-658.014) (-659.476) * [-645.561] (-639.217) (-649.290) (-662.242) -- 0:00:22
746000 -- (-644.827) [-641.690] (-651.911) (-648.356) * (-657.458) (-654.368) (-647.629) [-660.636] -- 0:00:22
746500 -- (-658.101) [-641.550] (-648.419) (-644.222) * (-657.990) [-643.606] (-653.099) (-648.436) -- 0:00:22
747000 -- (-645.313) [-637.777] (-649.916) (-650.513) * (-648.168) (-642.229) [-642.478] (-654.001) -- 0:00:22
747500 -- (-657.335) (-644.897) [-642.917] (-657.870) * (-642.869) [-640.909] (-645.777) (-647.822) -- 0:00:22
748000 -- (-650.383) (-647.148) [-638.868] (-648.688) * [-640.446] (-646.550) (-659.187) (-653.729) -- 0:00:22
748500 -- (-657.081) [-642.363] (-644.992) (-659.332) * (-644.256) [-643.614] (-651.373) (-657.496) -- 0:00:22
749000 -- (-649.913) [-642.790] (-646.919) (-648.768) * (-645.860) [-642.540] (-654.372) (-654.894) -- 0:00:22
749500 -- (-651.355) [-639.664] (-661.271) (-647.695) * (-657.998) (-639.584) (-658.129) [-656.345] -- 0:00:22
750000 -- (-653.951) [-644.540] (-650.064) (-655.129) * (-646.894) [-643.257] (-642.577) (-663.803) -- 0:00:22
Average standard deviation of split frequencies: 0.006123
750500 -- (-650.279) (-641.701) [-642.895] (-653.574) * (-641.621) (-643.002) [-646.586] (-670.550) -- 0:00:21
751000 -- (-648.632) (-661.759) (-645.171) [-651.346] * [-643.481] (-646.756) (-640.487) (-665.952) -- 0:00:21
751500 -- (-647.906) (-643.507) [-646.012] (-657.786) * (-640.407) (-640.205) [-645.969] (-659.684) -- 0:00:21
752000 -- [-646.807] (-648.345) (-653.111) (-651.915) * (-652.165) [-639.741] (-644.413) (-659.365) -- 0:00:21
752500 -- (-653.770) [-644.821] (-659.293) (-650.499) * (-659.646) [-637.790] (-644.473) (-660.364) -- 0:00:21
753000 -- (-652.756) (-651.800) (-653.450) [-646.998] * (-655.839) (-648.904) [-646.735] (-648.748) -- 0:00:21
753500 -- [-644.361] (-644.972) (-650.300) (-645.228) * [-640.747] (-650.717) (-652.449) (-651.203) -- 0:00:21
754000 -- (-646.800) [-647.562] (-645.984) (-641.592) * (-646.280) [-643.015] (-662.340) (-655.362) -- 0:00:21
754500 -- (-657.568) (-642.834) [-640.133] (-654.765) * (-641.612) [-639.913] (-649.990) (-670.482) -- 0:00:21
755000 -- (-651.349) (-648.020) [-645.257] (-650.238) * [-648.777] (-645.403) (-656.555) (-648.579) -- 0:00:21
Average standard deviation of split frequencies: 0.006391
755500 -- (-648.030) (-657.714) [-646.954] (-653.349) * (-661.372) (-651.743) [-644.687] (-638.527) -- 0:00:21
756000 -- (-648.667) (-659.199) [-649.748] (-648.531) * (-655.070) (-646.592) [-646.620] (-649.026) -- 0:00:21
756500 -- (-655.220) (-656.479) (-638.952) [-639.593] * [-639.670] (-643.475) (-648.637) (-661.365) -- 0:00:21
757000 -- (-652.541) (-654.101) (-649.386) [-649.306] * (-658.635) (-657.016) [-644.253] (-648.351) -- 0:00:21
757500 -- (-669.520) (-665.660) [-641.296] (-650.754) * (-656.267) (-638.997) (-661.000) [-652.755] -- 0:00:21
758000 -- (-649.415) (-652.277) [-637.597] (-645.715) * (-662.347) [-639.637] (-642.624) (-649.531) -- 0:00:21
758500 -- (-659.005) (-646.146) [-644.144] (-651.740) * (-657.308) (-644.212) [-640.089] (-647.812) -- 0:00:21
759000 -- (-651.011) [-637.082] (-657.919) (-651.302) * (-645.180) [-641.464] (-642.621) (-650.597) -- 0:00:21
759500 -- [-646.280] (-647.556) (-643.713) (-649.257) * [-643.813] (-660.220) (-647.195) (-645.037) -- 0:00:21
760000 -- (-650.211) (-649.863) [-638.156] (-664.810) * (-646.694) (-646.691) (-651.879) [-640.775] -- 0:00:21
Average standard deviation of split frequencies: 0.006740
760500 -- (-652.484) (-652.153) [-650.187] (-656.890) * [-638.614] (-651.145) (-643.671) (-649.719) -- 0:00:21
761000 -- (-648.843) (-647.234) [-654.682] (-652.560) * [-641.953] (-647.747) (-645.460) (-643.708) -- 0:00:21
761500 -- (-648.044) (-642.536) [-637.428] (-657.517) * [-643.326] (-650.321) (-650.809) (-656.598) -- 0:00:20
762000 -- (-641.541) (-652.730) (-654.617) [-655.595] * (-642.654) (-648.502) [-648.025] (-661.620) -- 0:00:20
762500 -- [-653.011] (-649.003) (-655.012) (-646.460) * (-641.900) (-650.431) [-639.911] (-655.251) -- 0:00:20
763000 -- [-651.404] (-653.644) (-651.850) (-652.153) * [-640.848] (-651.841) (-648.755) (-661.283) -- 0:00:20
763500 -- (-658.772) (-647.546) (-641.378) [-638.627] * (-634.551) (-650.822) [-648.262] (-666.097) -- 0:00:20
764000 -- (-660.851) (-654.335) (-646.776) [-637.643] * [-643.905] (-660.161) (-657.566) (-654.373) -- 0:00:20
764500 -- [-650.019] (-651.534) (-647.117) (-643.287) * (-641.820) (-654.007) (-661.552) [-640.785] -- 0:00:20
765000 -- [-648.260] (-647.592) (-656.716) (-645.264) * (-639.638) (-649.861) (-659.086) [-650.262] -- 0:00:20
Average standard deviation of split frequencies: 0.006770
765500 -- (-643.255) (-649.979) (-654.864) [-639.876] * (-641.679) (-655.817) (-657.231) [-649.463] -- 0:00:20
766000 -- (-654.739) [-646.496] (-655.417) (-645.459) * (-640.437) (-655.588) (-659.484) [-642.510] -- 0:00:20
766500 -- [-645.683] (-661.129) (-659.350) (-649.232) * (-643.076) [-653.293] (-651.240) (-649.343) -- 0:00:20
767000 -- (-648.289) (-657.830) [-638.669] (-653.064) * [-642.127] (-651.397) (-650.964) (-658.224) -- 0:00:20
767500 -- [-645.307] (-653.107) (-646.664) (-648.972) * [-638.063] (-649.194) (-663.770) (-651.228) -- 0:00:20
768000 -- (-648.325) (-655.268) [-644.087] (-648.389) * [-637.830] (-656.011) (-649.082) (-664.359) -- 0:00:20
768500 -- [-639.144] (-650.604) (-642.592) (-648.467) * (-640.592) (-657.659) (-650.079) [-642.742] -- 0:00:20
769000 -- (-646.823) (-669.829) (-646.093) [-640.619] * (-644.251) (-646.054) (-650.682) [-651.326] -- 0:00:20
769500 -- (-656.815) [-637.378] (-648.276) (-643.998) * (-644.777) [-649.769] (-652.219) (-649.115) -- 0:00:20
770000 -- (-663.181) (-650.411) (-646.080) [-638.582] * [-644.156] (-652.814) (-669.072) (-647.099) -- 0:00:20
Average standard deviation of split frequencies: 0.006652
770500 -- (-653.197) [-642.477] (-645.151) (-641.875) * [-638.943] (-646.714) (-660.925) (-649.962) -- 0:00:20
771000 -- (-642.302) [-642.668] (-646.678) (-646.148) * [-642.012] (-653.426) (-658.439) (-654.004) -- 0:00:20
771500 -- (-642.142) (-661.771) [-648.679] (-642.949) * [-644.550] (-651.161) (-652.468) (-656.444) -- 0:00:20
772000 -- [-645.808] (-654.877) (-655.695) (-646.163) * (-639.997) (-647.633) [-643.225] (-654.514) -- 0:00:20
772500 -- (-636.177) (-653.285) [-648.396] (-652.756) * [-640.703] (-666.794) (-649.069) (-652.376) -- 0:00:20
773000 -- [-642.952] (-643.298) (-650.813) (-637.390) * (-643.517) (-657.724) [-644.799] (-652.770) -- 0:00:19
773500 -- (-672.839) (-654.683) [-647.227] (-648.977) * [-642.111] (-653.496) (-639.062) (-645.690) -- 0:00:19
774000 -- (-649.633) [-654.034] (-640.451) (-653.215) * (-645.954) (-651.581) [-645.810] (-661.373) -- 0:00:19
774500 -- (-664.392) [-650.606] (-641.956) (-653.870) * [-638.142] (-650.853) (-652.157) (-655.376) -- 0:00:19
775000 -- (-653.512) (-644.989) [-646.204] (-658.547) * (-643.471) [-644.720] (-646.190) (-652.818) -- 0:00:19
Average standard deviation of split frequencies: 0.006758
775500 -- (-667.128) (-637.058) [-640.790] (-663.066) * [-640.412] (-649.232) (-656.946) (-651.940) -- 0:00:19
776000 -- (-645.481) [-645.984] (-646.984) (-648.122) * [-644.868] (-643.514) (-650.098) (-645.626) -- 0:00:19
776500 -- [-639.380] (-659.997) (-649.323) (-664.799) * [-644.292] (-649.465) (-653.009) (-654.881) -- 0:00:19
777000 -- (-639.512) (-654.028) [-654.813] (-650.655) * (-641.924) (-650.679) (-651.359) [-652.540] -- 0:00:19
777500 -- (-649.542) [-639.039] (-645.602) (-645.506) * (-645.903) [-654.020] (-644.039) (-652.445) -- 0:00:19
778000 -- (-651.154) [-640.708] (-663.010) (-658.504) * (-638.176) [-652.546] (-640.071) (-655.824) -- 0:00:19
778500 -- (-650.580) (-648.503) [-646.269] (-654.046) * [-639.157] (-641.422) (-650.008) (-660.437) -- 0:00:19
779000 -- [-646.738] (-649.329) (-641.064) (-659.455) * (-641.479) (-641.608) [-654.832] (-658.012) -- 0:00:19
779500 -- (-667.546) (-654.990) [-635.300] (-641.321) * [-645.404] (-640.795) (-660.538) (-648.816) -- 0:00:19
780000 -- (-651.442) (-647.541) (-639.146) [-645.550] * [-644.165] (-637.190) (-646.988) (-660.108) -- 0:00:19
Average standard deviation of split frequencies: 0.006756
780500 -- [-642.977] (-652.377) (-639.666) (-650.955) * (-659.031) [-639.029] (-644.646) (-651.773) -- 0:00:19
781000 -- (-650.397) (-651.250) [-640.070] (-661.693) * (-658.745) (-646.561) (-659.931) [-638.532] -- 0:00:19
781500 -- (-658.300) (-639.967) [-639.535] (-647.297) * (-669.080) (-641.846) (-658.849) [-646.659] -- 0:00:19
782000 -- (-642.483) (-647.018) [-638.809] (-648.698) * (-654.824) [-642.903] (-643.288) (-647.860) -- 0:00:19
782500 -- [-641.039] (-643.573) (-637.414) (-655.298) * (-660.605) (-649.793) [-656.041] (-654.256) -- 0:00:19
783000 -- [-644.160] (-642.911) (-643.992) (-656.458) * (-649.147) (-651.184) (-654.705) [-644.736] -- 0:00:19
783500 -- (-650.393) [-650.932] (-642.509) (-652.049) * [-639.809] (-646.660) (-647.688) (-644.459) -- 0:00:19
784000 -- (-650.161) (-653.016) [-645.793] (-647.289) * [-645.588] (-650.954) (-654.736) (-642.076) -- 0:00:19
784500 -- (-640.578) [-644.254] (-641.653) (-653.232) * (-653.022) [-650.795] (-651.958) (-642.358) -- 0:00:18
785000 -- (-645.760) (-641.881) (-657.369) [-646.682] * (-655.574) (-658.718) (-667.313) [-637.645] -- 0:00:18
Average standard deviation of split frequencies: 0.006633
785500 -- [-639.840] (-644.098) (-654.887) (-647.483) * [-645.136] (-646.491) (-654.868) (-640.125) -- 0:00:18
786000 -- [-640.371] (-644.263) (-645.059) (-653.448) * [-645.522] (-639.448) (-644.577) (-639.549) -- 0:00:18
786500 -- [-649.887] (-648.787) (-640.661) (-656.024) * (-644.988) [-643.062] (-653.904) (-639.919) -- 0:00:18
787000 -- (-657.846) (-645.379) [-642.657] (-658.139) * (-645.607) (-647.321) [-648.798] (-642.482) -- 0:00:18
787500 -- (-653.378) (-645.909) [-636.941] (-654.078) * (-656.521) (-653.495) (-647.098) [-638.479] -- 0:00:18
788000 -- (-650.978) (-656.104) (-641.478) [-646.236] * [-663.602] (-661.739) (-642.622) (-639.342) -- 0:00:18
788500 -- (-650.890) (-655.793) [-641.730] (-649.980) * (-656.117) (-663.170) (-653.881) [-645.816] -- 0:00:18
789000 -- (-655.693) (-656.855) (-643.075) [-650.459] * [-649.520] (-657.489) (-659.323) (-646.607) -- 0:00:18
789500 -- (-651.893) (-652.218) (-640.763) [-648.011] * [-640.013] (-664.107) (-655.955) (-647.772) -- 0:00:18
790000 -- [-649.672] (-652.684) (-639.994) (-655.654) * [-646.109] (-659.931) (-645.490) (-647.260) -- 0:00:18
Average standard deviation of split frequencies: 0.006839
790500 -- (-656.175) [-643.671] (-639.496) (-655.660) * (-648.482) (-652.834) (-651.703) [-647.699] -- 0:00:18
791000 -- (-641.660) (-652.862) [-643.759] (-658.399) * (-648.386) [-650.258] (-646.122) (-646.334) -- 0:00:18
791500 -- [-646.467] (-654.065) (-651.460) (-649.397) * (-657.733) (-656.347) (-646.507) [-639.554] -- 0:00:18
792000 -- (-651.672) [-658.102] (-643.129) (-652.745) * (-653.305) [-648.494] (-650.859) (-644.078) -- 0:00:18
792500 -- (-655.391) (-647.168) (-643.898) [-640.941] * (-651.275) [-643.387] (-660.943) (-647.126) -- 0:00:18
793000 -- (-647.784) (-649.951) (-644.434) [-642.314] * (-651.866) (-651.279) (-648.555) [-649.629] -- 0:00:18
793500 -- [-646.512] (-665.594) (-641.978) (-647.755) * (-647.775) (-644.430) [-644.428] (-653.849) -- 0:00:18
794000 -- (-655.435) [-646.367] (-641.593) (-642.948) * (-651.632) (-645.165) (-664.436) [-647.369] -- 0:00:18
794500 -- (-661.452) (-643.809) [-644.283] (-644.107) * (-654.965) (-641.967) (-659.352) [-641.595] -- 0:00:18
795000 -- (-657.169) (-651.665) [-650.348] (-646.563) * (-641.960) [-642.642] (-650.826) (-655.248) -- 0:00:18
Average standard deviation of split frequencies: 0.007385
795500 -- [-646.290] (-659.732) (-648.877) (-653.640) * (-650.630) [-643.859] (-656.404) (-660.451) -- 0:00:17
796000 -- [-643.326] (-656.379) (-652.447) (-646.656) * (-646.235) [-638.750] (-645.665) (-642.427) -- 0:00:17
796500 -- [-645.427] (-647.422) (-650.631) (-649.591) * [-647.047] (-647.189) (-646.129) (-647.108) -- 0:00:17
797000 -- (-657.361) [-644.490] (-660.754) (-660.574) * (-652.086) (-636.840) [-648.300] (-645.056) -- 0:00:17
797500 -- (-653.263) (-644.298) [-651.008] (-660.902) * (-645.913) [-647.918] (-652.352) (-649.654) -- 0:00:17
798000 -- (-650.734) (-656.404) [-638.930] (-658.103) * [-645.756] (-640.851) (-666.680) (-651.387) -- 0:00:17
798500 -- (-651.016) (-643.120) [-639.110] (-656.234) * (-652.619) [-646.691] (-648.266) (-646.084) -- 0:00:17
799000 -- [-642.654] (-640.448) (-641.887) (-658.367) * [-645.436] (-651.084) (-655.297) (-646.499) -- 0:00:17
799500 -- (-647.471) (-648.029) [-641.542] (-658.493) * [-644.719] (-658.850) (-653.493) (-647.519) -- 0:00:17
800000 -- (-650.074) [-651.812] (-642.200) (-646.541) * (-652.941) (-642.811) [-644.694] (-649.756) -- 0:00:17
Average standard deviation of split frequencies: 0.007308
800500 -- (-647.621) (-660.578) [-639.124] (-653.383) * [-645.432] (-643.649) (-652.817) (-654.341) -- 0:00:17
801000 -- (-648.696) [-641.145] (-649.269) (-648.116) * (-642.664) (-647.756) [-643.643] (-657.911) -- 0:00:17
801500 -- [-639.090] (-648.685) (-650.639) (-640.180) * (-645.013) (-646.455) [-644.411] (-647.433) -- 0:00:17
802000 -- (-643.922) (-651.155) [-643.217] (-651.694) * [-647.972] (-649.760) (-646.358) (-655.318) -- 0:00:17
802500 -- (-650.043) [-641.876] (-649.082) (-661.739) * (-653.868) [-651.860] (-660.210) (-653.023) -- 0:00:17
803000 -- (-641.787) (-650.815) [-648.508] (-657.099) * [-649.599] (-655.508) (-641.193) (-649.523) -- 0:00:17
803500 -- (-642.998) [-641.866] (-657.420) (-649.992) * (-648.654) [-641.458] (-647.218) (-657.822) -- 0:00:17
804000 -- [-642.620] (-641.081) (-649.216) (-655.105) * (-646.219) (-646.137) [-642.185] (-641.605) -- 0:00:17
804500 -- (-653.957) (-648.112) [-637.247] (-644.925) * (-646.836) (-653.620) [-646.184] (-642.866) -- 0:00:17
805000 -- (-660.902) (-649.371) (-645.370) [-639.954] * (-661.074) (-643.242) (-655.192) [-645.508] -- 0:00:17
Average standard deviation of split frequencies: 0.007328
805500 -- (-650.193) (-654.981) [-644.487] (-648.126) * [-653.170] (-652.734) (-647.764) (-654.324) -- 0:00:17
806000 -- (-650.980) (-646.946) (-642.519) [-648.317] * (-644.506) (-646.848) (-669.457) [-650.079] -- 0:00:17
806500 -- (-649.755) (-649.357) [-645.369] (-648.185) * (-647.418) [-641.669] (-654.986) (-645.631) -- 0:00:17
807000 -- [-643.226] (-651.884) (-645.920) (-662.791) * [-638.082] (-649.820) (-659.441) (-646.416) -- 0:00:16
807500 -- (-652.166) (-645.451) (-641.977) [-645.656] * (-644.442) [-643.433] (-652.386) (-653.348) -- 0:00:16
808000 -- [-652.372] (-645.362) (-650.568) (-669.469) * (-650.329) [-644.802] (-647.806) (-652.449) -- 0:00:16
808500 -- (-654.204) (-640.535) [-644.170] (-650.759) * (-646.195) (-644.606) [-647.113] (-653.992) -- 0:00:16
809000 -- (-653.155) [-644.790] (-643.735) (-646.844) * (-648.777) (-649.630) [-646.982] (-647.240) -- 0:00:16
809500 -- (-641.252) (-645.817) (-656.185) [-650.266] * (-648.155) [-637.220] (-641.607) (-649.287) -- 0:00:16
810000 -- [-651.820] (-656.314) (-654.834) (-647.914) * (-647.130) [-642.679] (-656.435) (-650.825) -- 0:00:16
Average standard deviation of split frequencies: 0.007354
810500 -- [-637.617] (-652.996) (-657.606) (-655.982) * (-648.483) [-641.955] (-654.362) (-642.433) -- 0:00:16
811000 -- (-652.627) (-662.309) (-663.084) [-647.273] * (-639.068) (-646.067) (-645.025) [-636.941] -- 0:00:16
811500 -- (-658.112) [-644.665] (-655.603) (-655.022) * (-651.239) (-639.994) (-654.285) [-641.805] -- 0:00:16
812000 -- [-654.589] (-651.435) (-645.735) (-639.750) * (-649.588) (-639.447) (-645.032) [-639.585] -- 0:00:16
812500 -- (-650.444) (-652.564) [-653.925] (-641.245) * (-654.587) (-642.127) [-645.820] (-641.641) -- 0:00:16
813000 -- (-651.958) (-641.505) [-652.361] (-646.564) * (-660.798) (-653.876) [-646.502] (-646.081) -- 0:00:16
813500 -- (-647.796) (-653.258) [-643.408] (-656.850) * (-652.402) (-645.619) (-663.434) [-653.934] -- 0:00:16
814000 -- (-643.361) (-640.914) (-657.335) [-645.928] * (-660.215) [-641.887] (-662.334) (-650.014) -- 0:00:16
814500 -- (-656.422) (-648.301) (-664.767) [-643.112] * (-652.527) [-642.919] (-653.800) (-643.631) -- 0:00:16
815000 -- (-653.504) [-650.821] (-653.768) (-643.612) * (-649.491) (-640.258) [-641.294] (-646.058) -- 0:00:16
Average standard deviation of split frequencies: 0.007136
815500 -- (-648.974) [-646.189] (-660.827) (-646.275) * (-649.575) [-639.768] (-645.454) (-651.288) -- 0:00:16
816000 -- [-640.590] (-642.204) (-651.785) (-648.107) * [-644.361] (-637.209) (-650.997) (-656.911) -- 0:00:16
816500 -- (-644.908) [-638.162] (-649.903) (-653.932) * (-653.352) (-650.708) (-652.616) [-640.367] -- 0:00:16
817000 -- [-648.104] (-640.416) (-657.684) (-648.483) * (-642.804) (-660.182) (-658.151) [-646.974] -- 0:00:16
817500 -- (-652.650) (-642.485) (-669.187) [-641.142] * [-639.731] (-663.102) (-645.844) (-645.658) -- 0:00:16
818000 -- [-645.764] (-645.487) (-651.800) (-649.119) * [-638.060] (-658.208) (-654.713) (-649.075) -- 0:00:16
818500 -- (-659.441) (-641.957) (-646.054) [-659.876] * [-638.959] (-656.752) (-637.633) (-651.402) -- 0:00:15
819000 -- [-642.247] (-665.329) (-655.669) (-640.891) * (-645.873) (-667.532) [-641.344] (-661.989) -- 0:00:15
819500 -- (-658.051) (-646.081) [-642.656] (-648.229) * [-648.406] (-659.523) (-648.961) (-643.861) -- 0:00:15
820000 -- (-651.082) [-641.431] (-651.684) (-652.705) * [-652.724] (-658.238) (-645.997) (-654.721) -- 0:00:15
Average standard deviation of split frequencies: 0.007028
820500 -- (-666.315) (-657.455) [-645.956] (-647.821) * (-651.606) (-649.531) [-644.458] (-660.853) -- 0:00:15
821000 -- (-656.773) (-654.994) [-651.032] (-643.483) * [-643.483] (-649.632) (-650.332) (-652.201) -- 0:00:15
821500 -- [-650.004] (-641.764) (-658.725) (-648.056) * [-641.070] (-653.859) (-656.887) (-644.389) -- 0:00:15
822000 -- [-648.496] (-653.361) (-647.304) (-641.281) * (-643.040) (-647.704) (-658.046) [-636.962] -- 0:00:15
822500 -- (-650.808) [-646.457] (-645.511) (-647.335) * (-651.587) (-666.464) (-654.802) [-641.398] -- 0:00:15
823000 -- (-651.588) (-651.650) (-655.549) [-646.188] * (-652.195) (-652.454) (-651.221) [-644.747] -- 0:00:15
823500 -- (-643.251) (-650.159) (-649.317) [-646.839] * (-653.575) [-644.545] (-656.372) (-643.210) -- 0:00:15
824000 -- (-649.133) (-650.359) (-653.229) [-643.878] * (-659.319) [-643.773] (-648.953) (-649.310) -- 0:00:15
824500 -- (-658.104) (-657.091) (-647.479) [-638.554] * (-646.226) [-644.740] (-651.065) (-655.387) -- 0:00:15
825000 -- (-658.296) [-645.458] (-641.651) (-644.472) * (-651.361) (-658.397) [-650.492] (-643.051) -- 0:00:15
Average standard deviation of split frequencies: 0.007218
825500 -- (-660.275) (-655.572) (-647.425) [-637.989] * (-645.520) (-651.897) [-642.965] (-649.685) -- 0:00:15
826000 -- (-652.369) [-643.207] (-655.507) (-643.528) * (-659.439) (-653.316) [-646.463] (-646.358) -- 0:00:15
826500 -- (-658.196) (-646.382) (-648.440) [-642.077] * (-651.834) (-643.843) [-641.502] (-662.658) -- 0:00:15
827000 -- (-655.873) (-641.616) [-647.810] (-644.568) * (-653.196) [-648.159] (-643.532) (-655.239) -- 0:00:15
827500 -- (-650.104) (-640.829) (-640.707) [-644.380] * (-652.464) [-639.973] (-649.409) (-659.210) -- 0:00:15
828000 -- (-660.639) [-645.293] (-653.288) (-640.173) * (-651.431) [-641.562] (-660.542) (-656.692) -- 0:00:15
828500 -- (-645.358) [-640.520] (-654.375) (-655.571) * [-645.534] (-647.554) (-657.658) (-663.794) -- 0:00:15
829000 -- [-643.191] (-642.857) (-653.568) (-658.648) * (-652.801) (-653.721) [-645.238] (-662.997) -- 0:00:15
829500 -- (-648.751) (-661.602) (-650.297) [-656.434] * (-659.791) [-661.249] (-654.681) (-654.864) -- 0:00:15
830000 -- [-645.048] (-648.858) (-656.023) (-647.209) * (-654.095) [-642.095] (-640.284) (-658.382) -- 0:00:14
Average standard deviation of split frequencies: 0.007211
830500 -- (-639.563) (-649.169) [-646.743] (-650.454) * (-655.858) [-651.981] (-645.276) (-646.333) -- 0:00:14
831000 -- (-641.461) (-640.874) [-651.901] (-662.612) * (-650.527) (-647.167) [-640.338] (-644.564) -- 0:00:14
831500 -- (-650.352) (-648.373) (-640.872) [-638.796] * (-654.345) [-641.623] (-636.280) (-643.026) -- 0:00:14
832000 -- (-652.113) (-648.715) (-645.814) [-642.698] * (-660.890) (-640.475) [-643.219] (-643.408) -- 0:00:14
832500 -- (-646.005) [-653.340] (-651.259) (-646.618) * (-651.498) [-643.397] (-658.253) (-656.295) -- 0:00:14
833000 -- [-646.066] (-655.675) (-656.602) (-644.559) * (-652.877) [-640.232] (-647.804) (-650.832) -- 0:00:14
833500 -- (-663.750) (-656.121) (-647.821) [-645.613] * (-651.766) [-643.391] (-650.629) (-649.170) -- 0:00:14
834000 -- (-653.226) (-655.696) (-649.737) [-644.133] * (-646.441) (-648.786) [-649.161] (-655.267) -- 0:00:14
834500 -- (-655.512) [-643.778] (-653.411) (-642.703) * (-648.703) [-637.882] (-656.766) (-668.220) -- 0:00:14
835000 -- (-656.913) (-642.585) (-652.309) [-646.761] * (-652.446) (-640.847) (-652.064) [-652.917] -- 0:00:14
Average standard deviation of split frequencies: 0.007297
835500 -- (-655.177) [-653.852] (-652.701) (-653.582) * (-651.114) [-637.570] (-662.947) (-651.554) -- 0:00:14
836000 -- (-657.047) (-649.668) [-654.392] (-658.867) * (-651.755) [-639.270] (-653.523) (-653.674) -- 0:00:14
836500 -- (-658.045) (-649.655) (-657.299) [-642.026] * (-653.134) [-644.538] (-653.411) (-650.476) -- 0:00:14
837000 -- [-657.821] (-639.298) (-650.787) (-647.428) * (-647.114) [-637.788] (-643.206) (-650.618) -- 0:00:14
837500 -- (-658.256) (-644.828) [-650.976] (-644.857) * (-654.551) (-643.221) (-652.328) [-652.191] -- 0:00:14
838000 -- (-665.405) (-645.770) [-643.518] (-646.208) * (-653.428) [-640.099] (-657.507) (-647.660) -- 0:00:14
838500 -- (-656.121) [-642.858] (-644.127) (-651.438) * (-646.694) (-653.979) (-658.208) [-640.671] -- 0:00:14
839000 -- (-653.407) (-646.516) [-641.406] (-649.663) * [-643.949] (-644.595) (-652.969) (-644.380) -- 0:00:14
839500 -- (-641.545) [-647.222] (-650.097) (-657.541) * [-649.294] (-645.713) (-662.432) (-647.843) -- 0:00:14
840000 -- [-649.305] (-651.253) (-663.703) (-653.867) * [-643.170] (-649.997) (-644.546) (-654.431) -- 0:00:14
Average standard deviation of split frequencies: 0.007224
840500 -- (-649.187) [-639.007] (-656.113) (-646.541) * (-643.072) (-651.060) (-654.915) [-639.922] -- 0:00:14
841000 -- [-653.100] (-640.537) (-640.839) (-654.551) * (-643.278) (-648.086) (-664.525) [-637.776] -- 0:00:13
841500 -- [-650.805] (-641.664) (-652.757) (-644.403) * (-647.876) (-657.567) (-657.970) [-647.542] -- 0:00:13
842000 -- [-655.433] (-649.071) (-646.627) (-657.601) * [-653.431] (-650.146) (-657.892) (-665.164) -- 0:00:13
842500 -- (-645.174) (-659.278) [-646.032] (-648.839) * (-658.169) (-656.070) (-649.483) [-642.966] -- 0:00:13
843000 -- (-658.513) (-658.073) [-640.009] (-643.383) * (-645.768) (-653.557) [-642.270] (-646.682) -- 0:00:13
843500 -- (-647.427) (-650.162) [-649.352] (-651.743) * (-652.770) [-650.625] (-658.467) (-643.974) -- 0:00:13
844000 -- (-652.750) (-645.002) (-658.471) [-642.544] * [-643.606] (-656.102) (-653.930) (-642.929) -- 0:00:13
844500 -- [-647.435] (-639.792) (-654.100) (-666.906) * (-652.021) (-654.571) (-652.037) [-636.700] -- 0:00:13
845000 -- [-641.440] (-643.119) (-648.184) (-659.622) * (-659.771) [-646.777] (-654.607) (-657.913) -- 0:00:13
Average standard deviation of split frequencies: 0.007408
845500 -- [-646.937] (-647.913) (-651.894) (-670.991) * (-653.059) (-651.506) (-651.010) [-640.172] -- 0:00:13
846000 -- [-647.250] (-642.421) (-659.602) (-654.951) * [-641.485] (-652.604) (-650.167) (-648.469) -- 0:00:13
846500 -- (-647.488) (-660.261) (-654.037) [-647.269] * (-644.741) (-642.557) (-649.048) [-652.163] -- 0:00:13
847000 -- (-645.171) (-660.027) (-645.052) [-637.098] * [-644.349] (-654.884) (-659.434) (-652.832) -- 0:00:13
847500 -- (-655.228) (-651.614) [-644.085] (-643.071) * (-657.901) (-651.527) (-654.829) [-640.655] -- 0:00:13
848000 -- [-639.725] (-659.774) (-639.519) (-650.894) * (-656.350) (-640.919) (-645.493) [-646.015] -- 0:00:13
848500 -- [-646.048] (-651.879) (-647.611) (-661.536) * (-655.118) (-640.313) [-647.214] (-639.202) -- 0:00:13
849000 -- (-639.903) (-652.440) [-641.166] (-667.893) * (-659.942) (-644.503) (-652.850) [-639.314] -- 0:00:13
849500 -- (-648.379) [-648.510] (-658.105) (-643.669) * (-669.281) (-667.758) [-643.356] (-639.936) -- 0:00:13
850000 -- [-641.940] (-646.705) (-644.029) (-654.392) * (-656.952) (-653.205) [-639.533] (-663.543) -- 0:00:13
Average standard deviation of split frequencies: 0.007269
850500 -- (-647.670) (-662.539) [-646.092] (-643.058) * (-649.127) [-645.683] (-645.339) (-649.296) -- 0:00:13
851000 -- [-641.927] (-651.863) (-639.816) (-642.089) * (-656.402) (-654.608) [-641.445] (-657.604) -- 0:00:13
851500 -- (-650.791) (-652.384) (-641.007) [-638.983] * (-652.654) (-651.872) (-649.852) [-647.126] -- 0:00:13
852000 -- (-648.926) (-656.797) [-642.793] (-647.788) * (-653.628) (-658.138) (-644.442) [-643.752] -- 0:00:13
852500 -- [-643.469] (-661.159) (-645.773) (-646.912) * (-646.895) (-656.353) [-638.105] (-643.062) -- 0:00:12
853000 -- (-647.730) (-661.412) (-646.696) [-644.518] * (-649.608) (-663.773) [-646.088] (-645.836) -- 0:00:12
853500 -- (-643.798) [-647.337] (-646.319) (-645.249) * (-658.286) (-659.618) (-646.781) [-639.465] -- 0:00:12
854000 -- (-643.598) (-647.633) [-644.947] (-659.074) * (-647.303) (-660.207) (-648.506) [-647.147] -- 0:00:12
854500 -- (-640.693) (-653.263) [-645.187] (-655.556) * (-657.691) (-649.781) (-640.333) [-638.139] -- 0:00:12
855000 -- (-642.184) (-644.686) (-643.200) [-642.642] * (-650.411) (-648.381) [-634.872] (-647.569) -- 0:00:12
Average standard deviation of split frequencies: 0.006900
855500 -- (-650.558) (-643.491) [-641.854] (-645.914) * (-658.931) [-648.068] (-643.574) (-644.457) -- 0:00:12
856000 -- (-642.065) (-647.283) (-636.544) [-642.419] * [-642.861] (-642.321) (-661.401) (-662.703) -- 0:00:12
856500 -- [-650.399] (-652.770) (-644.487) (-644.076) * (-646.897) (-656.258) (-652.985) [-646.716] -- 0:00:12
857000 -- (-661.243) (-660.848) (-641.964) [-648.971] * (-662.582) [-646.878] (-652.000) (-640.366) -- 0:00:12
857500 -- (-647.019) (-655.031) [-647.573] (-642.593) * (-654.589) (-643.471) (-659.386) [-646.332] -- 0:00:12
858000 -- (-656.448) (-647.045) (-660.052) [-637.619] * (-646.150) [-642.642] (-664.417) (-654.233) -- 0:00:12
858500 -- (-645.851) (-658.182) (-658.801) [-641.943] * (-639.125) (-647.415) (-657.668) [-643.725] -- 0:00:12
859000 -- [-646.765] (-655.346) (-655.497) (-643.884) * (-648.977) [-642.954] (-649.191) (-640.535) -- 0:00:12
859500 -- [-642.172] (-652.645) (-656.881) (-647.562) * (-638.837) [-645.857] (-649.561) (-660.647) -- 0:00:12
860000 -- (-644.676) [-645.721] (-657.576) (-651.310) * (-655.186) [-644.929] (-654.537) (-656.645) -- 0:00:12
Average standard deviation of split frequencies: 0.006863
860500 -- [-639.946] (-646.093) (-644.004) (-662.581) * (-659.731) (-640.783) [-639.605] (-662.584) -- 0:00:12
861000 -- (-643.080) [-655.304] (-663.288) (-656.818) * (-647.913) [-643.230] (-644.629) (-655.707) -- 0:00:12
861500 -- [-643.577] (-657.794) (-653.774) (-646.270) * (-649.893) (-652.124) (-656.382) [-643.209] -- 0:00:12
862000 -- [-643.046] (-648.757) (-650.893) (-659.487) * (-642.812) [-648.816] (-663.593) (-653.084) -- 0:00:12
862500 -- (-646.235) (-649.196) (-654.899) [-650.221] * (-645.408) (-651.037) (-655.327) [-644.177] -- 0:00:12
863000 -- (-650.371) (-657.796) [-639.313] (-643.425) * [-642.674] (-651.331) (-642.969) (-657.403) -- 0:00:12
863500 -- (-642.203) (-646.920) [-649.706] (-642.992) * (-642.170) (-655.002) [-639.094] (-657.509) -- 0:00:12
864000 -- [-641.122] (-645.183) (-661.907) (-642.217) * (-640.106) (-648.486) [-647.721] (-649.420) -- 0:00:11
864500 -- [-645.646] (-651.175) (-660.271) (-647.444) * (-638.258) (-648.105) (-646.149) [-644.659] -- 0:00:11
865000 -- (-645.870) [-646.320] (-648.267) (-649.969) * (-647.583) (-647.547) (-647.194) [-645.605] -- 0:00:11
Average standard deviation of split frequencies: 0.007173
865500 -- (-658.629) (-655.787) [-641.032] (-642.141) * [-639.178] (-648.318) (-647.901) (-645.516) -- 0:00:11
866000 -- (-648.796) (-651.694) [-644.015] (-643.180) * (-645.485) (-653.386) [-642.333] (-657.483) -- 0:00:11
866500 -- (-649.805) (-656.504) [-638.207] (-642.722) * (-651.852) (-664.146) (-656.477) [-655.356] -- 0:00:11
867000 -- (-644.554) (-663.250) [-648.632] (-654.747) * (-650.366) (-657.322) (-654.065) [-646.112] -- 0:00:11
867500 -- (-659.749) (-664.213) (-655.133) [-653.279] * (-648.766) [-648.437] (-663.330) (-644.756) -- 0:00:11
868000 -- (-654.855) (-660.822) (-645.494) [-653.333] * [-647.119] (-653.884) (-647.733) (-655.068) -- 0:00:11
868500 -- [-640.326] (-653.524) (-651.581) (-645.374) * (-651.071) [-642.242] (-647.111) (-657.143) -- 0:00:11
869000 -- (-655.600) (-653.777) (-648.834) [-648.263] * [-650.174] (-651.105) (-657.807) (-657.531) -- 0:00:11
869500 -- [-643.258] (-654.229) (-654.807) (-653.776) * (-648.922) (-657.043) [-638.637] (-647.715) -- 0:00:11
870000 -- (-651.919) (-644.648) [-642.082] (-656.306) * [-649.592] (-645.281) (-662.724) (-640.096) -- 0:00:11
Average standard deviation of split frequencies: 0.007198
870500 -- [-647.818] (-652.037) (-646.642) (-655.827) * (-648.923) (-658.007) [-641.498] (-641.643) -- 0:00:11
871000 -- (-646.534) (-647.673) [-638.341] (-656.880) * (-647.653) (-649.037) (-645.201) [-639.807] -- 0:00:11
871500 -- (-642.589) (-650.915) [-643.392] (-655.361) * (-655.542) (-651.824) [-648.925] (-652.430) -- 0:00:11
872000 -- [-645.656] (-649.710) (-640.504) (-659.467) * (-643.420) (-650.030) [-642.856] (-643.465) -- 0:00:11
872500 -- (-639.000) (-640.175) [-642.550] (-655.103) * (-655.664) [-653.981] (-649.123) (-644.911) -- 0:00:11
873000 -- (-652.179) [-638.887] (-641.022) (-652.238) * (-649.155) [-638.471] (-640.840) (-645.663) -- 0:00:11
873500 -- (-652.873) [-640.379] (-650.654) (-650.509) * [-643.400] (-647.936) (-653.038) (-660.453) -- 0:00:11
874000 -- (-662.061) (-647.743) (-646.535) [-642.721] * [-637.594] (-646.341) (-651.770) (-653.743) -- 0:00:11
874500 -- (-649.885) (-647.679) [-640.912] (-640.156) * (-642.576) (-646.800) [-639.503] (-645.198) -- 0:00:11
875000 -- (-660.865) (-645.477) [-642.664] (-646.882) * (-643.317) (-642.176) [-644.342] (-650.362) -- 0:00:11
Average standard deviation of split frequencies: 0.007344
875500 -- (-660.638) [-645.450] (-646.731) (-648.259) * (-644.279) (-650.312) (-645.112) [-649.177] -- 0:00:10
876000 -- [-646.840] (-646.994) (-639.990) (-658.609) * [-636.567] (-651.635) (-647.648) (-658.717) -- 0:00:10
876500 -- (-661.331) (-644.724) [-645.072] (-652.292) * (-637.745) (-662.320) [-649.258] (-647.520) -- 0:00:10
877000 -- (-649.499) (-646.028) (-641.219) [-646.627] * [-645.655] (-660.694) (-637.671) (-649.457) -- 0:00:10
877500 -- (-668.920) (-648.051) [-639.566] (-650.400) * (-652.709) [-649.959] (-644.066) (-656.808) -- 0:00:10
878000 -- (-656.151) (-643.537) [-649.343] (-641.430) * (-646.858) (-644.507) [-643.285] (-652.812) -- 0:00:10
878500 -- (-640.063) [-648.308] (-640.497) (-647.756) * (-645.076) (-640.719) [-641.672] (-657.690) -- 0:00:10
879000 -- (-653.637) (-654.994) [-641.820] (-651.316) * (-655.663) [-637.202] (-651.979) (-646.531) -- 0:00:10
879500 -- (-646.192) (-651.512) [-642.118] (-660.577) * (-653.977) (-652.527) (-641.230) [-644.163] -- 0:00:10
880000 -- [-641.994] (-647.982) (-642.373) (-662.119) * (-649.982) [-641.148] (-649.052) (-651.272) -- 0:00:10
Average standard deviation of split frequencies: 0.007494
880500 -- (-647.406) (-655.465) [-639.715] (-645.835) * (-639.935) [-638.085] (-656.171) (-649.018) -- 0:00:10
881000 -- (-641.482) (-646.105) [-645.777] (-642.209) * (-649.641) (-647.020) (-655.344) [-641.693] -- 0:00:10
881500 -- (-640.426) (-664.377) (-657.701) [-646.721] * (-655.890) (-647.610) (-648.993) [-646.096] -- 0:00:10
882000 -- (-643.081) (-662.342) [-656.809] (-651.636) * (-659.582) (-652.712) (-646.301) [-644.118] -- 0:00:10
882500 -- [-642.540] (-654.920) (-647.690) (-649.341) * (-657.961) (-662.162) (-660.139) [-650.311] -- 0:00:10
883000 -- [-643.371] (-650.941) (-645.613) (-653.811) * (-661.503) (-649.648) (-655.734) [-652.487] -- 0:00:10
883500 -- (-651.100) (-658.473) [-644.829] (-659.744) * [-643.992] (-649.027) (-662.742) (-654.618) -- 0:00:10
884000 -- (-640.951) (-656.952) [-643.619] (-657.811) * (-654.502) (-653.310) (-653.246) [-648.769] -- 0:00:10
884500 -- (-647.586) [-655.506] (-652.623) (-650.071) * [-659.264] (-650.857) (-662.995) (-645.188) -- 0:00:10
885000 -- [-653.247] (-652.364) (-649.205) (-652.283) * [-642.960] (-651.147) (-651.196) (-659.474) -- 0:00:10
Average standard deviation of split frequencies: 0.007386
885500 -- [-645.821] (-655.227) (-647.658) (-655.346) * (-655.994) (-644.953) (-648.516) [-638.041] -- 0:00:10
886000 -- (-640.557) (-650.978) [-646.508] (-658.001) * [-640.694] (-651.406) (-661.564) (-641.718) -- 0:00:10
886500 -- (-649.596) [-652.988] (-649.523) (-659.152) * (-644.683) (-650.696) (-639.028) [-643.405] -- 0:00:09
887000 -- (-654.571) [-644.269] (-655.999) (-645.878) * (-645.962) [-648.290] (-646.924) (-658.291) -- 0:00:09
887500 -- (-649.205) (-648.948) [-646.744] (-649.399) * (-643.934) (-654.752) (-659.553) [-653.178] -- 0:00:09
888000 -- (-655.686) [-644.686] (-655.752) (-651.360) * [-639.863] (-652.804) (-645.991) (-658.305) -- 0:00:09
888500 -- (-657.877) (-646.439) (-656.476) [-645.225] * (-646.515) (-654.610) [-642.264] (-644.467) -- 0:00:09
889000 -- (-643.370) [-648.082] (-653.603) (-647.654) * [-645.864] (-656.401) (-660.253) (-647.286) -- 0:00:09
889500 -- [-643.025] (-650.787) (-648.021) (-652.077) * [-649.096] (-642.187) (-657.119) (-654.286) -- 0:00:09
890000 -- [-647.508] (-653.552) (-649.451) (-649.070) * (-653.792) (-647.073) (-655.805) [-642.809] -- 0:00:09
Average standard deviation of split frequencies: 0.007211
890500 -- (-662.373) [-645.749] (-644.802) (-654.997) * (-649.320) (-662.887) [-652.737] (-639.416) -- 0:00:09
891000 -- (-657.123) (-642.313) [-647.687] (-658.540) * [-643.344] (-643.186) (-661.689) (-658.806) -- 0:00:09
891500 -- (-651.591) (-651.070) [-640.479] (-653.153) * (-636.821) [-654.533] (-650.673) (-659.321) -- 0:00:09
892000 -- (-650.902) (-653.998) [-639.133] (-658.746) * (-641.361) (-646.947) [-654.424] (-657.160) -- 0:00:09
892500 -- (-642.805) (-657.172) [-640.750] (-650.487) * [-649.064] (-647.264) (-657.655) (-647.910) -- 0:00:09
893000 -- [-644.868] (-660.023) (-640.263) (-654.298) * (-657.118) [-642.718] (-648.291) (-660.114) -- 0:00:09
893500 -- (-661.895) (-651.833) [-638.845] (-642.628) * (-647.146) (-655.633) (-644.730) [-642.603] -- 0:00:09
894000 -- (-647.548) (-653.456) [-650.259] (-645.952) * (-648.338) (-654.907) (-652.080) [-642.536] -- 0:00:09
894500 -- (-653.553) (-654.769) (-652.582) [-649.190] * [-641.572] (-658.872) (-653.862) (-648.213) -- 0:00:09
895000 -- [-638.305] (-647.481) (-651.793) (-647.924) * (-654.776) (-643.823) (-646.203) [-658.250] -- 0:00:09
Average standard deviation of split frequencies: 0.007366
895500 -- (-651.827) [-648.270] (-649.280) (-648.659) * (-659.007) [-644.218] (-657.025) (-647.231) -- 0:00:09
896000 -- (-646.752) (-646.607) (-666.521) [-645.517] * (-651.344) (-664.501) [-647.914] (-655.107) -- 0:00:09
896500 -- (-653.277) [-642.180] (-650.027) (-649.454) * (-650.272) (-644.623) [-644.027] (-646.261) -- 0:00:09
897000 -- (-663.386) (-645.679) [-652.191] (-650.666) * [-647.457] (-645.417) (-646.504) (-645.601) -- 0:00:09
897500 -- (-646.602) [-641.155] (-649.522) (-662.784) * (-652.330) [-652.846] (-656.989) (-648.849) -- 0:00:09
898000 -- (-654.307) [-654.372] (-657.695) (-658.367) * [-643.963] (-657.393) (-649.483) (-643.284) -- 0:00:08
898500 -- (-646.019) (-652.115) [-646.384] (-656.447) * (-647.047) [-649.508] (-653.296) (-640.156) -- 0:00:08
899000 -- [-644.371] (-659.395) (-650.544) (-649.936) * (-646.007) (-665.817) (-647.270) [-646.448] -- 0:00:08
899500 -- (-645.412) (-658.516) (-651.270) [-645.132] * (-652.786) (-645.386) (-642.291) [-644.616] -- 0:00:08
900000 -- (-644.903) [-644.190] (-657.755) (-653.879) * (-663.255) (-655.099) (-648.351) [-643.665] -- 0:00:08
Average standard deviation of split frequencies: 0.007328
900500 -- (-651.108) (-652.383) (-649.617) [-650.061] * (-663.904) [-644.372] (-652.844) (-652.204) -- 0:00:08
901000 -- (-646.051) (-641.560) [-646.298] (-651.020) * [-650.297] (-665.445) (-644.651) (-656.338) -- 0:00:08
901500 -- (-656.716) (-646.046) (-655.623) [-643.991] * (-646.561) [-651.945] (-665.570) (-653.594) -- 0:00:08
902000 -- (-648.926) [-642.840] (-645.668) (-646.282) * [-649.002] (-649.741) (-645.734) (-653.936) -- 0:00:08
902500 -- [-642.771] (-643.382) (-645.825) (-662.090) * (-649.978) (-644.796) [-647.083] (-654.785) -- 0:00:08
903000 -- (-644.215) (-647.158) [-642.900] (-645.175) * (-644.701) (-648.424) [-649.899] (-645.215) -- 0:00:08
903500 -- (-648.258) [-645.515] (-644.505) (-647.639) * [-646.388] (-656.003) (-653.599) (-654.086) -- 0:00:08
904000 -- (-649.461) (-640.525) [-639.832] (-664.022) * (-650.545) [-651.452] (-647.768) (-656.830) -- 0:00:08
904500 -- (-655.517) [-639.228] (-649.952) (-645.654) * (-658.025) [-651.682] (-655.874) (-646.210) -- 0:00:08
905000 -- (-647.397) [-642.199] (-648.002) (-658.799) * [-644.044] (-651.155) (-652.923) (-651.317) -- 0:00:08
Average standard deviation of split frequencies: 0.007577
905500 -- (-647.733) (-643.522) [-646.370] (-654.311) * [-649.959] (-650.247) (-662.225) (-657.302) -- 0:00:08
906000 -- (-654.139) [-645.993] (-648.922) (-660.827) * (-650.195) [-648.238] (-646.820) (-663.074) -- 0:00:08
906500 -- (-658.023) [-636.493] (-647.268) (-652.557) * (-663.887) [-646.005] (-650.394) (-650.078) -- 0:00:08
907000 -- (-659.414) [-638.846] (-651.360) (-647.459) * (-661.528) (-650.753) [-644.189] (-645.461) -- 0:00:08
907500 -- (-654.950) [-641.927] (-657.184) (-655.588) * (-656.708) (-645.336) (-653.052) [-639.096] -- 0:00:08
908000 -- (-642.923) (-647.319) (-668.834) [-649.816] * (-660.122) (-645.184) (-652.234) [-649.564] -- 0:00:08
908500 -- (-662.680) [-644.833] (-654.093) (-645.325) * (-658.583) (-651.397) [-644.154] (-642.368) -- 0:00:08
909000 -- (-648.525) [-642.950] (-655.971) (-666.266) * (-654.671) [-638.527] (-645.814) (-651.462) -- 0:00:08
909500 -- (-648.212) [-642.260] (-653.537) (-646.101) * (-645.422) [-648.246] (-650.226) (-654.570) -- 0:00:07
910000 -- (-639.081) [-650.901] (-653.264) (-648.339) * (-660.485) [-658.257] (-638.949) (-655.860) -- 0:00:07
Average standard deviation of split frequencies: 0.007732
910500 -- [-646.027] (-651.918) (-646.262) (-652.169) * (-645.174) (-645.547) (-658.448) [-650.038] -- 0:00:07
911000 -- (-647.412) (-657.626) [-641.019] (-660.979) * (-656.957) (-644.163) [-644.213] (-653.390) -- 0:00:07
911500 -- (-658.289) [-642.516] (-646.531) (-660.089) * (-646.910) (-647.437) (-654.378) [-638.795] -- 0:00:07
912000 -- (-656.818) (-646.789) [-644.518] (-651.198) * (-649.129) [-642.952] (-644.729) (-651.365) -- 0:00:07
912500 -- (-643.533) [-643.115] (-659.267) (-651.563) * (-660.089) (-643.508) [-644.975] (-651.542) -- 0:00:07
913000 -- (-645.042) [-645.468] (-651.439) (-648.146) * (-659.021) (-636.592) (-653.638) [-637.309] -- 0:00:07
913500 -- (-645.134) [-641.837] (-649.193) (-655.163) * (-646.048) [-644.347] (-645.073) (-649.409) -- 0:00:07
914000 -- (-653.102) (-653.433) [-642.147] (-646.685) * [-645.983] (-643.679) (-645.752) (-660.954) -- 0:00:07
914500 -- (-651.627) (-644.561) [-643.463] (-657.433) * [-642.630] (-652.223) (-650.660) (-650.632) -- 0:00:07
915000 -- (-646.040) (-647.506) [-643.063] (-655.766) * (-647.014) [-652.039] (-651.607) (-658.019) -- 0:00:07
Average standard deviation of split frequencies: 0.008022
915500 -- (-660.860) (-654.541) (-646.208) [-642.798] * (-662.143) (-656.553) [-645.131] (-649.329) -- 0:00:07
916000 -- (-659.292) (-659.017) (-642.610) [-646.033] * (-661.231) (-652.306) [-649.587] (-649.918) -- 0:00:07
916500 -- (-652.709) [-648.617] (-650.009) (-650.281) * (-650.758) (-644.347) [-653.388] (-652.070) -- 0:00:07
917000 -- (-648.777) (-657.472) (-644.890) [-641.640] * (-647.534) (-647.340) [-647.685] (-653.865) -- 0:00:07
917500 -- [-645.315] (-654.115) (-653.557) (-646.400) * (-649.307) [-642.939] (-649.018) (-651.680) -- 0:00:07
918000 -- (-650.497) (-657.504) (-640.825) [-656.186] * (-648.219) [-643.080] (-652.843) (-645.925) -- 0:00:07
918500 -- [-644.575] (-660.568) (-639.062) (-650.437) * [-645.558] (-644.646) (-665.402) (-657.914) -- 0:00:07
919000 -- [-647.568] (-648.306) (-643.447) (-646.505) * (-641.654) (-659.528) (-658.877) [-651.679] -- 0:00:07
919500 -- (-660.734) (-644.650) [-647.097] (-653.107) * [-649.213] (-644.037) (-650.000) (-649.958) -- 0:00:07
920000 -- (-643.928) (-660.098) [-637.029] (-659.225) * (-647.620) (-644.084) (-641.722) [-642.053] -- 0:00:07
Average standard deviation of split frequencies: 0.008373
920500 -- (-647.691) (-653.134) [-653.373] (-651.544) * (-661.854) (-642.327) (-655.470) [-645.818] -- 0:00:06
921000 -- (-649.713) [-652.725] (-660.754) (-648.762) * (-645.266) [-638.840] (-658.695) (-657.220) -- 0:00:06
921500 -- [-646.230] (-651.364) (-648.001) (-647.801) * (-647.391) (-641.890) [-639.393] (-653.443) -- 0:00:06
922000 -- (-640.961) [-642.753] (-652.764) (-658.534) * [-645.304] (-650.179) (-660.640) (-664.004) -- 0:00:06
922500 -- [-641.631] (-653.281) (-644.902) (-652.307) * (-653.425) (-648.845) [-648.861] (-643.651) -- 0:00:06
923000 -- (-650.002) (-649.126) [-640.026] (-653.025) * (-650.224) [-645.035] (-646.248) (-644.650) -- 0:00:06
923500 -- (-649.574) (-644.669) (-643.022) [-650.878] * (-648.216) [-640.420] (-645.135) (-645.886) -- 0:00:06
924000 -- (-652.398) (-646.619) (-649.719) [-640.230] * [-644.379] (-646.159) (-648.097) (-645.284) -- 0:00:06
924500 -- (-657.237) [-640.050] (-665.137) (-662.641) * (-649.235) [-643.624] (-651.285) (-644.759) -- 0:00:06
925000 -- (-652.986) [-646.434] (-659.471) (-658.659) * (-661.257) (-639.707) (-644.350) [-645.697] -- 0:00:06
Average standard deviation of split frequencies: 0.008594
925500 -- (-662.815) (-653.068) (-646.976) [-652.558] * (-647.098) (-655.113) (-646.967) [-641.096] -- 0:00:06
926000 -- (-653.491) (-655.963) (-655.144) [-649.719] * [-644.726] (-660.014) (-642.703) (-649.996) -- 0:00:06
926500 -- [-645.485] (-643.558) (-664.956) (-655.851) * [-638.096] (-654.054) (-644.766) (-646.904) -- 0:00:06
927000 -- (-650.258) [-650.245] (-650.842) (-643.313) * [-642.043] (-646.057) (-660.855) (-654.106) -- 0:00:06
927500 -- (-650.508) (-646.325) (-650.054) [-647.039] * [-639.391] (-649.298) (-646.240) (-646.734) -- 0:00:06
928000 -- (-652.692) (-654.823) (-647.655) [-648.567] * [-634.919] (-652.635) (-642.565) (-656.303) -- 0:00:06
928500 -- (-654.695) (-663.364) (-652.901) [-648.633] * [-641.076] (-649.903) (-645.184) (-653.666) -- 0:00:06
929000 -- (-645.833) (-644.829) (-646.210) [-643.989] * (-654.372) [-638.164] (-657.943) (-664.134) -- 0:00:06
929500 -- (-658.054) (-642.311) (-654.099) [-646.384] * [-637.082] (-649.964) (-651.644) (-659.396) -- 0:00:06
930000 -- (-644.026) (-655.847) [-648.509] (-652.257) * (-646.335) [-644.464] (-650.065) (-647.619) -- 0:00:06
Average standard deviation of split frequencies: 0.008224
930500 -- (-647.275) (-650.769) (-644.793) [-654.695] * [-646.549] (-644.291) (-649.758) (-656.044) -- 0:00:06
931000 -- (-644.422) [-651.885] (-641.958) (-645.515) * (-652.094) (-648.105) (-653.901) [-643.336] -- 0:00:06
931500 -- [-642.533] (-644.532) (-659.687) (-649.495) * (-656.126) (-651.268) (-661.715) [-645.817] -- 0:00:06
932000 -- (-639.850) (-660.710) (-660.213) [-644.414] * (-646.818) (-656.470) [-641.892] (-647.916) -- 0:00:05
932500 -- (-639.489) (-659.161) (-656.066) [-641.160] * (-656.045) [-643.814] (-649.554) (-650.331) -- 0:00:05
933000 -- [-640.096] (-644.027) (-643.973) (-651.267) * (-646.654) (-648.366) (-652.184) [-647.070] -- 0:00:05
933500 -- (-638.463) [-641.069] (-658.482) (-656.140) * [-640.745] (-650.437) (-655.602) (-649.401) -- 0:00:05
934000 -- (-641.388) (-654.386) [-651.647] (-643.954) * [-643.844] (-658.343) (-643.409) (-659.074) -- 0:00:05
934500 -- [-640.080] (-656.792) (-650.277) (-654.779) * (-652.458) [-644.697] (-648.837) (-666.018) -- 0:00:05
935000 -- (-660.443) [-642.157] (-655.267) (-653.605) * [-640.573] (-661.372) (-642.772) (-643.354) -- 0:00:05
Average standard deviation of split frequencies: 0.008414
935500 -- [-642.366] (-650.671) (-662.126) (-655.770) * (-648.035) (-654.653) (-648.874) [-642.807] -- 0:00:05
936000 -- (-643.191) (-645.951) (-652.646) [-652.287] * (-641.755) (-659.429) [-644.766] (-645.935) -- 0:00:05
936500 -- [-642.785] (-650.173) (-652.708) (-655.425) * (-644.277) (-649.020) (-643.179) [-642.899] -- 0:00:05
937000 -- (-660.512) (-642.240) (-651.450) [-644.675] * [-643.557] (-647.833) (-648.560) (-653.846) -- 0:00:05
937500 -- (-648.047) (-652.207) (-658.844) [-647.923] * [-644.362] (-651.284) (-639.766) (-657.499) -- 0:00:05
938000 -- (-656.599) [-640.546] (-650.062) (-652.729) * (-649.796) (-652.877) (-645.521) [-644.582] -- 0:00:05
938500 -- (-651.119) [-647.193] (-644.417) (-648.198) * [-641.603] (-663.620) (-654.120) (-645.982) -- 0:00:05
939000 -- [-640.708] (-645.193) (-649.753) (-641.544) * [-639.617] (-646.930) (-647.575) (-651.841) -- 0:00:05
939500 -- (-651.206) (-645.352) [-644.121] (-655.470) * [-644.656] (-661.866) (-650.485) (-657.099) -- 0:00:05
940000 -- (-652.126) [-654.889] (-645.661) (-649.168) * (-655.313) (-649.000) [-643.605] (-652.735) -- 0:00:05
Average standard deviation of split frequencies: 0.008077
940500 -- (-656.454) (-652.538) (-652.249) [-641.495] * [-645.591] (-662.456) (-645.540) (-656.884) -- 0:00:05
941000 -- (-646.209) [-647.364] (-661.399) (-657.185) * (-647.701) (-646.193) [-644.794] (-652.600) -- 0:00:05
941500 -- [-642.617] (-648.399) (-655.350) (-657.408) * (-650.859) (-651.198) [-644.554] (-658.930) -- 0:00:05
942000 -- [-646.946] (-656.087) (-642.471) (-657.325) * (-655.933) (-655.159) [-650.289] (-647.791) -- 0:00:05
942500 -- (-651.241) (-652.773) [-644.256] (-649.296) * (-650.251) (-649.083) [-645.779] (-647.883) -- 0:00:05
943000 -- (-650.607) (-657.433) (-660.987) [-648.488] * (-662.005) (-658.146) [-649.077] (-659.145) -- 0:00:05
943500 -- (-656.939) (-656.569) (-656.682) [-637.528] * (-657.266) (-652.754) [-647.497] (-661.129) -- 0:00:04
944000 -- (-660.427) (-649.894) (-658.841) [-644.904] * (-645.291) [-641.954] (-657.278) (-654.635) -- 0:00:04
944500 -- (-660.165) (-652.687) [-648.773] (-644.818) * [-648.633] (-653.907) (-656.772) (-652.318) -- 0:00:04
945000 -- [-647.542] (-652.129) (-666.440) (-658.674) * (-643.538) [-652.420] (-656.880) (-646.950) -- 0:00:04
Average standard deviation of split frequencies: 0.008090
945500 -- (-648.126) (-657.062) [-650.307] (-649.844) * (-642.546) [-649.689] (-659.448) (-650.522) -- 0:00:04
946000 -- [-645.907] (-642.581) (-665.247) (-649.686) * (-655.592) (-649.484) (-660.209) [-644.227] -- 0:00:04
946500 -- [-645.864] (-659.565) (-662.486) (-649.393) * (-656.091) [-647.533] (-646.554) (-652.778) -- 0:00:04
947000 -- (-650.630) (-653.445) (-654.429) [-645.841] * (-648.506) [-644.435] (-644.396) (-662.204) -- 0:00:04
947500 -- [-664.906] (-645.480) (-657.171) (-647.578) * (-655.702) (-642.439) [-651.219] (-651.434) -- 0:00:04
948000 -- [-650.529] (-659.253) (-654.475) (-649.189) * [-649.286] (-656.323) (-643.661) (-660.844) -- 0:00:04
948500 -- (-660.256) [-645.990] (-653.574) (-649.831) * (-651.184) (-647.327) (-648.229) [-644.184] -- 0:00:04
949000 -- (-643.294) [-641.537] (-646.584) (-661.442) * (-646.129) (-647.092) (-657.022) [-641.201] -- 0:00:04
949500 -- (-649.390) [-641.201] (-649.842) (-642.206) * (-641.424) (-653.589) (-656.342) [-644.414] -- 0:00:04
950000 -- (-653.991) (-646.542) [-645.571] (-657.112) * [-648.227] (-662.671) (-662.835) (-642.701) -- 0:00:04
Average standard deviation of split frequencies: 0.008051
950500 -- (-662.896) (-650.983) [-643.207] (-649.013) * (-655.407) (-652.213) [-650.715] (-642.187) -- 0:00:04
951000 -- (-650.468) (-646.207) [-642.118] (-646.841) * (-655.326) (-645.309) [-655.235] (-643.098) -- 0:00:04
951500 -- (-654.366) (-664.744) [-640.772] (-653.529) * [-648.637] (-646.808) (-653.785) (-659.365) -- 0:00:04
952000 -- (-656.845) (-654.374) (-642.897) [-651.657] * (-648.714) [-644.083] (-653.717) (-652.950) -- 0:00:04
952500 -- (-653.378) (-651.657) [-639.180] (-653.812) * (-649.295) [-642.448] (-656.705) (-657.780) -- 0:00:04
953000 -- (-653.664) (-649.020) [-642.098] (-643.098) * [-644.094] (-651.099) (-649.339) (-652.133) -- 0:00:04
953500 -- (-650.345) (-642.569) [-652.947] (-644.822) * (-651.321) (-657.239) [-642.817] (-656.240) -- 0:00:04
954000 -- (-649.038) (-648.049) (-647.572) [-641.756] * [-647.849] (-656.930) (-659.536) (-648.659) -- 0:00:04
954500 -- (-645.364) (-643.940) (-642.463) [-643.800] * (-648.828) (-648.389) [-642.604] (-653.461) -- 0:00:04
955000 -- (-654.010) (-648.670) [-656.252] (-648.161) * (-653.538) (-645.697) [-639.844] (-651.293) -- 0:00:03
Average standard deviation of split frequencies: 0.008441
955500 -- [-654.958] (-651.736) (-667.031) (-644.139) * [-653.263] (-657.067) (-648.664) (-651.664) -- 0:00:03
956000 -- (-653.533) (-643.123) (-656.809) [-647.833] * (-654.184) (-657.616) (-647.311) [-650.766] -- 0:00:03
956500 -- (-660.745) (-645.889) (-656.899) [-640.215] * (-645.853) (-660.132) [-647.135] (-651.396) -- 0:00:03
957000 -- [-647.278] (-654.554) (-648.541) (-641.072) * [-647.127] (-657.583) (-652.221) (-646.395) -- 0:00:03
957500 -- (-643.762) (-645.346) (-654.175) [-635.225] * (-655.913) [-647.728] (-650.874) (-649.681) -- 0:00:03
958000 -- (-654.082) (-657.529) (-644.184) [-639.437] * [-639.431] (-656.066) (-673.703) (-654.960) -- 0:00:03
958500 -- (-645.269) (-662.283) (-657.403) [-639.085] * [-646.060] (-649.702) (-651.235) (-647.559) -- 0:00:03
959000 -- (-642.771) (-657.744) [-649.273] (-638.061) * (-641.058) (-661.953) (-658.265) [-645.779] -- 0:00:03
959500 -- (-648.905) (-655.136) (-644.363) [-638.988] * [-646.046] (-647.444) (-665.803) (-651.616) -- 0:00:03
960000 -- (-647.829) [-641.580] (-656.607) (-650.179) * (-645.170) (-651.485) (-653.291) [-654.742] -- 0:00:03
Average standard deviation of split frequencies: 0.008862
960500 -- (-639.525) [-647.596] (-647.392) (-640.025) * (-645.064) [-663.384] (-654.275) (-656.197) -- 0:00:03
961000 -- (-641.057) (-657.046) [-650.004] (-648.657) * [-645.304] (-652.107) (-652.821) (-647.802) -- 0:00:03
961500 -- (-656.942) [-643.349] (-651.216) (-640.105) * [-648.535] (-649.462) (-650.722) (-644.733) -- 0:00:03
962000 -- (-656.698) (-648.685) (-648.251) [-647.567] * [-645.763] (-659.132) (-652.470) (-643.676) -- 0:00:03
962500 -- (-649.516) [-645.926] (-651.432) (-640.823) * (-646.152) (-666.434) [-649.521] (-644.071) -- 0:00:03
963000 -- (-647.700) (-650.175) (-650.489) [-639.092] * (-641.405) (-654.270) [-653.295] (-651.433) -- 0:00:03
963500 -- (-646.622) [-642.962] (-652.176) (-641.132) * (-651.738) [-650.380] (-648.988) (-646.370) -- 0:00:03
964000 -- (-644.961) [-641.535] (-652.442) (-645.577) * (-662.346) [-642.847] (-651.393) (-641.269) -- 0:00:03
964500 -- [-655.998] (-652.614) (-642.124) (-651.962) * (-646.506) (-642.201) [-643.800] (-655.321) -- 0:00:03
965000 -- (-647.487) (-653.794) [-639.247] (-640.545) * (-647.613) (-650.087) [-648.382] (-654.249) -- 0:00:03
Average standard deviation of split frequencies: 0.008755
965500 -- (-661.242) (-655.042) [-639.489] (-641.822) * (-650.773) (-643.430) [-643.128] (-662.416) -- 0:00:03
966000 -- (-647.591) (-650.447) [-638.231] (-654.086) * (-649.022) (-649.156) [-637.757] (-648.591) -- 0:00:02
966500 -- [-644.632] (-656.173) (-647.002) (-652.979) * [-645.166] (-656.134) (-646.972) (-659.802) -- 0:00:02
967000 -- [-648.370] (-662.542) (-653.811) (-658.719) * [-650.276] (-651.297) (-654.988) (-648.456) -- 0:00:02
967500 -- (-655.171) (-645.368) (-659.637) [-641.489] * [-645.907] (-655.646) (-641.086) (-661.135) -- 0:00:02
968000 -- (-648.186) (-660.275) [-640.835] (-655.358) * (-650.969) (-655.296) (-641.387) [-649.669] -- 0:00:02
968500 -- (-652.389) (-653.083) [-640.208] (-651.118) * (-651.484) (-656.181) [-641.530] (-640.870) -- 0:00:02
969000 -- (-642.498) (-655.162) (-640.509) [-642.695] * (-645.116) (-665.312) (-642.795) [-650.286] -- 0:00:02
969500 -- (-650.722) (-654.302) [-644.301] (-643.262) * (-652.777) (-652.532) (-656.304) [-652.402] -- 0:00:02
970000 -- (-666.186) (-659.531) (-646.845) [-647.967] * [-640.652] (-643.791) (-653.587) (-658.398) -- 0:00:02
Average standard deviation of split frequencies: 0.008656
970500 -- (-656.580) (-663.306) (-649.104) [-643.526] * (-651.796) [-643.029] (-656.840) (-657.012) -- 0:00:02
971000 -- (-654.226) (-658.651) (-662.942) [-645.996] * (-655.706) (-660.327) [-648.917] (-655.241) -- 0:00:02
971500 -- (-641.816) (-638.081) [-651.337] (-659.552) * (-647.176) [-643.429] (-641.807) (-652.419) -- 0:00:02
972000 -- [-650.966] (-653.529) (-654.703) (-645.607) * (-646.784) [-645.174] (-649.679) (-649.981) -- 0:00:02
972500 -- (-656.715) (-646.192) (-654.986) [-646.419] * (-649.588) (-645.856) [-658.381] (-652.017) -- 0:00:02
973000 -- (-657.779) (-649.751) (-652.018) [-641.503] * (-642.638) (-658.119) [-638.946] (-650.458) -- 0:00:02
973500 -- (-662.355) [-644.663] (-651.991) (-645.332) * (-646.551) (-652.221) (-651.805) [-645.159] -- 0:00:02
974000 -- (-657.093) (-654.171) [-650.987] (-641.573) * (-656.502) [-650.945] (-649.212) (-641.065) -- 0:00:02
974500 -- (-652.157) [-640.925] (-649.222) (-650.103) * (-641.641) [-639.881] (-666.899) (-645.014) -- 0:00:02
975000 -- (-656.199) [-645.752] (-642.672) (-650.826) * (-645.106) (-648.122) (-648.033) [-642.490] -- 0:00:02
Average standard deviation of split frequencies: 0.008543
975500 -- (-664.358) [-636.118] (-641.821) (-652.957) * (-643.190) (-643.629) (-646.122) [-642.233] -- 0:00:02
976000 -- (-652.441) [-641.899] (-644.802) (-663.618) * [-647.365] (-641.113) (-656.439) (-645.031) -- 0:00:02
976500 -- (-653.036) (-637.340) [-641.876] (-651.298) * [-652.564] (-648.548) (-648.835) (-656.800) -- 0:00:02
977000 -- (-650.131) [-644.076] (-656.154) (-645.118) * (-653.765) (-647.073) [-642.791] (-650.107) -- 0:00:02
977500 -- [-643.578] (-643.108) (-642.508) (-654.374) * (-657.404) (-650.129) [-644.592] (-639.168) -- 0:00:01
978000 -- (-651.652) (-645.006) [-649.149] (-656.749) * (-650.935) (-655.700) [-639.827] (-644.655) -- 0:00:01
978500 -- (-653.770) (-644.744) [-642.305] (-654.966) * (-649.799) [-644.878] (-654.687) (-642.675) -- 0:00:01
979000 -- (-648.478) (-642.501) (-653.459) [-650.275] * [-643.514] (-663.036) (-646.940) (-644.306) -- 0:00:01
979500 -- (-641.242) [-648.382] (-647.507) (-648.505) * (-645.800) (-666.724) (-650.436) [-650.955] -- 0:00:01
980000 -- (-645.251) (-645.332) [-648.614] (-657.918) * (-641.446) (-662.763) (-651.381) [-644.409] -- 0:00:01
Average standard deviation of split frequencies: 0.009105
980500 -- (-648.265) [-637.296] (-640.288) (-652.050) * [-642.848] (-655.989) (-648.639) (-649.868) -- 0:00:01
981000 -- (-651.749) (-655.532) [-638.951] (-646.433) * (-646.743) [-645.444] (-655.278) (-645.605) -- 0:00:01
981500 -- (-646.483) [-640.422] (-637.366) (-654.661) * (-653.027) [-642.499] (-656.382) (-647.227) -- 0:00:01
982000 -- [-640.869] (-657.640) (-653.445) (-653.271) * (-657.421) (-642.755) [-648.245] (-646.234) -- 0:00:01
982500 -- (-648.508) (-654.763) [-645.127] (-655.654) * (-656.300) (-644.488) [-639.149] (-645.363) -- 0:00:01
983000 -- [-646.959] (-651.724) (-652.560) (-644.862) * (-647.048) [-639.390] (-639.495) (-655.645) -- 0:00:01
983500 -- (-646.766) (-638.398) (-646.543) [-647.634] * (-655.871) (-640.507) (-643.936) [-652.995] -- 0:00:01
984000 -- (-648.471) (-636.871) [-651.239] (-652.118) * [-665.763] (-649.009) (-651.563) (-656.343) -- 0:00:01
984500 -- (-662.281) [-647.435] (-645.379) (-647.880) * (-659.070) (-645.768) (-646.485) [-642.142] -- 0:00:01
985000 -- (-647.656) [-650.635] (-654.055) (-651.408) * [-644.225] (-652.921) (-647.315) (-646.656) -- 0:00:01
Average standard deviation of split frequencies: 0.009056
985500 -- (-648.404) (-644.564) (-650.003) [-645.179] * (-647.993) (-653.159) [-642.733] (-645.738) -- 0:00:01
986000 -- (-650.971) [-643.594] (-653.903) (-643.108) * (-653.066) [-646.849] (-656.305) (-649.131) -- 0:00:01
986500 -- (-649.926) [-643.893] (-658.616) (-642.210) * [-645.581] (-661.837) (-651.825) (-644.273) -- 0:00:01
987000 -- [-644.304] (-646.140) (-655.572) (-664.141) * (-653.697) (-648.894) [-640.742] (-648.766) -- 0:00:01
987500 -- (-647.114) [-650.249] (-659.133) (-645.488) * (-649.127) (-657.367) (-651.931) [-642.843] -- 0:00:01
988000 -- (-646.083) (-650.421) [-646.778] (-648.927) * (-635.352) [-644.560] (-640.620) (-649.677) -- 0:00:01
988500 -- (-649.346) [-646.658] (-654.511) (-650.589) * [-640.901] (-652.714) (-659.838) (-638.684) -- 0:00:01
989000 -- (-659.602) (-641.104) (-651.144) [-642.920] * [-647.439] (-644.262) (-662.586) (-654.539) -- 0:00:00
989500 -- (-650.097) (-647.965) [-643.902] (-644.020) * [-652.611] (-654.833) (-655.134) (-665.039) -- 0:00:00
990000 -- (-642.752) (-646.585) [-659.650] (-642.540) * [-640.593] (-644.907) (-655.831) (-643.996) -- 0:00:00
Average standard deviation of split frequencies: 0.008873
990500 -- (-645.053) [-645.379] (-645.895) (-644.213) * (-641.544) (-661.261) (-665.859) [-639.709] -- 0:00:00
991000 -- (-639.927) [-643.346] (-655.633) (-660.065) * [-639.500] (-651.497) (-649.001) (-656.029) -- 0:00:00
991500 -- (-646.215) [-643.963] (-645.587) (-656.623) * (-647.217) [-649.608] (-640.835) (-671.489) -- 0:00:00
992000 -- (-652.044) [-647.783] (-644.828) (-661.990) * [-647.115] (-660.049) (-644.579) (-650.221) -- 0:00:00
992500 -- (-665.368) (-640.812) [-644.134] (-645.749) * (-647.480) [-654.381] (-655.288) (-662.176) -- 0:00:00
993000 -- (-661.296) [-645.810] (-649.712) (-654.754) * (-654.667) (-657.970) [-639.906] (-654.208) -- 0:00:00
993500 -- (-653.247) [-649.083] (-644.840) (-646.054) * (-656.566) (-667.228) [-640.381] (-652.438) -- 0:00:00
994000 -- (-647.904) (-659.022) [-649.795] (-650.899) * (-653.386) (-653.317) [-640.352] (-645.517) -- 0:00:00
994500 -- (-645.865) (-657.506) [-648.281] (-655.328) * (-662.592) (-656.656) (-652.508) [-649.081] -- 0:00:00
995000 -- [-665.125] (-659.606) (-649.520) (-654.818) * (-654.877) (-654.503) [-646.331] (-648.571) -- 0:00:00
Average standard deviation of split frequencies: 0.008904
995500 -- (-644.484) (-655.783) [-652.808] (-649.332) * (-645.065) (-647.628) (-658.306) [-639.291] -- 0:00:00
996000 -- (-641.949) (-654.568) (-646.955) [-641.971] * (-643.934) (-655.635) (-642.690) [-641.847] -- 0:00:00
996500 -- [-642.081] (-662.190) (-661.080) (-648.233) * [-647.910] (-665.416) (-647.856) (-656.917) -- 0:00:00
997000 -- (-648.294) (-660.915) (-656.933) [-641.428] * [-641.721] (-653.521) (-654.192) (-658.096) -- 0:00:00
997500 -- (-644.186) (-655.445) (-654.224) [-636.295] * (-641.986) (-659.675) (-658.413) [-647.431] -- 0:00:00
998000 -- (-653.720) (-657.386) (-660.553) [-640.716] * [-652.010] (-653.611) (-650.720) (-665.397) -- 0:00:00
998500 -- (-660.529) (-653.863) [-650.524] (-651.610) * [-641.155] (-652.458) (-661.143) (-648.393) -- 0:00:00
999000 -- (-647.536) [-656.044] (-653.444) (-660.103) * [-643.831] (-646.348) (-652.288) (-653.596) -- 0:00:00
999500 -- (-656.786) [-639.142] (-641.211) (-651.739) * [-637.374] (-640.963) (-653.230) (-649.358) -- 0:00:00
1000000 -- (-646.653) (-657.879) (-646.482) [-639.659] * [-640.643] (-650.387) (-647.516) (-647.230) -- 0:00:00
Average standard deviation of split frequencies: 0.009127
Analysis completed in 1 mins 28 seconds
Analysis used 86.48 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -632.93
Likelihood of best state for "cold" chain of run 2 was -632.95
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
73.3 % ( 72 %) Dirichlet(Revmat{all})
93.6 % ( 94 %) Slider(Revmat{all})
32.7 % ( 22 %) Dirichlet(Pi{all})
34.6 % ( 24 %) Slider(Pi{all})
66.4 % ( 33 %) Multiplier(Alpha{1,2})
71.6 % ( 36 %) Multiplier(Alpha{3})
60.0 % ( 33 %) Slider(Pinvar{all})
97.8 % ( 98 %) ExtSPR(Tau{all},V{all})
69.4 % ( 62 %) ExtTBR(Tau{all},V{all})
98.8 % ( 99 %) NNI(Tau{all},V{all})
88.3 % ( 83 %) ParsSPR(Tau{all},V{all})
27.9 % ( 33 %) Multiplier(V{all})
74.4 % ( 71 %) Nodeslider(V{all})
30.8 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.4 % ( 60 %) Dirichlet(Revmat{all})
93.5 % ( 88 %) Slider(Revmat{all})
32.7 % ( 33 %) Dirichlet(Pi{all})
33.8 % ( 26 %) Slider(Pi{all})
66.9 % ( 42 %) Multiplier(Alpha{1,2})
72.0 % ( 46 %) Multiplier(Alpha{3})
61.9 % ( 48 %) Slider(Pinvar{all})
97.9 % (100 %) ExtSPR(Tau{all},V{all})
69.4 % ( 70 %) ExtTBR(Tau{all},V{all})
98.9 % ( 99 %) NNI(Tau{all},V{all})
88.1 % ( 92 %) ParsSPR(Tau{all},V{all})
28.0 % ( 25 %) Multiplier(V{all})
74.5 % ( 60 %) Nodeslider(V{all})
30.7 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.68 0.41 0.22
2 | 165664 0.68 0.43
3 | 167437 166961 0.71
4 | 166940 166694 166304
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.68 0.40 0.22
2 | 166718 0.68 0.43
3 | 166121 166402 0.71
4 | 167658 166392 166709
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -642.18
| 2 2 1 1 2 |
| |
| 2 1 1* 221 2 |
| 2 2 1 1 2 1 21 2 2 1 |
| 22 2 2 1 1 211 2|
| 1 1 2 21 1 2 2 2 11 |
|2 1 1 2 1 2 11 2 1 1 |
|1 21 2 * 2 2 2 1 1 1 1 2 2 |
| 2 1 2 2 2 22 2 |
| * 1 2 1 2 2 2 2 1 2 11 1 11 2 |
| 1 1 2 1 1 212 1|
| 1 1 2 1 * 1 22 |
| 1 1 2 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -648.53
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -639.78 -659.96
2 -639.36 -658.68
--------------------------------------
TOTAL -639.55 -659.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.232238 0.035631 0.031846 0.609553 0.168808 612.89 616.52 1.001
r(A<->C){all} 0.202089 0.022208 0.000195 0.486710 0.170792 232.37 272.26 1.006
r(A<->G){all} 0.277474 0.024890 0.000172 0.556336 0.263084 122.77 166.76 1.000
r(A<->T){all} 0.116373 0.012302 0.000041 0.342777 0.084200 242.02 295.08 1.000
r(C<->G){all} 0.142913 0.013211 0.000070 0.370268 0.116326 286.39 299.76 1.001
r(C<->T){all} 0.090105 0.009840 0.000063 0.296572 0.056288 104.59 136.73 1.002
r(G<->T){all} 0.171046 0.016886 0.000207 0.426114 0.140117 216.85 247.42 1.000
pi(A){all} 0.205239 0.000375 0.166135 0.242999 0.204414 1100.58 1180.25 1.000
pi(C){all} 0.333475 0.000497 0.290846 0.377103 0.333876 753.93 942.62 1.000
pi(G){all} 0.287276 0.000463 0.246734 0.330320 0.287076 1094.81 1297.90 1.000
pi(T){all} 0.174011 0.000317 0.140267 0.209674 0.173585 1460.33 1480.67 1.000
alpha{1,2} 0.439794 0.166669 0.000186 1.260930 0.320970 913.09 1073.12 1.001
alpha{3} 0.462258 0.200749 0.000163 1.348461 0.324655 1394.12 1411.49 1.000
pinvar{all} 0.757327 0.045655 0.260221 0.968774 0.841182 284.85 306.45 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- ..****
9 -- ..*.*.
10 -- ..*..*
11 -- ...*.*
12 -- ...**.
13 -- .*.*..
14 -- .*.***
15 -- .*...*
16 -- .****.
17 -- .*..*.
18 -- ....**
19 -- ..**..
20 -- .**...
21 -- .***.*
22 -- ..*.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 466 0.155230 0.016017 0.143904 0.166556 2
8 458 0.152565 0.008480 0.146569 0.158561 2
9 447 0.148901 0.012719 0.139907 0.157895 2
10 440 0.146569 0.008480 0.140573 0.152565 2
11 439 0.146236 0.008951 0.139907 0.152565 2
12 432 0.143904 0.008480 0.137908 0.149900 2
13 430 0.143238 0.011306 0.135243 0.151233 2
14 430 0.143238 0.009422 0.136576 0.149900 2
15 429 0.142905 0.008951 0.136576 0.149234 2
16 423 0.140906 0.002355 0.139241 0.142572 2
17 418 0.139241 0.015075 0.128581 0.149900 2
18 415 0.138241 0.010835 0.130580 0.145903 2
19 400 0.133245 0.005653 0.129247 0.137242 2
20 397 0.132245 0.001413 0.131246 0.133245 2
21 394 0.131246 0.003769 0.128581 0.133911 2
22 282 0.093937 0.014133 0.083944 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.189868 0.026195 0.018481 0.507756 0.137256 1.000 2
length{all}[2] 0.005229 0.000057 0.000003 0.020091 0.002722 1.000 2
length{all}[3] 0.005325 0.000086 0.000000 0.019584 0.002598 1.000 2
length{all}[4] 0.005330 0.000069 0.000001 0.018135 0.002858 1.000 2
length{all}[5] 0.005348 0.000083 0.000001 0.018769 0.002732 1.002 2
length{all}[6] 0.005241 0.000064 0.000000 0.019213 0.002775 1.001 2
length{all}[7] 0.005369 0.000053 0.000008 0.017697 0.002951 0.998 2
length{all}[8] 0.004972 0.000045 0.000025 0.016477 0.003050 1.001 2
length{all}[9] 0.005270 0.000072 0.000002 0.018794 0.002735 1.000 2
length{all}[10] 0.005077 0.000079 0.000003 0.016692 0.002619 1.000 2
length{all}[11] 0.005678 0.000140 0.000006 0.018058 0.002774 0.999 2
length{all}[12] 0.005640 0.000087 0.000005 0.020121 0.002844 0.998 2
length{all}[13] 0.005342 0.000089 0.000007 0.017639 0.002700 0.999 2
length{all}[14] 0.005979 0.000107 0.000024 0.022656 0.002673 1.001 2
length{all}[15] 0.004931 0.000039 0.000002 0.018663 0.002798 0.998 2
length{all}[16] 0.005617 0.000074 0.000004 0.017479 0.003141 1.000 2
length{all}[17] 0.005304 0.000063 0.000009 0.016488 0.002901 1.002 2
length{all}[18] 0.004966 0.000045 0.000006 0.017160 0.002643 0.999 2
length{all}[19] 0.005783 0.000148 0.000004 0.018581 0.002627 0.998 2
length{all}[20] 0.005095 0.000069 0.000001 0.018010 0.002577 0.998 2
length{all}[21] 0.005625 0.000084 0.000006 0.018764 0.002604 1.002 2
length{all}[22] 0.005609 0.000051 0.000043 0.020700 0.003030 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009127
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|- C2 (2)
|
|- C3 (3)
+
|- C4 (4)
|
|- C5 (5)
|
\- C6 (6)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 492
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
144 ambiguity characters in seq. 1
72 ambiguity characters in seq. 2
72 ambiguity characters in seq. 3
72 ambiguity characters in seq. 4
72 ambiguity characters in seq. 5
72 ambiguity characters in seq. 6
48 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 116 / 116 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 116 / 116 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 6
0.035897 0.077493 0.099130 0.039440 0.032129 0.010030 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -551.774709
Iterating by ming2
Initial: fx= 551.774709
x= 0.03590 0.07749 0.09913 0.03944 0.03213 0.01003 0.30000 1.30000
1 h-m-p 0.0000 0.0001 338.7815 ++ 543.043732 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0001 466.1012 ++ 532.981028 m 0.0001 24 | 2/8
3 h-m-p 0.0032 0.4461 11.8700 ------------.. | 2/8
4 h-m-p 0.0000 0.0001 223.9379 ++ 529.843515 m 0.0001 56 | 3/8
5 h-m-p 0.0000 0.0001 553.7938 ++ 521.046391 m 0.0001 67 | 4/8
6 h-m-p 0.0026 0.4745 14.7939 ------------.. | 4/8
7 h-m-p 0.0000 0.0002 140.1542 +++ 517.581228 m 0.0002 100 | 5/8
8 h-m-p 0.0087 4.3561 7.8260 ++CYCCC 515.800086 4 0.1033 120 | 5/8
9 h-m-p 1.6000 8.0000 0.1240 CCYC 515.162555 3 1.6539 136 | 5/8
10 h-m-p 1.6000 8.0000 0.0381 CCC 515.160282 2 1.9081 154 | 5/8
11 h-m-p 1.6000 8.0000 0.0094 YC 515.159464 1 3.8674 169 | 5/8
12 h-m-p 1.6000 8.0000 0.0020 Y 515.159460 0 1.2365 183 | 5/8
13 h-m-p 1.6000 8.0000 0.0004 Y 515.159460 0 1.1307 197 | 5/8
14 h-m-p 1.6000 8.0000 0.0000 C 515.159460 0 1.6000 211 | 5/8
15 h-m-p 1.6000 8.0000 0.0000 Y 515.159460 0 1.6000 225 | 5/8
16 h-m-p 1.6000 8.0000 0.0000 -Y 515.159460 0 0.1000 240 | 5/8
17 h-m-p 0.0201 8.0000 0.0000 -------------.. | 5/8
18 h-m-p 0.0160 8.0000 0.0000 ------------- | 5/8
19 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -515.159460
316 lfun, 316 eigenQcodon, 1896 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 6
0.014562 0.011353 0.027322 0.109528 0.102550 0.059355 1.173166 0.823992 0.364824
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.109605
np = 9
lnL0 = -564.332300
Iterating by ming2
Initial: fx= 564.332300
x= 0.01456 0.01135 0.02732 0.10953 0.10255 0.05935 1.17317 0.82399 0.36482
1 h-m-p 0.0000 0.0001 756.3719 ++ 544.561710 m 0.0001 23 | 1/9
2 h-m-p 0.0000 0.0001 248.1142 ++ 537.377803 m 0.0001 44 | 2/9
3 h-m-p 0.0003 0.0023 79.9041 ++ 525.766713 m 0.0023 64 | 3/9
4 h-m-p 0.0001 0.0006 227.4754 ++ 515.246280 m 0.0006 83 | 4/9
5 h-m-p 0.0000 0.0000 3757.1318 ++ 514.316606 m 0.0000 101 | 5/9
6 h-m-p 0.0147 0.1001 1.7529 ++ 513.592383 m 0.1001 118 | 6/9
7 h-m-p 0.3214 5.8197 0.2010 +CYCCCC 513.234142 5 1.9630 144 | 6/9
8 h-m-p 0.2983 1.4916 0.4286 CCCCC 513.057305 4 0.3477 167 | 6/9
9 h-m-p 1.2454 8.0000 0.1197 CYC 512.992967 2 1.4185 185 | 6/9
10 h-m-p 1.6000 8.0000 0.0121 YCC 512.912423 2 2.5415 203 | 6/9
11 h-m-p 0.6153 8.0000 0.0498 +YC 512.894563 1 1.5495 220 | 6/9
12 h-m-p 1.6000 8.0000 0.0078 YC 512.894366 1 1.0968 236 | 6/9
13 h-m-p 1.6000 8.0000 0.0007 Y 512.894365 0 0.9781 251 | 6/9
14 h-m-p 1.6000 8.0000 0.0000 C 512.894365 0 1.6000 266 | 6/9
15 h-m-p 1.6000 8.0000 0.0000 C 512.894365 0 0.4000 281 | 6/9
16 h-m-p 0.5314 8.0000 0.0000 -C 512.894365 0 0.0332 297 | 6/9
17 h-m-p 0.0160 8.0000 0.0000 --C 512.894365 0 0.0003 314
Out..
lnL = -512.894365
315 lfun, 945 eigenQcodon, 3780 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 6
0.034293 0.081885 0.014372 0.073827 0.073723 0.084814 0.946531 0.969222 0.588043 0.200187 1.598662
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.767343
np = 11
lnL0 = -555.815035
Iterating by ming2
Initial: fx= 555.815035
x= 0.03429 0.08188 0.01437 0.07383 0.07372 0.08481 0.94653 0.96922 0.58804 0.20019 1.59866
1 h-m-p 0.0000 0.0001 342.6419 ++ 543.542952 m 0.0001 27 | 1/11
2 h-m-p 0.0001 0.0003 388.8953 ++ 516.859197 m 0.0003 52 | 2/11
3 h-m-p 0.0000 0.0000 36.9808 ++ 516.816476 m 0.0000 76 | 3/11
4 h-m-p 0.0000 0.0003 84.9141 +++ 515.013614 m 0.0003 100 | 4/11
5 h-m-p 0.0001 0.0003 55.1403 ++ 514.610753 m 0.0003 122 | 5/11
6 h-m-p 0.0160 8.0000 1.8569 ++++YC 512.081169 1 3.4522 148 | 5/11
7 h-m-p 0.3971 1.9856 2.4722 ++ 509.812187 m 1.9856 168 | 5/11
8 h-m-p 0.0000 0.0000 5.9040
h-m-p: 0.00000000e+00 0.00000000e+00 5.90399094e+00 509.812187
.. | 5/11
9 h-m-p 0.0000 0.0074 21.2189 +++YCCCC 509.333119 4 0.0019 215 | 5/11
10 h-m-p 0.0589 8.0000 0.6874 ++CCC 509.129947 2 0.8730 241 | 5/11
11 h-m-p 0.8943 8.0000 0.6710 ++ 508.329594 m 8.0000 261 | 5/11
12 h-m-p 0.5275 8.0000 10.1755 YCCCC 505.809933 4 1.1983 288 | 5/11
13 h-m-p 1.6000 8.0000 5.5538 YCCC 504.439491 3 0.8821 313 | 5/11
14 h-m-p 0.5664 8.0000 8.6492 +YCYCC 502.090645 4 3.9062 340 | 5/11
15 h-m-p 1.6000 8.0000 8.9875 YCC 500.767669 2 3.0071 363 | 5/11
16 h-m-p 1.2219 8.0000 22.1181 +YCCC 499.199453 3 3.4394 389 | 5/11
17 h-m-p 1.3181 6.5903 37.4389 CCCC 498.305147 3 1.6436 415 | 5/11
18 h-m-p 0.7597 3.7985 48.8691 ++ 496.989592 m 3.7985 435 | 6/11
19 h-m-p 0.0594 0.2972 75.5620 ++ 496.937564 m 0.2972 455 | 6/11
20 h-m-p 0.0000 0.0000 51.6460
h-m-p: 1.38412284e-17 6.92061422e-17 5.16460401e+01 496.937564
.. | 6/11
21 h-m-p 0.0014 0.6980 0.7719 ++YC 496.921829 1 0.0504 493 | 6/11
22 h-m-p 0.0478 3.5595 0.8142 +CCC 496.889475 2 0.1861 517 | 6/11
23 h-m-p 1.6000 8.0000 0.0124 C 496.889429 0 0.3802 536 | 6/11
24 h-m-p 1.1030 8.0000 0.0043 Y 496.889408 0 0.8496 555 | 6/11
25 h-m-p 0.9638 8.0000 0.0038 ++ 496.889323 m 8.0000 574 | 6/11
26 h-m-p 0.0470 8.0000 0.6391 +++YC 496.887619 1 1.9694 597 | 6/11
27 h-m-p 1.6000 8.0000 0.4647 ++ 496.876585 m 8.0000 616 | 6/11
28 h-m-p 0.0162 0.8057 229.2786 ++CYYCYYCCCC 496.409250 9 0.6422 652 | 6/11
29 h-m-p 0.0443 0.2216 91.4696 CY 496.402830 1 0.0425 673 | 6/11
30 h-m-p 0.0264 0.1322 20.1115 ++ 496.329395 m 0.1322 692 | 7/11
31 h-m-p 0.0882 8.0000 30.1552 +CCCCC 496.058260 4 0.5120 720 | 7/11
32 h-m-p 1.6000 8.0000 4.6249 CCCC 495.762619 3 0.5262 744 | 7/11
33 h-m-p 0.2492 8.0000 9.7655 +YCCC 495.672159 3 0.7628 768 | 7/11
34 h-m-p 1.6000 8.0000 1.0365 YYCC 495.642243 3 2.2953 790 | 7/11
35 h-m-p 1.6000 8.0000 0.3659 ++ 495.630322 m 8.0000 808 | 7/11
36 h-m-p 1.6000 8.0000 0.9573 YCC 495.624492 2 0.6828 829 | 7/11
37 h-m-p 1.6000 8.0000 0.3473 CY 495.624029 1 1.8382 849 | 7/11
38 h-m-p 1.6000 8.0000 0.2404 YC 495.623958 1 2.5629 868 | 7/11
39 h-m-p 1.6000 8.0000 0.2976 ++ 495.623298 m 8.0000 886 | 7/11
40 h-m-p 0.0278 4.3415 85.5468 +++YCCC 495.598678 3 2.5538 912 | 7/11
41 h-m-p 1.3173 6.5863 23.2204 CCCC 495.589388 3 2.3801 936 | 7/11
42 h-m-p 0.7238 3.6192 26.9859 +YC 495.585146 1 2.2881 956 | 7/11
43 h-m-p 0.4206 2.1029 17.0814 YC 495.584888 1 1.0373 975 | 7/11
44 h-m-p 0.6006 3.0031 6.0608 +Y 495.584856 0 1.9884 994 | 7/11
45 h-m-p 1.6000 8.0000 0.0198 Y 495.584856 0 1.1442 1012 | 7/11
46 h-m-p 1.0691 8.0000 0.0212 C 495.584856 0 1.0113 1030 | 7/11
47 h-m-p 1.6000 8.0000 0.0003 Y 495.584856 0 1.1913 1048 | 6/11
48 h-m-p 0.0160 8.0000 16.7001 ++YC 495.584658 1 0.4401 1069 | 6/11
49 h-m-p 1.6000 8.0000 0.1564 +YC 495.583694 1 4.0802 1090 | 6/11
50 h-m-p 0.0473 0.9592 13.4985 +++ 495.582930 m 0.9592 1110 | 7/11
51 h-m-p 0.9648 8.0000 0.1353 +CYC 495.580990 2 5.2613 1134 | 7/11
52 h-m-p 0.9131 4.5654 0.0578 YC 495.580892 1 0.1274 1153 | 7/11
53 h-m-p 0.0339 8.0000 0.2174 ++YC 495.580462 1 1.1942 1174 | 7/11
54 h-m-p 1.4886 8.0000 0.1744 Y 495.580256 0 1.1878 1192 | 7/11
55 h-m-p 0.9014 8.0000 0.2299 CCC 495.579960 2 1.5892 1214 | 7/11
56 h-m-p 1.6000 8.0000 0.1787 YC 495.579758 1 0.6325 1233 | 7/11
57 h-m-p 0.3850 8.0000 0.2935 +YC 495.579548 1 1.5400 1253 | 7/11
58 h-m-p 1.6000 8.0000 0.1990 YC 495.579386 1 2.8875 1272 | 7/11
59 h-m-p 1.6000 8.0000 0.1581 CC 495.579262 1 2.1785 1292 | 7/11
60 h-m-p 0.8825 8.0000 0.3902 Y 495.579239 0 0.5935 1310 | 7/11
61 h-m-p 0.5555 8.0000 0.4169 +Y 495.579174 0 1.8474 1329 | 7/11
62 h-m-p 1.6000 8.0000 0.1580 C 495.579141 0 2.0619 1347 | 7/11
63 h-m-p 0.6553 8.0000 0.4971 Y 495.579125 0 1.0546 1365 | 7/11
64 h-m-p 1.4582 8.0000 0.3595 Y 495.579111 0 2.7079 1383 | 7/11
65 h-m-p 1.6000 8.0000 0.1881 C 495.579104 0 1.8753 1401 | 7/11
66 h-m-p 0.8268 8.0000 0.4266 Y 495.579101 0 1.9770 1419 | 7/11
67 h-m-p 1.6000 8.0000 0.3584 Y 495.579098 0 2.6833 1437 | 7/11
68 h-m-p 1.6000 8.0000 0.3523 C 495.579098 0 2.0003 1455 | 7/11
69 h-m-p 1.6000 8.0000 0.3358 Y 495.579097 0 3.5606 1473 | 7/11
70 h-m-p 1.6000 8.0000 0.3503 C 495.579097 0 1.9241 1491 | 7/11
71 h-m-p 1.6000 8.0000 0.3310 Y 495.579097 0 3.6698 1509 | 7/11
72 h-m-p 1.6000 8.0000 0.3524 C 495.579097 0 1.9426 1527 | 7/11
73 h-m-p 1.6000 8.0000 0.3408 Y 495.579097 0 3.6421 1545 | 7/11
74 h-m-p 1.6000 8.0000 0.3498 C 495.579097 0 1.9239 1563 | 7/11
75 h-m-p 1.6000 8.0000 0.3422 Y 495.579097 0 3.7192 1581 | 7/11
76 h-m-p 1.6000 8.0000 0.3858 C 495.579097 0 1.9783 1599 | 7/11
77 h-m-p 1.6000 8.0000 0.1696 C 495.579097 0 2.0949 1617 | 7/11
78 h-m-p 1.6000 8.0000 0.1838 ---Y 495.579097 0 0.0063 1638 | 7/11
79 h-m-p 0.9635 8.0000 0.0012 Y 495.579097 0 0.4457 1656 | 7/11
80 h-m-p 1.3596 8.0000 0.0004 +Y 495.579097 0 5.4383 1675 | 7/11
81 h-m-p 0.7840 8.0000 0.0027 -C 495.579097 0 0.0490 1694 | 7/11
82 h-m-p 1.6000 8.0000 0.0000 -Y 495.579097 0 0.0662 1713 | 7/11
83 h-m-p 0.0160 8.0000 0.0003 -------------.. | 7/11
84 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -495.579097
1772 lfun, 7088 eigenQcodon, 31896 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -521.938397 S = -505.489729 -32.284282
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:10
did 20 / 49 patterns 0:10
did 30 / 49 patterns 0:10
did 40 / 49 patterns 0:10
did 49 / 49 patterns 0:10
Time used: 0:10
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 6
0.058568 0.061435 0.060105 0.018659 0.064639 0.081243 0.000100 0.302474 1.750032
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.443511
np = 9
lnL0 = -562.180711
Iterating by ming2
Initial: fx= 562.180711
x= 0.05857 0.06143 0.06011 0.01866 0.06464 0.08124 0.00011 0.30247 1.75003
1 h-m-p 0.0000 0.0002 376.7860 +++ 545.364972 m 0.0002 24 | 1/9
2 h-m-p 0.0000 0.0002 358.1871 ++ 526.392728 m 0.0002 45 | 2/9
3 h-m-p 0.0000 0.0000 297.5246 ++ 525.907775 m 0.0000 65 | 3/9
4 h-m-p 0.0000 0.0001 63.0087 ++ 525.140057 m 0.0001 84 | 4/9
5 h-m-p 0.0000 0.0007 76.2652 ++ 522.868897 m 0.0007 102 | 5/9
6 h-m-p 0.0363 1.2776 1.3603 ++YCYCCC 519.962965 5 0.9756 130 | 5/9
7 h-m-p 0.0906 0.4532 0.9285 YCCCC 519.652207 4 0.1721 153 | 5/9
8 h-m-p 0.2081 8.0000 0.7679 YCCCC 518.881079 4 0.4103 176 | 5/9
9 h-m-p 0.5532 2.7659 0.1918 +YYYYYYYCYC 515.863097 10 2.2837 204 | 5/9
10 h-m-p 0.0475 0.2377 0.9449 +YYCCYC 515.050686 5 0.1593 228 | 5/9
11 h-m-p 0.0080 0.0402 1.9125 CCCC 515.023129 3 0.0065 250 | 5/9
12 h-m-p 0.0467 0.2337 0.2598 +CYYCYCYC 514.637856 7 0.2182 278 | 5/9
13 h-m-p 0.0651 0.3254 0.0523 ++ 514.482217 m 0.3254 294 | 5/9
14 h-m-p -0.0000 -0.0000 0.3021
h-m-p: -0.00000000e+00 -0.00000000e+00 3.02125545e-01 514.482217
.. | 5/9
15 h-m-p 0.0000 0.0108 10.9282 ++CCYCYC 514.425805 5 0.0006 334 | 5/9
16 h-m-p 0.0000 0.0001 210.0383 ++ 514.339906 m 0.0001 350 | 5/9
17 h-m-p 0.0013 0.1122 14.5751 ++CCC 513.174353 2 0.0261 372 | 5/9
18 h-m-p 0.0054 0.0270 0.0733 ++ 513.164218 m 0.0270 388 | 5/9
19 h-m-p 0.0160 8.0000 0.1275 +++CYCC 512.925932 3 1.3093 412 | 5/9
20 h-m-p 0.0049 0.0243 0.5856 ++ 512.922812 m 0.0243 428 | 5/9
21 h-m-p -0.0000 -0.0000 0.0350
h-m-p: -0.00000000e+00 -0.00000000e+00 3.50293007e-02 512.922812
.. | 5/9
22 h-m-p 0.0001 0.0362 3.2189 ++CCC 512.916562 2 0.0012 463 | 5/9
23 h-m-p 0.0100 3.0632 0.3850 ++CCYCYC 512.897306 5 0.2304 489 | 5/9
24 h-m-p 0.0000 0.0001 522.5641 ++ 512.894764 m 0.0001 505 | 5/9
25 h-m-p -0.0000 -0.0000 0.0026
h-m-p: -0.00000000e+00 -0.00000000e+00 2.56384008e-03 512.894764
.. | 5/9
26 h-m-p 0.0039 1.9320 0.0539 C 512.894763 0 0.0012 534 | 5/9
27 h-m-p 0.0066 2.2165 0.0094 Y 512.894762 0 0.0142 550 | 5/9
28 h-m-p 0.0074 0.0619 0.0180 ++ 512.894756 m 0.0619 566 | 6/9
29 h-m-p 0.5112 6.4058 0.0022 C 512.894755 0 0.1359 582 | 6/9
30 h-m-p 0.0583 8.0000 0.0051 +C 512.894753 0 0.2333 598 | 6/9
31 h-m-p 1.6000 8.0000 0.0001 Y 512.894753 0 1.0571 613 | 6/9
32 h-m-p 1.6000 8.0000 0.0000 -Y 512.894753 0 0.1000 629 | 6/9
33 h-m-p 0.1025 8.0000 0.0000 ----C 512.894753 0 0.0001 648
Out..
lnL = -512.894753
649 lfun, 7139 eigenQcodon, 38940 P(t)
Time used: 0:19
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 6
0.105825 0.024962 0.022405 0.078568 0.050292 0.045119 0.948729 0.900000 0.840489 1.936792 1.446380
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.371461
np = 11
lnL0 = -538.764062
Iterating by ming2
Initial: fx= 538.764062
x= 0.10582 0.02496 0.02240 0.07857 0.05029 0.04512 0.94873 0.90000 0.84049 1.93679 1.44638
1 h-m-p 0.0000 0.0002 245.9132 +++ 526.303009 m 0.0002 28 | 1/11
2 h-m-p 0.0000 0.0000 252.6625 ++ 525.097230 m 0.0000 53 | 2/11
3 h-m-p 0.0001 0.0005 115.4678 ++ 517.882433 m 0.0005 77 | 3/11
4 h-m-p 0.0000 0.0000 556.1388 ++ 516.659969 m 0.0000 100 | 4/11
5 h-m-p 0.0000 0.0000 5367.6043 ++ 513.247769 m 0.0000 122 | 5/11
6 h-m-p 0.0106 0.6014 2.8042 ++
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
+ 508.942879 m 0.6014 144
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23994) = 1.167429e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23969) = 1.167590e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23982) = 1.167510e-160 2000 rounds
| 6/11
7 h-m-p 0.2207 1.1033 2.4868
QuantileBeta(0.15, 0.00500, 2.21230) = 1.185770e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17072) = 1.214453e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.16333) = 1.219694e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14653) = 1.231778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13814) = 1.237910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15343) = 1.226787e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.15287) = 1.227197e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14970) = 1.229483e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15234) = 1.227578e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.15102) = 1.228530e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
C 506.571836 5 0.7016 174
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15243) = 1.227512e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15219) = 1.227686e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15231) = 1.227599e-160 2000 rounds
| 6/11
8 h-m-p 1.0112 5.3190 1.7255 +YYCCC 503.803729 4 3.6268 200 | 6/11
9 h-m-p 0.0922 0.4612 13.1095 CYCCC 502.881942 4 0.1527 226 | 6/11
10 h-m-p 0.2314 1.8605 8.6490 CYCCC 502.234975 4 0.1555 252 | 6/11
11 h-m-p 0.4040 6.4359 3.3296 +YCYYYYYYCC 499.990823 10 5.8135 286 | 6/11
12 h-m-p 1.6000 8.0000 1.4379 CYCCC 499.695395 4 1.2878 312 | 6/11
13 h-m-p 0.5087 4.9237 3.6400 +CYYYYYC 498.995661 6 3.4511 339 | 6/11
14 h-m-p 0.1885 1.6586 66.6458 +YCCC 497.472530 3 1.0296 364 | 6/11
15 h-m-p 0.5357 2.6785 16.2305 YCCC 496.951182 3 1.0965 388 | 6/11
16 h-m-p 0.2039 1.0193 16.7550 ++ 496.776954 m 1.0193 407 | 6/11
17 h-m-p -0.0000 -0.0000 17.7049
h-m-p: -1.50742463e-17 -7.53712316e-17 1.77049119e+01 496.776954
.. | 6/11
18 h-m-p 0.0000 0.0046 12.4767 ++YCCC 496.751820 3 0.0003 449 | 6/11
19 h-m-p 0.0028 0.4481 1.3752 ++YCCC 496.623788 3 0.1179 475 | 6/11
20 h-m-p 0.2823 2.3288 0.5744 CYC 496.586336 2 0.2729 497 | 6/11
21 h-m-p 1.6000 8.0000 0.0473 YCC 496.578279 2 0.6954 519 | 6/11
22 h-m-p 1.6000 8.0000 0.0206 YC 496.577387 1 1.1980 539 | 6/11
23 h-m-p 1.6000 8.0000 0.0105 C 496.577239 0 1.4379 558 | 6/11
24 h-m-p 1.4949 8.0000 0.0101 ++ 496.576709 m 8.0000 577 | 6/11
25 h-m-p 0.1100 8.0000 0.7316 ++CCC 496.570880 2 2.4832 602 | 6/11
26 h-m-p 1.6000 8.0000 0.8884 ++ 496.523515 m 8.0000 621 | 6/11
27 h-m-p 0.1042 3.2239 68.2044 +++ 495.959480 m 3.2239 641 | 6/11
28 h-m-p -0.0000 -0.0000 41.2360
h-m-p: -1.21124105e-15 -6.05620526e-15 4.12360380e+01 495.959480
.. | 6/11
29 h-m-p 0.0000 0.0035 14.8371 ++YCCC 495.922447 3 0.0003 683 | 6/11
30 h-m-p 0.0000 0.0001 0.3240 ++ 495.922440 m 0.0001 702 | 7/11
31 h-m-p 0.0160 8.0000 0.0727 +++CCC 495.910662 2 1.0640 728 | 7/11
32 h-m-p 1.6000 8.0000 0.0017 CC 495.910581 1 0.5457 748 | 6/11
33 h-m-p 0.0499 8.0000 0.0184 ++++ 495.801072 m 8.0000 768 | 6/11
34 h-m-p 0.2403 1.2017 0.1226 CCC 495.796816 2 0.2497 791 | 6/11
35 h-m-p 0.6251 8.0000 0.0490 CCC 495.774505 2 0.9262 814 | 6/11
36 h-m-p 1.6000 8.0000 0.0066 YC 495.774433 1 0.8226 834 | 6/11
37 h-m-p 1.6000 8.0000 0.0028 ++ 495.774377 m 8.0000 853 | 6/11
38 h-m-p 0.0993 8.0000 0.2257 +++CC 495.773233 1 5.5204 877 | 6/11
39 h-m-p 1.6000 8.0000 0.4529 YC 495.771353 1 3.3068 897 | 6/11
40 h-m-p 1.2925 8.0000 1.1588 ++ 495.765592 m 8.0000 916 | 6/11
41 h-m-p 0.7546 8.0000 12.2848 ++ 495.725280 m 8.0000 935 | 6/11
42 h-m-p 0.0009 0.0047 145.3952 ++ 495.725001 m 0.0047 954 | 6/11
43 h-m-p 0.0000 0.0000 325.7336
h-m-p: 0.00000000e+00 0.00000000e+00 3.25733601e+02 495.725001
.. | 6/11
44 h-m-p 0.0007 0.3573 2.6910 CC 495.724026 1 0.0003 991 | 6/11
45 h-m-p 0.0160 8.0000 0.2116 ++CCC 495.719478 2 0.2114 1016 | 6/11
46 h-m-p 1.6000 8.0000 0.0018 Y 495.719471 0 2.5660 1035 | 6/11
47 h-m-p 1.0551 8.0000 0.0044 ++ 495.719407 m 8.0000 1054 | 6/11
48 h-m-p 0.0181 8.0000 1.9618 +++CYC 495.717342 2 1.2284 1079 | 6/11
49 h-m-p 1.6000 8.0000 0.0690 C 495.717246 0 1.3936 1098 | 6/11
50 h-m-p 1.6000 8.0000 0.0218 C 495.717244 0 1.7816 1117 | 6/11
51 h-m-p 1.6000 8.0000 0.0037 ++ 495.717230 m 8.0000 1136 | 6/11
52 h-m-p 0.0160 8.0000 2.1085 +++YC 495.715894 1 2.1329 1159 | 6/11
53 h-m-p 1.6000 8.0000 1.3144 ++ 495.706933 m 8.0000 1178 | 6/11
54 h-m-p 0.0746 0.3729 133.9646 ++ 495.672111 m 0.3729 1197 | 7/11
55 h-m-p 0.3514 3.5319 142.1843 ++ 495.580714 m 3.5319 1216 | 8/11
56 h-m-p 0.4307 2.1535 11.9878 YC 495.579598 1 0.0821 1235 | 8/11
57 h-m-p 1.6000 8.0000 0.1446 YC 495.579146 1 1.2146 1253 | 8/11
58 h-m-p 1.6000 8.0000 0.0741 Y 495.579139 0 3.1854 1270 | 8/11
59 h-m-p 1.6000 8.0000 0.0153 Y 495.579138 0 1.2158 1287 | 8/11
60 h-m-p 1.6000 8.0000 0.0005 Y 495.579138 0 1.1012 1304 | 8/11
61 h-m-p 1.6000 8.0000 0.0001 -----Y 495.579138 0 0.0004 1326
Out..
lnL = -495.579138
1327 lfun, 15924 eigenQcodon, 87582 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -521.985310 S = -505.490420 -28.871542
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:41
did 20 / 49 patterns 0:41
did 30 / 49 patterns 0:41
did 40 / 49 patterns 0:42
did 49 / 49 patterns 0:42
Time used: 0:42
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=164
NC_011896_1_WP_049769707_1_865_MLBR_RS04040 ------------------------LRGTSNGADGISRLADYPAPPPRETL
NC_002677_1_NP_301626_1_498_ML0825 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
:.* .:********************
NC_011896_1_WP_049769707_1_865_MLBR_RS04040 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
NC_002677_1_NP_301626_1_498_ML0825 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
**************************************************
NC_011896_1_WP_049769707_1_865_MLBR_RS04040 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDALoooooooooo
NC_002677_1_NP_301626_1_498_ML0825 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
****************************************
NC_011896_1_WP_049769707_1_865_MLBR_RS04040 oooooooooooooo
NC_002677_1_NP_301626_1_498_ML0825 --------------
NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095 --------------
NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125 --------------
NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485 --------------
NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560 --------------
>NC_011896_1_WP_049769707_1_865_MLBR_RS04040 -------------------------------------------------- ----------------------TTGAGGGGCACGAGCAACGGCGCTGATG GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC ACGCTGGCGTGGATGCACTG------------------------------ ------------------------------------------ >NC_002677_1_NP_301626_1_498_ML0825 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC ACGCTGGCGTGGATGCACTG------------------------------ ------------------------------------------ >NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC ACGCTGGCGTGGATGCACTG------------------------------ ------------------------------------------ >NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC ACGCTGGCGTGGATGCACTG------------------------------ ------------------------------------------ >NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC ACGCTGGCGTGGATGCACTG------------------------------ ------------------------------------------ >NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC ACGCTGGCGTGGATGCACTG------------------------------ ------------------------------------------
>NC_011896_1_WP_049769707_1_865_MLBR_RS04040 ------------------------LRGTSNGADGISRLADYPAPPPRETL DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL >NC_002677_1_NP_301626_1_498_ML0825 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL >NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL >NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL >NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL >NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
#NEXUS
[ID: 0292705593]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_049769707_1_865_MLBR_RS04040
NC_002677_1_NP_301626_1_498_ML0825
NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095
NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125
NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485
NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560
;
end;
begin trees;
translate
1 NC_011896_1_WP_049769707_1_865_MLBR_RS04040,
2 NC_002677_1_NP_301626_1_498_ML0825,
3 NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095,
4 NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125,
5 NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485,
6 NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.1372562,2:0.002722354,3:0.002598235,4:0.002858327,5:0.002732255,6:0.002775151);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.1372562,2:0.002722354,3:0.002598235,4:0.002858327,5:0.002732255,6:0.002775151);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -639.78 -659.96
2 -639.36 -658.68
--------------------------------------
TOTAL -639.55 -659.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.232238 0.035631 0.031846 0.609553 0.168808 612.89 616.52 1.001
r(A<->C){all} 0.202089 0.022208 0.000195 0.486710 0.170792 232.37 272.26 1.006
r(A<->G){all} 0.277474 0.024890 0.000172 0.556336 0.263084 122.77 166.76 1.000
r(A<->T){all} 0.116373 0.012302 0.000041 0.342777 0.084200 242.02 295.08 1.000
r(C<->G){all} 0.142913 0.013211 0.000070 0.370268 0.116326 286.39 299.76 1.001
r(C<->T){all} 0.090105 0.009840 0.000063 0.296572 0.056288 104.59 136.73 1.002
r(G<->T){all} 0.171046 0.016886 0.000207 0.426114 0.140117 216.85 247.42 1.000
pi(A){all} 0.205239 0.000375 0.166135 0.242999 0.204414 1100.58 1180.25 1.000
pi(C){all} 0.333475 0.000497 0.290846 0.377103 0.333876 753.93 942.62 1.000
pi(G){all} 0.287276 0.000463 0.246734 0.330320 0.287076 1094.81 1297.90 1.000
pi(T){all} 0.174011 0.000317 0.140267 0.209674 0.173585 1460.33 1480.67 1.000
alpha{1,2} 0.439794 0.166669 0.000186 1.260930 0.320970 913.09 1073.12 1.001
alpha{3} 0.462258 0.200749 0.000163 1.348461 0.324655 1394.12 1411.49 1.000
pinvar{all} 0.757327 0.045655 0.260221 0.968774 0.841182 284.85 306.45 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0825/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 116
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 3 3 3 3 3 3 | CAC 5 7 7 7 7 7 | CGC 6 6 6 6 6 6
CTA 3 3 3 3 3 3 | CCA 3 3 3 3 3 3 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 8 8 8 8 8 8 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 0 0 0 0 0 0 | AAC 1 0 0 0 0 0 | AGC 2 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 2 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 2 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 5 | Gly GGT 0 0 0 0 0 0
GTC 6 6 6 6 6 6 | GCC 6 6 6 6 6 6 | GAC 2 2 2 2 2 2 | GGC 4 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 6 6 6 6 6 6 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 2 2 2 2 2 2 | GCG 2 2 2 2 2 2 | GAG 3 5 5 5 5 5 | GGG 4 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_049769707_1_865_MLBR_RS04040
position 1: T:0.08621 C:0.32759 A:0.15517 G:0.43103
position 2: T:0.30172 C:0.25862 A:0.24138 G:0.19828
position 3: T:0.12069 C:0.39655 A:0.19828 G:0.28448
Average T:0.16954 C:0.32759 A:0.19828 G:0.30460
#2: NC_002677_1_NP_301626_1_498_ML0825
position 1: T:0.07759 C:0.34483 A:0.12069 G:0.45690
position 2: T:0.30172 C:0.25000 A:0.26724 G:0.18103
position 3: T:0.12931 C:0.38793 A:0.19828 G:0.28448
Average T:0.16954 C:0.32759 A:0.19540 G:0.30747
#3: NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095
position 1: T:0.07759 C:0.34483 A:0.12069 G:0.45690
position 2: T:0.30172 C:0.25000 A:0.26724 G:0.18103
position 3: T:0.12931 C:0.38793 A:0.19828 G:0.28448
Average T:0.16954 C:0.32759 A:0.19540 G:0.30747
#4: NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125
position 1: T:0.07759 C:0.34483 A:0.12069 G:0.45690
position 2: T:0.30172 C:0.25000 A:0.26724 G:0.18103
position 3: T:0.12931 C:0.38793 A:0.19828 G:0.28448
Average T:0.16954 C:0.32759 A:0.19540 G:0.30747
#5: NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485
position 1: T:0.07759 C:0.34483 A:0.12069 G:0.45690
position 2: T:0.30172 C:0.25000 A:0.26724 G:0.18103
position 3: T:0.12931 C:0.38793 A:0.19828 G:0.28448
Average T:0.16954 C:0.32759 A:0.19540 G:0.30747
#6: NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560
position 1: T:0.07759 C:0.34483 A:0.12069 G:0.45690
position 2: T:0.30172 C:0.25000 A:0.26724 G:0.18103
position 3: T:0.12931 C:0.38793 A:0.19828 G:0.28448
Average T:0.16954 C:0.32759 A:0.19540 G:0.30747
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 0 | TCC 6 | TAC 18 | TGC 6
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 7 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 0
CTC 6 | CCC 18 | CAC 40 | CGC 36
CTA 18 | CCA 18 | Gln Q CAA 12 | CGA 6
CTG 48 | CCG 6 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 30 | ACC 0 | AAC 1 | AGC 7
ATA 6 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 6 | ACG 7 | AAG 6 | AGG 7
------------------------------------------------------------------------------
Val V GTT 17 | Ala A GCT 18 | Asp D GAT 30 | Gly G GGT 0
GTC 36 | GCC 36 | GAC 12 | GGC 19
GTA 0 | GCA 36 | Glu E GAA 18 | GGA 12
GTG 12 | GCG 12 | GAG 28 | GGG 29
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.07902 C:0.34195 A:0.12644 G:0.45259
position 2: T:0.30172 C:0.25144 A:0.26293 G:0.18391
position 3: T:0.12787 C:0.38937 A:0.19828 G:0.28448
Average T:0.16954 C:0.32759 A:0.19588 G:0.30699
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 6
check convergence..
lnL(ntime: 6 np: 8): -515.159460 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.108059 0.000004 0.000004 0.000004 0.000004 0.000004 1.173166 1.446380
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.108079
(1: 0.108059, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_049769707_1_865_MLBR_RS04040: 0.108059, NC_002677_1_NP_301626_1_498_ML0825: 0.000004, NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095: 0.000004, NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125: 0.000004, NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485: 0.000004, NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.17317
omega (dN/dS) = 1.44638
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.108 250.4 97.6 1.4464 0.0394 0.0273 9.9 2.7
7..2 0.000 250.4 97.6 1.4464 0.0000 0.0000 0.0 0.0
7..3 0.000 250.4 97.6 1.4464 0.0000 0.0000 0.0 0.0
7..4 0.000 250.4 97.6 1.4464 0.0000 0.0000 0.0 0.0
7..5 0.000 250.4 97.6 1.4464 0.0000 0.0000 0.0 0.0
7..6 0.000 250.4 97.6 1.4464 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0394
tree length for dS: 0.0273
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 6
lnL(ntime: 6 np: 9): -512.894365 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.111414 0.000004 0.000004 0.000004 0.000004 0.000004 0.946531 0.704689 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.111434
(1: 0.111414, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_049769707_1_865_MLBR_RS04040: 0.111414, NC_002677_1_NP_301626_1_498_ML0825: 0.000004, NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095: 0.000004, NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125: 0.000004, NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485: 0.000004, NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.94653
MLEs of dN/dS (w) for site classes (K=2)
p: 0.70469 0.29531
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.111 252.0 96.0 0.2953 0.0224 0.0758 5.6 7.3
7..2 0.000 252.0 96.0 0.2953 0.0000 0.0000 0.0 0.0
7..3 0.000 252.0 96.0 0.2953 0.0000 0.0000 0.0 0.0
7..4 0.000 252.0 96.0 0.2953 0.0000 0.0000 0.0 0.0
7..5 0.000 252.0 96.0 0.2953 0.0000 0.0000 0.0 0.0
7..6 0.000 252.0 96.0 0.2953 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 6
check convergence..
lnL(ntime: 6 np: 11): -495.579097 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
1.003735 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.958700 0.000000 0.197483 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.003755
(1: 1.003735, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_049769707_1_865_MLBR_RS04040: 1.003735, NC_002677_1_NP_301626_1_498_ML0825: 0.000004, NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095: 0.000004, NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125: 0.000004, NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485: 0.000004, NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.95870 0.00000 0.04130
w: 0.19748 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 1.004 262.1 85.9 41.4483 0.4407 0.0106 115.5 0.9
7..2 0.000 262.1 85.9 41.4483 0.0000 0.0000 0.0 0.0
7..3 0.000 262.1 85.9 41.4483 0.0000 0.0000 0.0 0.0
7..4 0.000 262.1 85.9 41.4483 0.0000 0.0000 0.0 0.0
7..5 0.000 262.1 85.9 41.4483 0.0000 0.0000 0.0 0.0
7..6 0.000 262.1 85.9 41.4483 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.310
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.849 8.458 +- 3.336
2 R 0.999** 9.804 +- 1.010
4 T 0.993** 9.751 +- 1.218
5 S 1.000** 9.809 +- 0.984
6 N 0.753 7.591 +- 3.957
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.141 0.129 0.119 0.110 0.101 0.093 0.086 0.079 0.074 0.068
w2: 0.000 0.000 0.000 0.001 0.004 0.014 0.042 0.111 0.261 0.567
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.001
0.012 0.003 0.001
0.017 0.016 0.014 0.004 0.001
0.010 0.015 0.018 0.018 0.015 0.004 0.001
0.004 0.008 0.011 0.017 0.021 0.020 0.016 0.004 0.001
0.001 0.003 0.005 0.009 0.013 0.019 0.023 0.022 0.018 0.004 0.001
0.000 0.001 0.002 0.004 0.005 0.010 0.014 0.022 0.026 0.024 0.019 0.004 0.001
0.000 0.000 0.001 0.001 0.002 0.004 0.006 0.012 0.016 0.024 0.029 0.026 0.021 0.005 0.001
0.000 0.000 0.000 0.000 0.001 0.001 0.002 0.005 0.007 0.013 0.019 0.028 0.032 0.029 0.023 0.005 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.002 0.002 0.005 0.008 0.015 0.021 0.031 0.036 0.032 0.025 0.005 0.001
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 6
lnL(ntime: 6 np: 9): -512.894753 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.111423 0.000004 0.000004 0.000004 0.000004 0.000004 0.948729 0.005000 0.011701
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.111443
(1: 0.111423, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_049769707_1_865_MLBR_RS04040: 0.111423, NC_002677_1_NP_301626_1_498_ML0825: 0.000004, NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095: 0.000004, NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125: 0.000004, NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485: 0.000004, NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.94873
Parameters in M7 (beta):
p = 0.00500 q = 0.01170
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.111 252.0 96.0 0.3000 0.0226 0.0753 5.7 7.2
7..2 0.000 252.0 96.0 0.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 252.0 96.0 0.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 252.0 96.0 0.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 252.0 96.0 0.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 252.0 96.0 0.3000 0.0000 0.0000 0.0 0.0
Time used: 0:19
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 6
lnL(ntime: 6 np: 11): -495.579138 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
1.003695 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.958699 24.395654 99.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.003715
(1: 1.003695, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_049769707_1_865_MLBR_RS04040: 1.003695, NC_002677_1_NP_301626_1_498_ML0825: 0.000004, NZ_LVXE01000097_1_WP_010907950_1_2927_A3216_RS14095: 0.000004, NZ_LYPH01000103_1_WP_010907950_1_2921_A8144_RS14125: 0.000004, NZ_CP029543_1_WP_010907950_1_883_DIJ64_RS04485: 0.000004, NZ_AP014567_1_WP_010907950_1_898_JK2ML_RS04560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.95870 p = 24.39565 q = 99.00000
(p1 = 0.04130) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09587 0.09587 0.09587 0.09587 0.09587 0.09587 0.09587 0.09587 0.09587 0.09587 0.04130
w: 0.14186 0.16079 0.17269 0.18252 0.19159 0.20059 0.21010 0.22094 0.23487 0.25914 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 1.004 262.1 85.9 41.4488 0.4407 0.0106 115.5 0.9
7..2 0.000 262.1 85.9 41.4488 0.0000 0.0000 0.0 0.0
7..3 0.000 262.1 85.9 41.4488 0.0000 0.0000 0.0 0.0
7..4 0.000 262.1 85.9 41.4488 0.0000 0.0000 0.0 0.0
7..5 0.000 262.1 85.9 41.4488 0.0000 0.0000 0.0 0.0
7..6 0.000 262.1 85.9 41.4488 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.308
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.904 8.916 +- 2.842
2 R 1.000** 9.781 +- 1.021
4 T 0.997** 9.757 +- 1.122
5 S 1.000** 9.784 +- 1.010
6 N 0.835 8.275 +- 3.506
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.001 0.002 0.006 0.021 0.072 0.196 0.366 0.312 0.024
p : 0.152 0.127 0.113 0.103 0.095 0.090 0.085 0.081 0.078 0.076
q : 0.061 0.076 0.086 0.095 0.101 0.107 0.112 0.117 0.121 0.124
ws: 0.000 0.000 0.000 0.001 0.005 0.016 0.045 0.113 0.262 0.559
Time used: 0:42
Model 1: NearlyNeutral -512.894365
Model 2: PositiveSelection -495.579097
Model 0: one-ratio -515.15946
Model 7: beta -512.894753
Model 8: beta&w>1 -495.579138
Model 0 vs 1 4.530189999999948
Model 2 vs 1 34.630536000000006
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.310
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.849 8.458 +- 3.336
2 R 0.999** 9.804 +- 1.010
4 T 0.993** 9.751 +- 1.218
5 S 1.000** 9.809 +- 0.984
6 N 0.753 7.591 +- 3.957
Model 8 vs 7 34.63123000000007
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.308
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.904 8.916 +- 2.842
2 R 1.000** 9.781 +- 1.021
4 T 0.997** 9.757 +- 1.122
5 S 1.000** 9.784 +- 1.010
6 N 0.835 8.275 +- 3.506
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
