--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:49:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0825/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -639.78 -659.96
2 -639.36 -658.68
--------------------------------------
TOTAL -639.55 -659.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.232238 0.035631 0.031846 0.609553 0.168808 612.89 616.52 1.001
r(A<->C){all} 0.202089 0.022208 0.000195 0.486710 0.170792 232.37 272.26 1.006
r(A<->G){all} 0.277474 0.024890 0.000172 0.556336 0.263084 122.77 166.76 1.000
r(A<->T){all} 0.116373 0.012302 0.000041 0.342777 0.084200 242.02 295.08 1.000
r(C<->G){all} 0.142913 0.013211 0.000070 0.370268 0.116326 286.39 299.76 1.001
r(C<->T){all} 0.090105 0.009840 0.000063 0.296572 0.056288 104.59 136.73 1.002
r(G<->T){all} 0.171046 0.016886 0.000207 0.426114 0.140117 216.85 247.42 1.000
pi(A){all} 0.205239 0.000375 0.166135 0.242999 0.204414 1100.58 1180.25 1.000
pi(C){all} 0.333475 0.000497 0.290846 0.377103 0.333876 753.93 942.62 1.000
pi(G){all} 0.287276 0.000463 0.246734 0.330320 0.287076 1094.81 1297.90 1.000
pi(T){all} 0.174011 0.000317 0.140267 0.209674 0.173585 1460.33 1480.67 1.000
alpha{1,2} 0.439794 0.166669 0.000186 1.260930 0.320970 913.09 1073.12 1.001
alpha{3} 0.462258 0.200749 0.000163 1.348461 0.324655 1394.12 1411.49 1.000
pinvar{all} 0.757327 0.045655 0.260221 0.968774 0.841182 284.85 306.45 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -512.894365
Model 2: PositiveSelection -495.579097
Model 0: one-ratio -515.15946
Model 7: beta -512.894753
Model 8: beta&w>1 -495.579138
Model 0 vs 1 4.530189999999948
Model 2 vs 1 34.630536000000006
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.310
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.849 8.458 +- 3.336
2 R 0.999** 9.804 +- 1.010
4 T 0.993** 9.751 +- 1.218
5 S 1.000** 9.809 +- 0.984
6 N 0.753 7.591 +- 3.957
Model 8 vs 7 34.63123000000007
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.994** 993.308
2 R 1.000** 999.000
4 T 1.000** 998.996
5 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_049769707_1_865_MLBR_RS04040)
Pr(w>1) post mean +- SE for w
1 L 0.904 8.916 +- 2.842
2 R 1.000** 9.781 +- 1.021
4 T 0.997** 9.757 +- 1.122
5 S 1.000** 9.784 +- 1.010
6 N 0.835 8.275 +- 3.506
>C1
LRGTSNGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
THIVVDAVAHAGVDALoooooooooooooooooooooooo
>C2
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C3
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C4
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C5
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C6
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=164
C1 ------------------------LRGTSNGADGISRLADYPAPPPRETL
C2 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C3 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C4 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C5 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
C6 MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
:.* .:********************
C1 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C2 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C3 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C4 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C5 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
C6 DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
**************************************************
C1 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDALoooooooooo
C2 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C3 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C4 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C5 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
C6 KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL----------
****************************************
C1 oooooooooooooo
C2 --------------
C3 --------------
C4 --------------
C5 --------------
C6 --------------
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4400]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4400]--->[4280]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.469 Mb, Max= 30.678 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LRGTSNGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C2 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C3 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C4 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C5 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
C6 VEGHEHGADGISRLADYPAPPPRETLDAAGELLRALAAPVRIAIVLQLRE
:.* .:********************************************
C1 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C2 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C3 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C4 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C5 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
C6 SQRCVHELVDALGIPQPLVSQHLKILKGAGIVAGERSGREMLYRLADYHL
**************************************************
C1 THIVVDAVAHAGVDAL
C2 THIVVDAVAHAGVDAL
C3 THIVVDAVAHAGVDAL
C4 THIVVDAVAHAGVDAL
C5 THIVVDAVAHAGVDAL
C6 THIVVDAVAHAGVDAL
****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:98 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 95.69 C1 C2 95.69
TOP 1 0 95.69 C2 C1 95.69
BOT 0 2 95.69 C1 C3 95.69
TOP 2 0 95.69 C3 C1 95.69
BOT 0 3 95.69 C1 C4 95.69
TOP 3 0 95.69 C4 C1 95.69
BOT 0 4 95.69 C1 C5 95.69
TOP 4 0 95.69 C5 C1 95.69
BOT 0 5 95.69 C1 C6 95.69
TOP 5 0 95.69 C6 C1 95.69
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 95.69
AVG 1 C2 * 99.14
AVG 2 C3 * 99.14
AVG 3 C4 * 99.14
AVG 4 C5 * 99.14
AVG 5 C6 * 99.14
TOT TOT * 98.56
CLUSTAL W (1.83) multiple sequence alignment
C1 --------------------------------------------------
C2 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C3 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C4 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C5 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C6 ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
C1 ----------------------TTGAGGGGCACGAGCAACGGCGCTGATG
C2 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C3 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C4 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C5 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
C6 CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
* ..*** .. .. .************
C1 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C2 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C3 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C4 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C5 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
C6 GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
**************************************************
C1 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C2 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C3 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C4 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C5 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
C6 GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
**************************************************
C1 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C2 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C3 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C4 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C5 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
C6 CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
**************************************************
C1 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C2 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C3 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C4 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C5 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
C6 ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
**************************************************
C1 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C2 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C3 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C4 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C5 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
C6 AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
**************************************************
C1 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C2 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C3 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C4 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C5 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
C6 CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
**************************************************
C1 ACGCTGGCGTGGATGCACTG------------------------------
C2 ACGCTGGCGTGGATGCACTG------------------------------
C3 ACGCTGGCGTGGATGCACTG------------------------------
C4 ACGCTGGCGTGGATGCACTG------------------------------
C5 ACGCTGGCGTGGATGCACTG------------------------------
C6 ACGCTGGCGTGGATGCACTG------------------------------
********************
C1 ------------------------------------------
C2 ------------------------------------------
C3 ------------------------------------------
C4 ------------------------------------------
C5 ------------------------------------------
C6 ------------------------------------------
>C1
--------------------------------------------------
----------------------TTGAGGGGCACGAGCAACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C2
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C3
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C4
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C5
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C6
ATGGTGACGTCCCCGTCAACATCGACCACCGTTGACCTCCCATCCACGAC
CACCGACTTAAGCTCAGGTTTAGTTGAGGGGCACGAGCACGGCGCTGATG
GGATTTCGAGGTTAGCGGATTACCCCGCACCCCCACCGCGCGAGACTCTG
GATGCAGCCGGGGAGCTGTTGCGCGCACTAGCCGCACCCGTTCGCATCGC
CATCGTGCTGCAACTGCGCGAATCGCAGCGATGCGTCCACGAACTAGTCG
ACGCACTGGGCATACCACAGCCACTGGTTAGCCAACACCTAAAAATCCTC
AAGGGGGCGGGGATCGTCGCCGGAGAGCGCTCCGGACGCGAAATGCTTTA
CCGGCTTGCTGACTACCACCTGACGCACATCGTCGTCGATGCCGTCGCCC
ACGCTGGCGTGGATGCACTG------------------------------
------------------------------------------
>C1
ooooooooooooooooooooooooLRGTSNGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C2
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C3
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C4
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C5
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
>C6
MVTSPSTSTTVDLPSTTTDLSSGLVEGHEHGADGISRLADYPAPPPRETL
DAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALGIPQPLVSQHLKIL
KGAGIVAGERSGREMLYRLADYHLTHIVVDAVAHAGVDAL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 492 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579798020
Setting output file names to "/data/5res/ML0825/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 229252536
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0292705593
Seed = 1328124849
Swapseed = 1579798020
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 12 unique site patterns
Division 2 has 11 unique site patterns
Division 3 has 12 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -973.963061 -- -24.965149
Chain 2 -- -973.963061 -- -24.965149
Chain 3 -- -973.963061 -- -24.965149
Chain 4 -- -973.963061 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -973.934283 -- -24.965149
Chain 2 -- -973.963061 -- -24.965149
Chain 3 -- -973.934283 -- -24.965149
Chain 4 -- -973.963061 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-973.963] (-973.963) (-973.963) (-973.963) * [-973.934] (-973.963) (-973.934) (-973.963)
500 -- (-651.875) [-654.122] (-650.416) (-654.656) * (-660.429) [-649.723] (-642.966) (-655.765) -- 0:00:00
1000 -- (-643.233) [-640.125] (-642.508) (-643.324) * (-646.407) (-648.348) (-651.556) [-644.711] -- 0:00:00
1500 -- (-643.215) (-644.020) [-651.394] (-649.930) * (-648.727) [-639.455] (-650.181) (-645.498) -- 0:00:00
2000 -- [-638.371] (-644.334) (-641.603) (-656.874) * (-648.115) (-642.668) (-653.758) [-642.284] -- 0:00:00
2500 -- (-648.818) (-643.627) [-642.933] (-646.906) * [-646.483] (-646.649) (-643.524) (-646.498) -- 0:00:00
3000 -- (-648.796) (-643.004) [-643.232] (-645.639) * (-649.613) (-641.877) (-642.010) [-643.226] -- 0:05:32
3500 -- (-654.450) (-651.735) [-643.700] (-640.893) * (-643.275) (-648.867) (-653.923) [-642.120] -- 0:04:44
4000 -- (-650.042) (-643.618) (-644.352) [-643.252] * [-642.627] (-642.041) (-640.440) (-642.126) -- 0:04:09
4500 -- [-641.759] (-643.393) (-655.839) (-642.294) * (-648.329) [-643.040] (-639.418) (-643.075) -- 0:03:41
5000 -- (-646.345) [-644.213] (-648.247) (-645.625) * (-649.767) [-640.617] (-652.796) (-641.997) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-647.843) [-639.071] (-645.016) (-641.917) * (-649.293) (-641.545) [-648.162] (-644.672) -- 0:03:00
6000 -- [-649.532] (-648.018) (-645.972) (-645.098) * [-643.993] (-644.177) (-645.808) (-643.420) -- 0:02:45
6500 -- [-644.428] (-644.715) (-639.896) (-641.647) * (-647.244) [-646.049] (-647.011) (-644.368) -- 0:02:32
7000 -- (-647.994) (-640.355) [-645.877] (-649.903) * (-647.994) (-640.273) [-644.271] (-650.052) -- 0:02:21
7500 -- [-640.389] (-640.998) (-645.876) (-649.515) * (-637.207) (-648.136) (-651.961) [-650.968] -- 0:02:12
8000 -- (-654.348) [-644.844] (-639.854) (-638.043) * [-644.594] (-641.352) (-642.304) (-644.010) -- 0:02:04
8500 -- [-647.737] (-644.252) (-644.615) (-646.983) * (-643.438) (-646.641) (-648.951) [-637.989] -- 0:01:56
9000 -- (-645.396) (-641.563) (-644.065) [-642.468] * (-643.111) [-643.378] (-643.536) (-640.837) -- 0:01:50
9500 -- (-642.467) [-636.040] (-639.699) (-647.972) * [-648.709] (-648.482) (-645.762) (-647.803) -- 0:01:44
10000 -- (-645.883) (-641.431) [-642.370] (-645.311) * (-652.764) (-642.253) (-645.068) [-641.973] -- 0:01:39
Average standard deviation of split frequencies: 0.069448
10500 -- [-643.264] (-646.811) (-645.434) (-643.710) * (-651.943) (-644.115) (-638.270) [-640.916] -- 0:01:34
11000 -- (-645.199) (-642.031) [-642.473] (-646.088) * (-644.694) (-645.459) (-644.582) [-640.613] -- 0:01:29
11500 -- [-642.917] (-645.337) (-642.346) (-650.045) * (-657.988) (-649.372) [-643.986] (-645.575) -- 0:01:25
12000 -- (-649.485) (-641.105) [-643.023] (-640.037) * (-650.144) (-648.693) [-642.143] (-639.682) -- 0:01:22
12500 -- (-650.537) [-636.889] (-646.440) (-643.523) * (-657.035) (-640.097) [-641.829] (-642.935) -- 0:01:19
13000 -- (-648.249) [-638.099] (-648.705) (-649.154) * (-650.666) (-653.503) (-639.343) [-643.497] -- 0:01:15
13500 -- (-654.700) [-643.305] (-640.207) (-641.200) * (-651.828) [-648.205] (-644.729) (-639.287) -- 0:01:13
14000 -- (-650.484) (-642.359) [-644.732] (-645.806) * (-652.948) [-644.488] (-643.837) (-641.843) -- 0:01:10
14500 -- (-647.141) (-641.384) [-640.345] (-654.511) * (-645.167) [-645.192] (-641.465) (-648.462) -- 0:02:15
15000 -- (-666.178) (-640.277) [-640.276] (-642.417) * (-642.781) [-638.090] (-640.032) (-645.928) -- 0:02:11
Average standard deviation of split frequencies: 0.075983
15500 -- (-652.911) [-642.950] (-640.667) (-644.602) * (-644.896) (-648.693) [-636.694] (-637.587) -- 0:02:07
16000 -- (-659.496) (-641.345) (-653.428) [-648.196] * [-638.751] (-641.546) (-639.745) (-643.633) -- 0:02:03
16500 -- (-651.901) (-638.421) (-647.628) [-641.751] * (-646.217) [-651.754] (-645.962) (-648.862) -- 0:01:59
17000 -- (-647.521) [-640.992] (-644.565) (-642.455) * (-642.066) (-640.741) (-638.572) [-639.064] -- 0:01:55
17500 -- (-651.226) [-637.776] (-642.600) (-658.593) * (-639.387) [-637.475] (-637.530) (-649.284) -- 0:01:52
18000 -- (-647.011) [-639.085] (-649.072) (-651.096) * (-652.917) [-639.115] (-648.298) (-649.162) -- 0:01:49
18500 -- (-656.885) (-637.680) [-644.679] (-649.207) * [-645.939] (-655.296) (-648.499) (-646.805) -- 0:01:46
19000 -- (-655.510) [-639.745] (-645.137) (-641.655) * (-656.342) (-640.474) (-643.507) [-653.182] -- 0:01:43
19500 -- (-647.039) (-644.736) (-659.339) [-643.236] * (-656.987) (-642.913) [-652.884] (-647.000) -- 0:01:40
20000 -- (-648.013) [-639.342] (-642.509) (-640.906) * (-648.881) (-648.268) (-643.815) [-644.970] -- 0:01:38
Average standard deviation of split frequencies: 0.059559
20500 -- (-643.962) [-636.855] (-644.709) (-646.498) * [-639.796] (-661.473) (-643.490) (-644.546) -- 0:01:35
21000 -- (-645.593) (-644.130) (-643.587) [-647.079] * (-644.127) (-642.016) [-640.967] (-646.566) -- 0:01:33
21500 -- (-652.688) [-641.463] (-651.574) (-654.956) * (-643.052) (-643.596) [-640.099] (-643.558) -- 0:01:31
22000 -- (-649.272) [-644.785] (-651.903) (-651.519) * (-650.716) [-638.937] (-643.832) (-640.994) -- 0:01:28
22500 -- (-647.952) [-638.451] (-646.853) (-650.925) * [-645.969] (-653.905) (-644.766) (-644.563) -- 0:01:26
23000 -- (-649.931) [-643.649] (-654.000) (-649.113) * (-653.964) (-643.439) (-641.299) [-644.897] -- 0:01:24
23500 -- [-639.292] (-648.060) (-653.014) (-646.163) * (-645.496) (-644.425) [-641.650] (-640.831) -- 0:01:23
24000 -- [-647.053] (-642.543) (-657.918) (-655.082) * (-645.759) (-647.884) (-637.204) [-640.471] -- 0:01:21
24500 -- (-640.013) [-642.920] (-651.272) (-656.033) * (-641.671) (-643.476) (-641.736) [-643.437] -- 0:01:19
25000 -- (-646.427) (-644.112) (-660.434) [-647.896] * (-642.402) (-650.718) (-644.081) [-638.666] -- 0:01:18
Average standard deviation of split frequencies: 0.049860
25500 -- [-643.020] (-652.853) (-660.942) (-646.682) * [-641.451] (-647.192) (-644.941) (-644.472) -- 0:01:54
26000 -- (-641.500) [-644.622] (-654.149) (-654.560) * (-640.974) [-651.538] (-659.635) (-647.738) -- 0:01:52
26500 -- [-644.528] (-647.017) (-654.344) (-653.915) * [-641.121] (-645.525) (-655.976) (-640.310) -- 0:01:50
27000 -- (-641.172) [-645.273] (-640.140) (-657.134) * [-638.095] (-647.980) (-638.821) (-640.084) -- 0:01:48
27500 -- (-647.196) (-663.915) (-649.295) [-647.240] * [-638.879] (-642.468) (-646.305) (-643.336) -- 0:01:46
28000 -- (-660.889) (-645.238) [-647.370] (-656.788) * (-637.729) (-647.145) (-653.820) [-644.311] -- 0:01:44
28500 -- (-658.876) (-646.553) [-647.258] (-658.896) * [-639.714] (-642.137) (-655.739) (-639.334) -- 0:01:42
29000 -- (-656.876) [-639.698] (-653.689) (-659.798) * (-641.963) [-641.785] (-650.598) (-650.336) -- 0:01:40
29500 -- (-657.353) [-640.093] (-641.746) (-658.248) * (-641.923) [-638.671] (-656.379) (-648.781) -- 0:01:38
30000 -- (-652.655) (-644.469) [-646.349] (-668.669) * (-641.605) (-642.668) (-647.000) [-644.530] -- 0:01:37
Average standard deviation of split frequencies: 0.037731
30500 -- (-644.010) [-642.123] (-647.287) (-661.938) * (-648.228) [-644.302] (-646.819) (-646.538) -- 0:01:35
31000 -- (-657.200) [-643.306] (-649.248) (-657.442) * [-642.307] (-650.358) (-645.703) (-639.093) -- 0:01:33
31500 -- (-653.273) [-642.485] (-651.838) (-652.146) * (-644.591) [-646.141] (-650.255) (-646.785) -- 0:01:32
32000 -- (-655.181) (-641.670) [-650.502] (-646.893) * (-646.312) (-648.066) (-652.019) [-646.991] -- 0:01:30
32500 -- (-647.185) (-648.296) [-643.070] (-645.310) * (-639.342) [-644.114] (-645.314) (-648.182) -- 0:01:29
33000 -- (-655.910) [-639.396] (-644.083) (-652.978) * [-637.729] (-647.981) (-664.100) (-655.386) -- 0:01:27
33500 -- (-651.933) [-641.336] (-644.151) (-651.899) * [-637.478] (-643.021) (-652.963) (-653.619) -- 0:01:26
34000 -- (-656.989) [-642.839] (-644.006) (-657.967) * (-636.661) (-647.494) (-654.142) [-648.636] -- 0:01:25
34500 -- (-659.095) (-639.688) [-644.817] (-650.263) * [-639.016] (-642.110) (-646.418) (-653.223) -- 0:01:23
35000 -- (-655.189) [-642.554] (-650.896) (-655.512) * (-638.328) (-643.259) (-656.960) [-652.243] -- 0:01:22
Average standard deviation of split frequencies: 0.037974
35500 -- (-654.935) [-644.069] (-647.299) (-655.472) * (-643.991) [-646.336] (-656.200) (-652.695) -- 0:01:21
36000 -- (-652.015) [-641.493] (-651.234) (-645.643) * (-640.698) [-642.763] (-656.184) (-641.458) -- 0:01:20
36500 -- (-652.787) [-640.002] (-639.967) (-651.995) * (-643.094) [-643.477] (-654.654) (-649.095) -- 0:01:19
37000 -- [-644.635] (-642.500) (-641.421) (-654.900) * (-639.730) (-648.499) [-651.030] (-656.301) -- 0:01:44
37500 -- (-653.893) (-638.129) [-647.192] (-657.673) * [-639.936] (-646.678) (-644.325) (-653.900) -- 0:01:42
38000 -- (-653.873) (-643.080) [-642.296] (-651.511) * [-639.652] (-662.442) (-658.061) (-642.740) -- 0:01:41
38500 -- [-646.935] (-647.267) (-650.055) (-659.662) * [-637.700] (-645.414) (-661.979) (-646.773) -- 0:01:39
39000 -- (-641.676) [-646.492] (-643.688) (-660.129) * (-641.651) [-650.989] (-662.803) (-650.881) -- 0:01:38
39500 -- (-658.281) [-647.161] (-640.508) (-642.094) * [-640.701] (-643.895) (-648.049) (-642.864) -- 0:01:37
40000 -- [-647.950] (-646.952) (-645.872) (-654.101) * (-645.665) (-658.789) (-661.177) [-646.821] -- 0:01:36
Average standard deviation of split frequencies: 0.038436
40500 -- (-641.480) (-646.681) [-644.991] (-656.166) * [-644.737] (-657.132) (-652.054) (-643.704) -- 0:01:34
41000 -- [-646.004] (-646.106) (-643.487) (-660.992) * [-642.933] (-660.818) (-651.378) (-646.845) -- 0:01:33
41500 -- (-643.246) (-644.074) [-639.940] (-653.309) * (-652.869) (-658.049) (-657.775) [-648.724] -- 0:01:32
42000 -- (-653.603) (-647.837) [-644.443] (-648.872) * (-644.116) [-647.303] (-658.746) (-652.362) -- 0:01:31
42500 -- (-656.627) [-645.255] (-645.837) (-646.569) * (-642.433) (-649.805) (-655.114) [-643.115] -- 0:01:30
43000 -- (-646.760) (-649.545) [-641.620] (-644.889) * [-647.829] (-651.675) (-653.675) (-649.487) -- 0:01:29
43500 -- (-649.825) [-645.104] (-649.584) (-670.639) * [-646.064] (-649.084) (-651.419) (-647.216) -- 0:01:27
44000 -- (-656.582) [-644.308] (-658.045) (-660.971) * (-642.005) [-638.043] (-665.244) (-650.789) -- 0:01:26
44500 -- (-658.554) [-643.620] (-645.962) (-655.718) * (-638.803) [-643.986] (-650.770) (-647.100) -- 0:01:25
45000 -- (-645.794) (-651.043) [-639.312] (-650.924) * (-642.360) (-657.856) [-645.289] (-645.043) -- 0:01:24
Average standard deviation of split frequencies: 0.034470
45500 -- (-646.506) (-649.042) [-643.819] (-653.722) * (-642.686) (-650.444) [-646.338] (-649.223) -- 0:01:23
46000 -- (-657.776) (-644.755) [-645.791] (-659.791) * [-646.863] (-649.579) (-641.059) (-648.848) -- 0:01:22
46500 -- [-640.403] (-650.486) (-640.667) (-655.745) * [-643.638] (-657.153) (-657.434) (-648.262) -- 0:01:22
47000 -- (-648.894) [-643.376] (-647.589) (-657.732) * (-639.666) (-646.946) (-650.806) [-643.247] -- 0:01:21
47500 -- [-648.783] (-649.100) (-644.269) (-657.350) * (-645.760) [-648.845] (-652.242) (-646.418) -- 0:01:20
48000 -- [-641.284] (-647.720) (-644.313) (-656.571) * (-636.594) (-660.403) (-646.724) [-643.954] -- 0:01:19
48500 -- (-649.507) (-645.291) [-645.133] (-657.492) * (-643.077) (-662.300) (-654.643) [-649.874] -- 0:01:38
49000 -- (-644.051) (-644.220) [-637.629] (-665.954) * [-638.122] (-649.219) (-647.076) (-651.447) -- 0:01:37
49500 -- [-638.591] (-642.713) (-648.721) (-660.481) * (-638.872) (-660.633) (-655.506) [-646.055] -- 0:01:36
50000 -- (-638.432) [-644.207] (-642.690) (-661.648) * [-639.395] (-659.845) (-649.976) (-655.747) -- 0:01:35
Average standard deviation of split frequencies: 0.032564
50500 -- (-641.482) (-640.518) [-642.096] (-659.149) * [-641.852] (-657.259) (-647.221) (-640.718) -- 0:01:34
51000 -- (-649.330) [-638.689] (-642.067) (-665.838) * (-644.400) (-658.106) [-644.361] (-648.485) -- 0:01:33
51500 -- (-648.473) [-640.290] (-657.410) (-657.952) * (-643.226) (-657.376) [-641.000] (-650.464) -- 0:01:32
52000 -- (-651.549) [-638.418] (-636.840) (-653.580) * [-640.581] (-658.827) (-650.764) (-653.005) -- 0:01:31
52500 -- (-642.955) (-641.616) [-641.253] (-654.684) * [-646.373] (-653.217) (-662.890) (-650.431) -- 0:01:30
53000 -- [-647.059] (-644.398) (-660.715) (-656.291) * (-645.257) [-640.360] (-653.336) (-655.771) -- 0:01:29
53500 -- [-646.175] (-645.025) (-668.189) (-650.151) * (-652.056) (-642.357) (-643.476) [-646.774] -- 0:01:28
54000 -- [-644.452] (-644.845) (-654.271) (-663.904) * (-642.902) [-641.067] (-656.019) (-657.062) -- 0:01:27
54500 -- (-648.339) (-641.003) [-641.935] (-643.895) * (-654.558) [-636.636] (-657.503) (-647.813) -- 0:01:26
55000 -- (-645.652) (-641.839) [-662.378] (-644.507) * [-640.907] (-645.342) (-663.171) (-644.735) -- 0:01:25
Average standard deviation of split frequencies: 0.036773
55500 -- (-650.533) [-641.709] (-656.218) (-641.487) * (-645.632) (-645.152) (-655.207) [-640.302] -- 0:01:25
56000 -- (-659.638) [-645.459] (-658.172) (-639.745) * [-639.743] (-647.511) (-650.845) (-645.043) -- 0:01:24
56500 -- [-655.602] (-652.898) (-652.719) (-655.163) * [-644.642] (-649.209) (-659.379) (-643.897) -- 0:01:23
57000 -- (-662.391) [-648.050] (-654.762) (-647.630) * [-640.383] (-643.035) (-642.446) (-641.432) -- 0:01:22
57500 -- [-652.645] (-648.309) (-663.196) (-653.746) * (-640.172) (-646.862) (-646.059) [-641.709] -- 0:01:21
58000 -- (-662.487) [-642.590] (-653.899) (-658.543) * [-637.369] (-645.270) (-648.525) (-640.421) -- 0:01:21
58500 -- (-657.821) [-643.721] (-656.072) (-654.472) * (-656.793) [-654.382] (-648.533) (-646.757) -- 0:01:20
59000 -- (-664.000) [-638.705] (-656.384) (-662.390) * (-642.049) (-642.559) (-649.751) [-636.832] -- 0:01:19
59500 -- (-671.014) (-642.435) (-656.767) [-653.854] * (-638.822) [-640.975] (-657.489) (-642.905) -- 0:01:34
60000 -- (-655.401) [-641.731] (-648.731) (-662.013) * [-643.167] (-660.039) (-643.208) (-645.420) -- 0:01:34
Average standard deviation of split frequencies: 0.033824
60500 -- (-648.154) [-638.812] (-646.713) (-645.361) * (-654.333) (-646.429) (-642.069) [-649.397] -- 0:01:33
61000 -- (-659.293) [-636.057] (-641.583) (-655.940) * (-648.798) (-641.197) [-644.415] (-654.008) -- 0:01:32
61500 -- (-644.738) (-639.136) (-648.814) [-640.530] * (-641.903) [-636.888] (-652.065) (-654.154) -- 0:01:31
62000 -- (-658.913) [-642.682] (-663.366) (-638.855) * [-643.545] (-648.669) (-644.139) (-645.736) -- 0:01:30
62500 -- (-657.184) [-639.695] (-642.500) (-649.910) * [-644.971] (-644.708) (-646.672) (-651.087) -- 0:01:30
63000 -- (-650.925) (-642.331) [-645.129] (-639.918) * (-644.551) (-643.136) [-648.797] (-654.058) -- 0:01:29
63500 -- (-659.299) (-647.225) [-639.047] (-662.283) * (-641.474) (-655.913) [-646.255] (-646.284) -- 0:01:28
64000 -- (-650.497) [-644.277] (-643.143) (-654.530) * (-646.744) [-661.200] (-646.037) (-648.312) -- 0:01:27
64500 -- (-649.474) (-650.060) [-640.579] (-653.545) * (-639.817) [-647.533] (-649.128) (-658.967) -- 0:01:27
65000 -- (-643.959) [-639.391] (-642.373) (-637.416) * (-646.981) (-656.374) (-647.902) [-647.270] -- 0:01:26
Average standard deviation of split frequencies: 0.032651
65500 -- (-651.165) [-645.314] (-647.779) (-643.096) * (-649.407) (-651.544) [-652.904] (-647.582) -- 0:01:25
66000 -- (-646.749) [-641.278] (-643.115) (-640.819) * (-648.549) [-646.513] (-641.651) (-647.930) -- 0:01:24
66500 -- (-649.317) (-634.648) [-641.678] (-652.626) * (-646.814) (-658.617) (-645.486) [-641.293] -- 0:01:24
67000 -- (-654.583) [-647.343] (-646.189) (-650.909) * (-647.914) (-651.242) (-650.725) [-643.750] -- 0:01:23
67500 -- (-650.210) [-639.742] (-648.803) (-664.144) * [-644.364] (-654.133) (-653.262) (-644.323) -- 0:01:22
68000 -- (-656.948) (-643.352) (-652.532) [-637.497] * [-642.230] (-659.569) (-642.822) (-651.001) -- 0:01:22
68500 -- (-667.662) (-647.951) (-648.921) [-647.157] * (-646.033) (-657.679) (-646.406) [-656.274] -- 0:01:21
69000 -- (-649.843) (-643.273) [-644.011] (-645.431) * (-646.500) [-640.466] (-647.807) (-652.401) -- 0:01:20
69500 -- (-644.124) [-639.525] (-656.271) (-649.486) * (-652.714) (-665.161) (-642.361) [-656.490] -- 0:01:20
70000 -- (-652.632) [-640.205] (-661.628) (-638.766) * (-648.905) (-644.791) [-652.394] (-657.840) -- 0:01:19
Average standard deviation of split frequencies: 0.028685
70500 -- (-645.501) (-643.909) [-640.723] (-648.786) * [-641.189] (-646.556) (-642.534) (-656.701) -- 0:01:19
71000 -- (-639.146) (-640.872) [-645.326] (-642.486) * [-643.931] (-644.648) (-659.635) (-665.217) -- 0:01:31
71500 -- (-650.482) (-645.371) (-651.949) [-645.187] * [-646.994] (-650.682) (-645.921) (-651.769) -- 0:01:30
72000 -- (-665.422) (-641.249) [-651.896] (-649.375) * (-651.263) [-641.746] (-648.436) (-654.339) -- 0:01:30
72500 -- [-650.760] (-645.587) (-650.631) (-644.989) * (-646.767) (-642.874) (-658.175) [-656.155] -- 0:01:29
73000 -- (-673.345) [-642.626] (-648.331) (-647.678) * (-644.101) [-643.793] (-664.562) (-652.049) -- 0:01:28
73500 -- (-648.451) [-638.148] (-649.934) (-653.580) * (-645.438) (-650.051) [-649.288] (-653.204) -- 0:01:28
74000 -- (-658.072) [-644.218] (-655.771) (-644.104) * (-645.004) [-644.579] (-645.783) (-654.569) -- 0:01:27
74500 -- (-647.993) [-648.430] (-645.899) (-643.513) * (-649.752) [-638.648] (-646.229) (-656.368) -- 0:01:26
75000 -- (-642.801) (-639.923) [-643.957] (-646.719) * [-643.060] (-656.140) (-647.578) (-653.379) -- 0:01:26
Average standard deviation of split frequencies: 0.032786
75500 -- (-652.493) [-639.805] (-644.575) (-655.743) * (-638.586) [-645.525] (-652.786) (-645.441) -- 0:01:25
76000 -- (-650.778) (-645.582) (-644.332) [-654.931] * [-645.334] (-643.764) (-654.665) (-643.236) -- 0:01:25
76500 -- (-647.606) [-643.924] (-642.576) (-656.716) * [-640.871] (-647.464) (-655.815) (-643.395) -- 0:01:24
77000 -- (-640.801) (-643.085) [-648.385] (-657.890) * [-649.065] (-655.126) (-654.281) (-648.997) -- 0:01:23
77500 -- [-644.502] (-644.148) (-639.605) (-668.587) * [-640.883] (-650.142) (-649.642) (-642.930) -- 0:01:23
78000 -- (-644.474) [-641.117] (-647.403) (-659.534) * [-645.332] (-647.865) (-654.517) (-650.518) -- 0:01:22
78500 -- (-642.914) [-645.215] (-646.250) (-671.397) * (-649.950) [-649.094] (-651.643) (-662.617) -- 0:01:22
79000 -- (-651.276) (-640.933) [-647.361] (-660.854) * (-650.066) (-646.936) [-656.363] (-661.731) -- 0:01:21
79500 -- (-654.635) [-648.344] (-647.900) (-646.607) * (-652.069) (-644.266) [-648.315] (-656.587) -- 0:01:21
80000 -- (-648.042) [-651.792] (-640.330) (-659.771) * (-652.032) [-640.346] (-659.048) (-654.307) -- 0:01:20
Average standard deviation of split frequencies: 0.035388
80500 -- (-643.653) [-644.398] (-649.355) (-659.078) * (-647.393) [-654.072] (-646.347) (-655.854) -- 0:01:19
81000 -- (-655.039) (-646.500) [-647.002] (-647.749) * (-641.869) (-658.826) (-643.809) [-641.955] -- 0:01:19
81500 -- (-657.673) (-650.321) (-660.136) [-646.509] * (-652.604) (-656.543) (-646.162) [-641.916] -- 0:01:18
82000 -- (-656.120) [-642.640] (-646.045) (-643.283) * (-648.885) (-654.123) [-644.278] (-646.793) -- 0:01:29
82500 -- (-654.752) [-645.559] (-660.163) (-652.519) * (-645.138) [-647.470] (-649.694) (-647.105) -- 0:01:28
83000 -- (-648.458) [-638.230] (-656.375) (-651.738) * (-662.306) [-642.672] (-652.371) (-651.305) -- 0:01:28
83500 -- (-660.616) [-643.973] (-653.258) (-644.883) * (-651.432) [-645.505] (-655.273) (-647.597) -- 0:01:27
84000 -- (-650.214) [-642.150] (-652.186) (-656.095) * (-646.974) (-638.801) [-656.140] (-650.448) -- 0:01:27
84500 -- (-652.790) [-645.184] (-646.219) (-647.774) * (-653.274) [-643.257] (-657.141) (-645.136) -- 0:01:26
85000 -- (-654.511) [-644.601] (-647.170) (-639.969) * (-648.329) (-662.377) (-665.038) [-649.998] -- 0:01:26
Average standard deviation of split frequencies: 0.032023
85500 -- (-647.364) (-646.628) [-639.229] (-651.230) * (-656.179) (-654.405) (-655.233) [-650.668] -- 0:01:25
86000 -- (-667.888) (-647.875) [-646.094] (-644.008) * (-651.318) (-650.900) (-653.719) [-647.164] -- 0:01:25
86500 -- (-651.861) (-646.834) [-650.060] (-644.798) * [-646.214] (-656.413) (-645.969) (-640.980) -- 0:01:24
87000 -- (-652.989) (-644.002) (-642.941) [-641.992] * (-658.381) (-645.070) (-654.534) [-641.477] -- 0:01:23
87500 -- (-657.901) (-653.506) (-646.035) [-641.960] * (-656.209) (-656.475) (-657.455) [-649.805] -- 0:01:23
88000 -- [-641.152] (-648.566) (-642.814) (-649.801) * [-645.260] (-647.606) (-650.300) (-655.091) -- 0:01:22
88500 -- [-644.147] (-652.474) (-641.733) (-646.992) * (-651.650) (-643.856) [-646.103] (-660.253) -- 0:01:22
89000 -- (-648.287) (-649.425) [-645.122] (-646.277) * [-648.111] (-646.620) (-643.507) (-651.078) -- 0:01:21
89500 -- (-649.370) (-648.274) (-643.734) [-644.187] * (-655.553) [-652.686] (-644.228) (-648.265) -- 0:01:21
90000 -- (-648.148) (-656.371) [-643.488] (-644.728) * (-654.345) [-644.712] (-658.928) (-649.530) -- 0:01:20
Average standard deviation of split frequencies: 0.026257
90500 -- (-645.973) (-660.006) (-641.657) [-640.265] * (-654.661) (-659.120) [-646.367] (-646.423) -- 0:01:20
91000 -- (-648.559) (-652.502) (-642.998) [-637.776] * [-642.058] (-646.951) (-646.411) (-664.077) -- 0:01:19
91500 -- (-647.411) (-655.516) (-647.619) [-646.730] * (-643.659) [-642.846] (-652.064) (-647.939) -- 0:01:19
92000 -- (-647.544) (-651.880) (-643.363) [-639.158] * [-641.973] (-646.788) (-641.996) (-661.532) -- 0:01:18
92500 -- (-649.593) (-645.842) (-644.819) [-642.132] * (-646.806) (-647.207) (-651.357) [-643.162] -- 0:01:18
93000 -- (-643.569) (-649.858) (-647.548) [-637.685] * (-655.990) (-646.532) (-660.926) [-644.999] -- 0:01:18
93500 -- (-657.896) [-651.666] (-642.434) (-643.138) * (-659.085) [-650.797] (-648.201) (-643.172) -- 0:01:27
94000 -- (-662.218) [-642.703] (-658.005) (-639.809) * (-654.989) [-645.555] (-647.657) (-639.144) -- 0:01:26
94500 -- (-643.292) (-656.476) (-654.250) [-646.666] * (-662.386) (-654.503) (-645.099) [-635.356] -- 0:01:26
95000 -- (-646.607) [-646.843] (-646.992) (-644.037) * (-662.869) (-650.558) [-650.935] (-645.239) -- 0:01:25
Average standard deviation of split frequencies: 0.026025
95500 -- [-646.856] (-642.316) (-655.016) (-654.342) * (-659.154) (-646.652) (-641.506) [-649.933] -- 0:01:25
96000 -- (-645.205) (-652.097) [-642.778] (-655.842) * (-657.734) (-652.521) (-646.905) [-638.951] -- 0:01:24
96500 -- [-646.475] (-655.997) (-643.617) (-649.727) * (-664.281) (-652.924) [-650.279] (-641.266) -- 0:01:24
97000 -- (-648.695) [-641.744] (-650.799) (-656.801) * (-657.927) (-639.743) (-646.014) [-641.729] -- 0:01:23
97500 -- (-647.116) [-642.209] (-657.801) (-651.405) * (-666.597) [-641.638] (-652.967) (-641.267) -- 0:01:23
98000 -- [-653.649] (-654.963) (-645.667) (-663.339) * (-669.286) [-650.324] (-639.689) (-644.874) -- 0:01:22
98500 -- (-649.703) (-647.483) [-643.211] (-653.660) * (-646.368) (-644.737) (-645.804) [-645.012] -- 0:01:22
99000 -- (-653.334) (-647.572) (-651.518) [-646.735] * (-654.288) (-640.393) (-655.493) [-641.121] -- 0:01:21
99500 -- [-638.822] (-656.704) (-659.435) (-651.675) * (-648.794) [-649.425] (-653.671) (-638.208) -- 0:01:21
100000 -- (-642.888) (-659.194) [-638.470] (-660.802) * (-656.961) (-640.872) (-653.179) [-643.949] -- 0:01:21
Average standard deviation of split frequencies: 0.024585
100500 -- [-640.485] (-653.147) (-653.827) (-650.692) * (-651.368) (-647.735) (-653.053) [-636.316] -- 0:01:20
101000 -- (-647.995) (-656.047) (-657.612) [-640.387] * (-649.973) (-648.010) [-652.654] (-646.896) -- 0:01:20
101500 -- [-639.621] (-653.243) (-657.865) (-649.296) * (-651.301) (-644.884) (-652.790) [-643.528] -- 0:01:19
102000 -- (-637.921) (-663.287) [-643.945] (-651.123) * (-653.713) (-646.407) (-643.535) [-643.771] -- 0:01:19
102500 -- [-644.424] (-647.771) (-659.944) (-661.544) * (-649.613) [-641.437] (-651.323) (-643.088) -- 0:01:18
103000 -- [-639.604] (-656.043) (-663.373) (-660.535) * (-647.530) (-653.345) [-651.333] (-645.690) -- 0:01:18
103500 -- [-640.288] (-640.346) (-647.248) (-643.941) * (-645.559) [-642.627] (-654.219) (-641.000) -- 0:01:17
104000 -- (-641.273) (-646.586) (-669.191) [-649.325] * (-645.264) (-657.803) (-646.768) [-638.628] -- 0:01:17
104500 -- (-651.312) (-645.242) [-644.956] (-646.326) * (-646.313) (-653.734) (-655.446) [-635.651] -- 0:01:25
105000 -- [-640.155] (-647.814) (-651.005) (-646.016) * [-654.979] (-654.112) (-647.113) (-649.436) -- 0:01:25
Average standard deviation of split frequencies: 0.026048
105500 -- [-644.728] (-650.109) (-645.528) (-663.923) * [-644.366] (-640.659) (-658.523) (-647.390) -- 0:01:24
106000 -- (-648.253) [-652.720] (-659.858) (-652.738) * (-660.834) [-642.873] (-650.507) (-644.086) -- 0:01:24
106500 -- (-651.777) [-641.280] (-653.680) (-654.642) * (-647.411) (-654.627) (-652.062) [-637.689] -- 0:01:23
107000 -- (-652.824) [-640.289] (-660.624) (-644.845) * (-647.645) (-644.882) (-645.138) [-634.896] -- 0:01:23
107500 -- [-643.863] (-650.319) (-657.415) (-646.149) * (-647.485) (-638.654) (-662.713) [-638.079] -- 0:01:23
108000 -- (-645.338) (-658.899) (-653.342) [-643.564] * (-639.508) (-643.379) (-647.710) [-641.210] -- 0:01:22
108500 -- (-663.694) (-650.257) (-657.588) [-643.934] * (-651.972) (-653.448) (-656.112) [-641.133] -- 0:01:22
109000 -- (-645.714) [-647.207] (-653.414) (-641.142) * (-654.674) [-649.100] (-665.931) (-647.645) -- 0:01:21
109500 -- (-651.488) (-656.774) (-648.040) [-645.317] * (-656.442) (-647.826) (-655.736) [-640.958] -- 0:01:21
110000 -- (-647.474) [-657.744] (-649.440) (-653.173) * (-652.303) [-641.191] (-659.453) (-644.211) -- 0:01:20
Average standard deviation of split frequencies: 0.024885
110500 -- (-653.250) (-657.934) [-647.250] (-649.569) * (-642.625) (-642.758) (-658.157) [-637.993] -- 0:01:20
111000 -- (-655.859) (-651.099) [-643.597] (-653.222) * [-647.544] (-644.833) (-654.360) (-641.127) -- 0:01:20
111500 -- (-665.119) (-663.547) [-641.675] (-648.249) * (-653.775) (-643.831) (-650.011) [-643.793] -- 0:01:19
112000 -- (-651.943) (-661.671) (-647.478) [-648.148] * (-650.053) (-645.691) (-655.795) [-638.150] -- 0:01:19
112500 -- (-653.171) [-648.302] (-652.298) (-653.544) * (-652.211) (-641.565) (-651.002) [-640.109] -- 0:01:18
113000 -- (-658.348) (-649.276) [-648.578] (-656.636) * (-648.623) (-642.962) (-654.365) [-644.770] -- 0:01:18
113500 -- (-656.467) (-649.900) [-649.233] (-641.684) * (-641.625) (-650.732) (-642.437) [-640.933] -- 0:01:18
114000 -- (-661.350) (-655.792) [-652.847] (-647.906) * (-647.857) [-642.215] (-651.297) (-641.859) -- 0:01:17
114500 -- (-652.026) (-649.706) (-641.364) [-641.831] * (-651.332) (-643.073) (-647.638) [-638.766] -- 0:01:17
115000 -- (-662.241) (-650.309) [-646.357] (-639.557) * (-640.841) (-639.196) (-644.021) [-637.793] -- 0:01:16
Average standard deviation of split frequencies: 0.022577
115500 -- (-653.583) (-660.633) [-642.822] (-643.031) * (-654.480) (-645.199) (-646.277) [-643.944] -- 0:01:16
116000 -- [-642.776] (-654.405) (-641.806) (-655.303) * [-646.676] (-652.396) (-646.473) (-636.897) -- 0:01:23
116500 -- (-647.571) (-657.622) [-646.933] (-650.941) * (-650.103) (-650.860) [-642.651] (-642.552) -- 0:01:23
117000 -- [-642.516] (-648.661) (-646.811) (-651.167) * (-654.766) (-660.566) (-642.317) [-643.727] -- 0:01:23
117500 -- (-650.250) (-659.921) (-650.269) [-653.314] * [-654.292] (-660.273) (-651.663) (-649.580) -- 0:01:22
118000 -- (-657.764) (-654.740) [-638.968] (-645.611) * (-659.089) [-645.772] (-651.456) (-642.946) -- 0:01:22
118500 -- (-661.610) (-648.479) [-645.252] (-641.047) * (-661.932) (-652.486) (-654.089) [-646.091] -- 0:01:21
119000 -- (-659.850) (-648.385) [-639.725] (-651.937) * (-651.405) [-645.977] (-654.761) (-641.403) -- 0:01:21
119500 -- (-656.792) (-654.386) [-644.512] (-645.971) * (-643.846) [-640.177] (-648.186) (-649.049) -- 0:01:21
120000 -- (-658.617) (-651.494) [-644.891] (-646.183) * (-644.105) (-645.039) (-656.842) [-637.787] -- 0:01:20
Average standard deviation of split frequencies: 0.020401
120500 -- (-656.321) [-647.329] (-647.258) (-646.140) * [-642.577] (-647.911) (-655.990) (-639.490) -- 0:01:20
121000 -- (-656.517) (-646.216) [-643.490] (-651.707) * (-646.423) (-640.387) [-640.990] (-645.686) -- 0:01:19
121500 -- (-648.845) (-654.246) (-654.869) [-643.343] * (-646.521) [-652.884] (-663.157) (-644.723) -- 0:01:19
122000 -- (-643.136) (-660.512) (-643.460) [-646.689] * (-653.851) (-652.491) (-646.313) [-646.728] -- 0:01:19
122500 -- [-650.175] (-650.970) (-643.840) (-663.280) * (-649.896) (-660.375) (-656.584) [-637.368] -- 0:01:18
123000 -- [-648.688] (-652.827) (-648.043) (-654.553) * [-648.186] (-650.240) (-649.011) (-634.797) -- 0:01:18
123500 -- (-663.167) (-653.728) [-642.698] (-644.064) * (-642.651) (-648.402) (-645.877) [-646.322] -- 0:01:18
124000 -- (-655.918) (-657.221) (-659.766) [-647.548] * (-654.959) (-647.724) (-661.832) [-645.585] -- 0:01:17
124500 -- [-645.091] (-653.056) (-654.598) (-643.759) * (-649.563) (-655.643) (-653.660) [-644.386] -- 0:01:17
125000 -- (-661.103) (-660.154) (-660.150) [-647.334] * [-640.545] (-656.906) (-651.342) (-647.245) -- 0:01:17
Average standard deviation of split frequencies: 0.017771
125500 -- (-654.401) (-659.313) (-658.794) [-640.333] * (-644.388) (-657.252) (-641.743) [-642.517] -- 0:01:16
126000 -- (-645.016) (-642.911) [-638.995] (-651.853) * [-639.716] (-647.156) (-650.607) (-646.020) -- 0:01:16
126500 -- (-647.730) [-647.528] (-651.761) (-648.468) * (-647.310) (-646.989) (-646.285) [-642.922] -- 0:01:15
127000 -- [-655.865] (-663.629) (-655.153) (-640.599) * (-652.587) [-646.664] (-653.792) (-637.059) -- 0:01:22
127500 -- (-653.460) (-657.501) (-649.654) [-654.790] * (-663.284) (-660.931) (-649.342) [-640.441] -- 0:01:22
128000 -- (-654.249) (-649.747) (-661.127) [-648.000] * (-646.926) (-660.905) (-655.943) [-642.686] -- 0:01:21
128500 -- [-651.793] (-643.977) (-663.386) (-660.491) * (-664.425) (-652.023) (-649.132) [-639.893] -- 0:01:21
129000 -- (-649.680) [-644.919] (-654.867) (-658.077) * (-657.032) [-647.503] (-653.788) (-641.643) -- 0:01:21
129500 -- (-654.130) (-648.679) (-649.269) [-647.862] * [-651.482] (-647.889) (-647.974) (-644.411) -- 0:01:20
130000 -- (-648.811) (-644.720) (-650.551) [-648.329] * (-655.371) (-652.447) (-646.523) [-639.280] -- 0:01:20
Average standard deviation of split frequencies: 0.019948
130500 -- [-641.538] (-645.672) (-649.815) (-651.302) * (-655.833) (-650.596) (-657.367) [-635.664] -- 0:01:19
131000 -- [-653.066] (-645.379) (-652.989) (-649.636) * (-657.819) [-641.361] (-649.114) (-645.079) -- 0:01:19
131500 -- [-641.581] (-651.982) (-656.620) (-647.982) * (-659.452) (-648.682) [-640.767] (-641.709) -- 0:01:19
132000 -- [-638.923] (-646.101) (-655.074) (-650.408) * (-658.729) [-639.397] (-658.883) (-652.748) -- 0:01:18
132500 -- (-642.764) [-647.548] (-655.714) (-666.400) * (-655.602) [-642.083] (-665.529) (-639.952) -- 0:01:18
133000 -- (-643.025) [-649.557] (-651.995) (-660.830) * (-654.214) (-653.534) [-643.569] (-638.326) -- 0:01:18
133500 -- (-653.918) [-644.338] (-645.767) (-656.493) * (-656.907) (-651.443) [-649.559] (-642.212) -- 0:01:17
134000 -- (-648.369) (-656.277) (-659.249) [-643.972] * (-652.885) [-639.000] (-653.929) (-641.691) -- 0:01:17
134500 -- (-649.793) (-648.558) [-642.849] (-647.393) * [-649.954] (-647.794) (-666.362) (-640.775) -- 0:01:17
135000 -- (-650.974) (-654.202) [-651.600] (-644.362) * (-644.463) [-647.327] (-657.966) (-649.593) -- 0:01:16
Average standard deviation of split frequencies: 0.018758
135500 -- (-643.769) (-650.178) [-644.632] (-659.866) * (-643.933) (-654.933) (-663.778) [-641.704] -- 0:01:16
136000 -- [-644.728] (-653.004) (-649.207) (-652.281) * [-642.249] (-643.590) (-656.153) (-636.650) -- 0:01:16
136500 -- (-652.600) (-650.514) [-641.933] (-649.735) * (-643.528) [-642.628] (-649.202) (-639.720) -- 0:01:15
137000 -- (-654.241) [-643.102] (-643.583) (-651.495) * (-658.003) [-647.272] (-648.805) (-644.986) -- 0:01:15
137500 -- (-656.961) [-642.521] (-648.906) (-646.369) * (-668.125) (-653.167) (-661.175) [-639.461] -- 0:01:15
138000 -- (-650.679) (-658.906) (-652.016) [-642.826] * (-653.039) (-656.949) (-662.767) [-647.455] -- 0:01:14
138500 -- (-657.123) (-664.078) (-645.920) [-653.138] * (-650.150) (-654.453) (-656.482) [-643.895] -- 0:01:20
139000 -- (-660.254) (-654.177) (-650.834) [-651.553] * [-647.207] (-655.241) (-659.553) (-635.604) -- 0:01:20
139500 -- (-645.786) (-655.083) (-650.523) [-643.600] * (-642.371) (-643.383) (-651.891) [-644.348] -- 0:01:20
140000 -- (-650.698) (-655.973) (-646.014) [-640.606] * (-654.135) (-659.998) (-659.249) [-641.477] -- 0:01:19
Average standard deviation of split frequencies: 0.019122
140500 -- [-658.969] (-658.993) (-652.451) (-640.791) * (-652.226) [-648.828] (-660.071) (-641.228) -- 0:01:19
141000 -- [-649.655] (-647.524) (-648.125) (-646.794) * (-659.173) [-640.209] (-662.070) (-640.694) -- 0:01:19
141500 -- [-651.473] (-656.336) (-642.534) (-642.552) * [-650.197] (-641.718) (-655.366) (-637.822) -- 0:01:18
142000 -- (-646.956) (-645.719) (-654.914) [-650.868] * (-647.374) (-655.188) (-653.333) [-644.639] -- 0:01:18
142500 -- (-647.273) (-652.251) (-659.087) [-644.685] * [-640.992] (-648.051) (-649.778) (-643.141) -- 0:01:18
143000 -- (-647.318) (-652.520) (-653.089) [-640.120] * [-642.029] (-646.823) (-638.530) (-643.423) -- 0:01:17
143500 -- (-657.399) (-651.326) (-642.910) [-638.219] * [-648.334] (-650.019) (-644.709) (-640.313) -- 0:01:17
144000 -- (-654.578) [-647.076] (-647.248) (-656.807) * (-658.919) (-647.757) (-648.269) [-645.910] -- 0:01:17
144500 -- (-656.683) (-648.744) (-641.803) [-647.115] * (-657.209) (-655.101) (-643.412) [-639.051] -- 0:01:16
145000 -- (-644.317) (-657.821) (-648.547) [-642.903] * (-657.767) (-659.682) (-652.975) [-642.033] -- 0:01:16
Average standard deviation of split frequencies: 0.019183
145500 -- (-650.241) (-651.798) [-650.346] (-645.691) * (-666.821) [-647.915] (-647.564) (-640.514) -- 0:01:16
146000 -- (-657.747) (-652.428) (-649.299) [-650.328] * (-651.635) (-645.360) (-651.623) [-635.029] -- 0:01:16
146500 -- [-650.025] (-660.236) (-642.430) (-646.952) * (-657.763) (-649.938) (-649.769) [-644.662] -- 0:01:15
147000 -- (-644.377) (-651.696) [-649.281] (-657.360) * (-657.155) (-653.411) (-646.208) [-634.925] -- 0:01:15
147500 -- (-648.926) (-652.794) [-645.848] (-645.923) * (-654.750) (-643.393) (-645.353) [-641.034] -- 0:01:15
148000 -- (-651.201) [-646.353] (-649.611) (-652.856) * (-656.178) (-655.123) (-644.175) [-640.579] -- 0:01:14
148500 -- (-648.540) (-668.622) [-642.634] (-650.144) * (-662.087) (-656.063) (-648.468) [-638.921] -- 0:01:14
149000 -- (-645.772) (-647.804) (-651.201) [-645.409] * (-656.756) (-652.736) (-645.309) [-640.711] -- 0:01:14
149500 -- [-640.966] (-649.165) (-652.759) (-652.407) * (-660.452) (-665.684) (-652.007) [-643.174] -- 0:01:13
150000 -- [-647.747] (-652.795) (-648.529) (-645.111) * (-660.807) (-657.472) (-664.954) [-639.852] -- 0:01:19
Average standard deviation of split frequencies: 0.017035
150500 -- (-657.643) (-646.186) (-656.643) [-644.588] * (-642.645) (-659.605) (-652.543) [-640.420] -- 0:01:19
151000 -- (-655.648) (-656.400) (-645.108) [-644.000] * [-651.568] (-662.823) (-660.919) (-642.763) -- 0:01:18
151500 -- (-652.360) [-657.774] (-649.551) (-644.864) * [-642.905] (-657.759) (-651.102) (-648.643) -- 0:01:18
152000 -- [-642.793] (-651.198) (-649.587) (-643.035) * (-646.692) (-650.753) (-653.378) [-654.739] -- 0:01:18
152500 -- (-656.268) [-646.933] (-650.087) (-646.395) * (-647.399) (-644.721) (-651.496) [-641.188] -- 0:01:17
153000 -- [-651.244] (-643.803) (-652.692) (-638.020) * (-649.307) [-642.074] (-652.512) (-647.519) -- 0:01:17
153500 -- (-644.385) (-667.274) (-647.779) [-642.238] * (-650.809) (-643.777) (-643.988) [-640.904] -- 0:01:17
154000 -- (-648.421) (-648.434) (-648.504) [-639.567] * (-664.036) (-647.263) [-646.361] (-652.094) -- 0:01:16
154500 -- (-653.286) (-645.205) (-649.817) [-637.902] * (-660.434) (-637.627) (-651.107) [-642.072] -- 0:01:16
155000 -- (-653.591) (-646.816) (-644.794) [-638.080] * (-657.049) [-642.797] (-644.256) (-643.689) -- 0:01:16
Average standard deviation of split frequencies: 0.016284
155500 -- (-657.738) (-647.074) [-651.808] (-643.434) * (-647.355) (-642.710) [-646.733] (-640.585) -- 0:01:16
156000 -- (-653.342) (-647.680) (-646.023) [-636.307] * (-663.438) [-646.505] (-656.449) (-656.909) -- 0:01:15
156500 -- (-652.630) (-649.734) (-648.512) [-635.860] * (-657.001) [-640.500] (-649.061) (-650.312) -- 0:01:15
157000 -- (-654.759) (-651.521) (-657.425) [-641.602] * (-651.894) [-643.954] (-653.322) (-656.248) -- 0:01:15
157500 -- (-646.473) (-644.129) (-642.828) [-644.817] * [-643.201] (-645.060) (-648.087) (-650.971) -- 0:01:14
158000 -- (-647.085) (-649.847) [-647.721] (-645.339) * (-654.321) (-640.787) (-651.060) [-642.445] -- 0:01:14
158500 -- [-652.970] (-644.533) (-654.968) (-645.385) * (-639.934) (-657.880) [-647.071] (-641.162) -- 0:01:14
159000 -- (-649.575) (-652.587) [-650.742] (-652.319) * [-648.385] (-654.035) (-647.442) (-651.862) -- 0:01:14
159500 -- [-651.705] (-655.878) (-643.957) (-648.846) * (-650.421) (-653.691) [-646.672] (-643.749) -- 0:01:13
160000 -- (-647.750) (-654.350) (-647.811) [-641.880] * (-651.605) (-655.065) [-644.365] (-640.429) -- 0:01:13
Average standard deviation of split frequencies: 0.016626
160500 -- (-667.493) [-644.119] (-644.885) (-651.413) * (-656.059) (-651.802) [-643.692] (-648.863) -- 0:01:13
161000 -- (-657.427) [-648.691] (-638.047) (-652.377) * (-649.054) (-639.848) (-643.563) [-650.129] -- 0:01:12
161500 -- (-650.608) [-645.699] (-637.203) (-666.494) * (-664.398) (-659.753) [-643.998] (-641.583) -- 0:01:17
162000 -- (-641.069) [-640.984] (-646.530) (-641.278) * (-649.675) (-664.129) [-644.133] (-645.294) -- 0:01:17
162500 -- (-657.381) (-642.761) [-645.996] (-643.792) * [-646.444] (-647.187) (-654.383) (-658.260) -- 0:01:17
163000 -- (-663.476) [-650.124] (-642.428) (-651.291) * (-652.562) (-648.580) (-646.289) [-643.374] -- 0:01:17
163500 -- (-648.513) (-643.111) (-643.952) [-650.025] * (-649.832) (-651.613) [-642.654] (-647.979) -- 0:01:16
164000 -- (-652.883) [-643.743] (-658.136) (-651.915) * (-663.893) [-640.139] (-646.184) (-647.887) -- 0:01:16
164500 -- (-655.101) (-664.269) (-641.237) [-656.490] * [-649.837] (-644.638) (-646.040) (-647.542) -- 0:01:16
165000 -- (-651.413) (-653.341) (-657.839) [-642.864] * (-657.565) (-647.211) (-644.002) [-644.833] -- 0:01:15
Average standard deviation of split frequencies: 0.017985
165500 -- (-650.051) (-644.502) (-651.027) [-640.687] * (-645.306) [-646.629] (-643.847) (-652.699) -- 0:01:15
166000 -- (-657.963) [-641.261] (-656.747) (-640.838) * [-644.695] (-648.788) (-658.142) (-653.278) -- 0:01:15
166500 -- (-649.487) [-644.675] (-647.444) (-654.014) * (-644.256) (-654.677) [-641.576] (-649.560) -- 0:01:15
167000 -- [-652.910] (-654.324) (-646.627) (-653.237) * (-642.559) [-649.838] (-646.767) (-651.373) -- 0:01:14
167500 -- (-654.247) [-642.584] (-643.669) (-647.785) * [-648.644] (-640.649) (-648.677) (-649.659) -- 0:01:14
168000 -- (-649.084) [-643.793] (-644.008) (-646.471) * (-651.647) (-661.068) (-648.200) [-642.039] -- 0:01:14
168500 -- (-652.717) (-646.645) (-652.258) [-640.798] * (-644.610) (-658.761) [-639.369] (-650.774) -- 0:01:14
169000 -- (-651.860) (-654.459) [-651.216] (-649.085) * (-655.209) (-651.131) [-641.347] (-647.888) -- 0:01:13
169500 -- (-653.410) (-643.031) [-648.965] (-641.918) * (-651.278) (-654.937) [-639.632] (-645.491) -- 0:01:13
170000 -- (-655.489) (-644.906) [-638.874] (-647.445) * (-649.350) (-648.129) [-639.349] (-654.104) -- 0:01:13
Average standard deviation of split frequencies: 0.017954
170500 -- (-644.253) (-648.687) (-648.344) [-643.658] * (-655.745) (-647.780) [-644.095] (-654.922) -- 0:01:12
171000 -- (-646.826) (-649.493) (-644.974) [-637.957] * (-656.558) (-642.849) [-642.746] (-661.657) -- 0:01:12
171500 -- (-647.632) (-645.276) (-648.507) [-644.908] * (-654.842) [-651.414] (-651.045) (-650.985) -- 0:01:12
172000 -- (-657.112) (-649.727) (-649.068) [-640.657] * (-654.629) (-646.176) [-643.238] (-642.028) -- 0:01:12
172500 -- (-652.131) (-646.026) (-643.233) [-644.266] * (-643.530) (-645.847) (-646.981) [-640.686] -- 0:01:11
173000 -- (-653.925) (-645.426) (-658.891) [-642.888] * (-639.908) [-641.105] (-641.291) (-649.375) -- 0:01:16
173500 -- (-641.495) [-639.413] (-655.553) (-646.414) * (-656.703) (-649.977) (-641.298) [-640.595] -- 0:01:16
174000 -- [-646.989] (-641.465) (-656.634) (-647.222) * (-649.305) (-654.048) [-640.133] (-640.152) -- 0:01:15
174500 -- (-645.844) [-641.807] (-659.187) (-640.358) * (-645.239) (-655.183) [-640.052] (-652.010) -- 0:01:15
175000 -- (-641.949) (-651.213) (-647.935) [-636.221] * (-654.110) (-648.412) [-638.739] (-652.808) -- 0:01:15
Average standard deviation of split frequencies: 0.018749
175500 -- (-656.707) (-644.603) (-669.971) [-640.284] * (-659.111) [-648.540] (-637.957) (-654.426) -- 0:01:15
176000 -- (-664.272) (-650.107) (-661.666) [-639.771] * (-652.343) (-658.865) [-648.902] (-652.731) -- 0:01:14
176500 -- (-646.390) (-646.277) (-644.177) [-653.660] * [-645.656] (-663.381) (-648.144) (-652.512) -- 0:01:14
177000 -- (-652.558) (-645.337) [-649.158] (-641.038) * (-651.095) (-654.441) (-647.834) [-648.734] -- 0:01:14
177500 -- (-653.785) (-640.095) [-644.308] (-638.825) * (-651.856) (-650.361) [-642.900] (-641.321) -- 0:01:14
178000 -- (-648.251) (-640.357) (-652.662) [-642.151] * (-643.988) (-652.106) [-639.352] (-653.201) -- 0:01:13
178500 -- (-647.835) (-638.150) [-643.950] (-649.492) * (-645.884) (-651.935) (-641.094) [-644.121] -- 0:01:13
179000 -- (-661.634) (-644.778) (-647.611) [-639.471] * (-653.624) (-649.580) (-644.662) [-641.629] -- 0:01:13
179500 -- (-658.747) (-644.896) (-642.198) [-641.812] * (-661.463) (-662.131) (-642.017) [-638.070] -- 0:01:13
180000 -- (-657.648) [-642.191] (-649.343) (-639.311) * (-650.744) (-651.267) (-642.911) [-645.159] -- 0:01:12
Average standard deviation of split frequencies: 0.016883
180500 -- [-653.175] (-647.634) (-652.131) (-635.785) * [-641.935] (-650.642) (-643.547) (-646.140) -- 0:01:12
181000 -- (-653.542) [-649.264] (-652.236) (-639.948) * (-656.870) [-652.685] (-643.347) (-650.193) -- 0:01:12
181500 -- (-650.487) (-642.452) (-663.192) [-642.350] * (-668.713) (-654.566) [-639.655] (-644.724) -- 0:01:12
182000 -- (-647.775) [-636.901] (-658.173) (-643.778) * (-658.492) (-645.491) [-643.318] (-652.678) -- 0:01:11
182500 -- (-648.016) [-646.094] (-660.244) (-639.784) * (-648.323) (-655.878) [-638.076] (-655.519) -- 0:01:11
183000 -- (-647.094) (-644.266) (-645.369) [-640.823] * (-656.600) (-649.553) [-642.407] (-652.454) -- 0:01:11
183500 -- (-649.942) [-641.253] (-648.384) (-638.739) * (-657.989) [-646.149] (-641.654) (-654.727) -- 0:01:11
184000 -- (-659.297) (-638.162) (-648.918) [-642.980] * (-662.589) [-652.799] (-648.357) (-658.897) -- 0:01:10
184500 -- (-652.389) [-644.036] (-651.205) (-645.518) * (-651.400) (-657.288) [-642.943] (-659.629) -- 0:01:15
185000 -- (-648.953) (-640.522) [-648.365] (-640.123) * (-650.640) (-660.885) [-643.155] (-655.114) -- 0:01:14
Average standard deviation of split frequencies: 0.016896
185500 -- (-652.328) [-646.025] (-655.800) (-642.900) * (-653.968) (-656.632) (-648.076) [-644.370] -- 0:01:14
186000 -- (-656.609) [-639.194] (-650.078) (-644.274) * (-651.528) (-661.488) (-660.709) [-647.483] -- 0:01:14
186500 -- (-649.112) (-643.145) [-640.038] (-651.357) * (-657.525) (-660.362) (-647.911) [-642.648] -- 0:01:14
187000 -- (-646.272) [-646.826] (-653.493) (-640.403) * (-654.417) (-661.469) (-647.538) [-639.883] -- 0:01:13
187500 -- (-660.632) (-643.480) (-658.198) [-640.070] * (-645.759) (-660.218) (-645.899) [-645.163] -- 0:01:13
188000 -- (-656.497) (-641.457) (-657.291) [-640.411] * (-644.583) (-655.370) (-645.683) [-642.618] -- 0:01:13
188500 -- (-654.822) (-642.633) (-658.696) [-640.371] * [-644.415] (-652.537) (-645.395) (-645.749) -- 0:01:13
189000 -- (-647.630) (-654.073) (-659.529) [-645.071] * (-649.143) (-661.808) (-657.621) [-638.129] -- 0:01:12
189500 -- (-648.078) [-647.124] (-657.151) (-642.612) * (-650.695) (-649.999) (-655.227) [-639.052] -- 0:01:12
190000 -- (-646.092) [-651.783] (-653.317) (-653.916) * (-654.752) (-651.013) (-660.344) [-643.678] -- 0:01:12
Average standard deviation of split frequencies: 0.017889
190500 -- (-644.509) [-644.579] (-648.079) (-638.215) * (-651.597) (-649.470) (-655.919) [-637.997] -- 0:01:12
191000 -- (-655.200) (-657.110) [-647.340] (-638.743) * (-658.975) (-640.083) [-645.877] (-652.108) -- 0:01:12
191500 -- (-660.622) (-659.645) [-645.917] (-639.886) * (-654.457) (-642.077) [-644.847] (-642.028) -- 0:01:11
192000 -- (-659.757) (-658.300) (-642.692) [-642.193] * (-644.279) (-648.023) (-651.503) [-637.144] -- 0:01:11
192500 -- (-644.701) (-656.893) (-646.184) [-640.103] * (-653.407) (-649.793) (-656.776) [-640.144] -- 0:01:11
193000 -- (-645.889) [-643.811] (-645.716) (-643.106) * [-647.432] (-653.809) (-660.587) (-645.287) -- 0:01:11
193500 -- (-645.322) (-655.715) (-653.078) [-640.190] * (-649.527) (-649.407) (-658.112) [-641.199] -- 0:01:10
194000 -- (-650.789) (-663.366) (-640.075) [-638.115] * (-660.117) [-642.016] (-654.161) (-639.030) -- 0:01:10
194500 -- (-650.294) (-663.399) (-656.711) [-638.141] * (-658.803) (-643.156) (-649.113) [-642.077] -- 0:01:10
195000 -- (-655.410) (-658.167) [-649.737] (-652.475) * (-652.737) (-651.627) (-648.070) [-642.833] -- 0:01:10
Average standard deviation of split frequencies: 0.017826
195500 -- (-642.344) (-652.919) (-660.286) [-641.846] * (-643.754) (-638.692) (-652.069) [-641.482] -- 0:01:09
196000 -- (-657.572) (-648.712) (-653.084) [-638.679] * (-656.414) [-645.563] (-661.955) (-643.997) -- 0:01:13
196500 -- (-652.664) (-642.611) (-653.482) [-637.578] * (-653.539) [-647.928] (-658.175) (-642.235) -- 0:01:13
197000 -- (-655.315) [-641.824] (-657.135) (-642.146) * (-650.308) [-642.392] (-649.716) (-647.994) -- 0:01:13
197500 -- (-656.191) (-640.770) (-647.382) [-639.377] * (-655.049) [-647.341] (-653.842) (-645.054) -- 0:01:13
198000 -- (-661.779) (-654.214) (-651.433) [-648.328] * (-649.764) (-643.661) (-643.591) [-646.564] -- 0:01:12
198500 -- (-653.664) (-643.331) (-652.064) [-642.441] * [-647.796] (-645.228) (-650.221) (-648.184) -- 0:01:12
199000 -- (-651.281) (-639.982) [-641.682] (-643.734) * (-661.471) [-640.597] (-654.398) (-643.171) -- 0:01:12
199500 -- (-653.040) [-645.242] (-650.513) (-645.797) * (-656.291) (-646.837) (-650.525) [-649.878] -- 0:01:12
200000 -- (-661.521) (-652.875) [-646.614] (-642.207) * (-648.816) (-645.144) (-653.445) [-641.314] -- 0:01:12
Average standard deviation of split frequencies: 0.016859
200500 -- (-648.412) (-645.551) (-650.082) [-640.135] * (-657.843) (-647.525) [-648.693] (-643.953) -- 0:01:11
201000 -- [-652.535] (-659.052) (-651.289) (-639.609) * (-646.711) (-641.120) (-651.211) [-648.704] -- 0:01:11
201500 -- (-652.462) (-654.660) (-638.550) [-642.723] * (-651.463) (-641.431) (-653.442) [-650.187] -- 0:01:11
202000 -- (-645.238) (-659.687) [-647.374] (-651.931) * (-647.555) [-646.269] (-661.622) (-644.106) -- 0:01:11
202500 -- (-644.604) [-645.404] (-641.526) (-642.309) * (-654.000) (-647.288) (-656.012) [-640.280] -- 0:01:10
203000 -- (-645.050) [-649.116] (-653.779) (-643.628) * (-650.740) (-646.703) (-656.359) [-647.166] -- 0:01:10
203500 -- (-645.866) (-650.245) (-660.078) [-635.357] * (-665.155) (-649.112) (-656.422) [-645.022] -- 0:01:10
204000 -- (-645.387) (-661.333) (-657.186) [-641.636] * (-657.873) (-647.832) (-647.004) [-645.892] -- 0:01:10
204500 -- (-651.707) (-664.924) (-640.617) [-642.052] * (-654.478) [-642.495] (-661.807) (-655.036) -- 0:01:10
205000 -- [-652.320] (-650.788) (-652.679) (-639.525) * (-642.735) (-639.397) (-643.648) [-649.110] -- 0:01:09
Average standard deviation of split frequencies: 0.017230
205500 -- (-660.784) (-654.274) (-644.035) [-649.936] * (-652.560) [-644.587] (-640.417) (-640.630) -- 0:01:09
206000 -- (-653.540) [-657.895] (-653.344) (-649.752) * (-650.157) (-643.646) [-638.145] (-642.363) -- 0:01:09
206500 -- [-650.646] (-653.690) (-645.715) (-660.393) * (-658.939) (-640.661) (-643.490) [-640.379] -- 0:01:09
207000 -- (-653.167) (-642.936) [-640.495] (-649.353) * (-653.427) [-637.068] (-645.452) (-640.179) -- 0:01:08
207500 -- (-662.268) (-655.826) (-652.666) [-651.042] * (-643.775) (-640.027) (-647.327) [-638.107] -- 0:01:12
208000 -- (-656.255) [-652.866] (-645.485) (-649.537) * (-651.615) [-642.246] (-650.791) (-647.585) -- 0:01:12
208500 -- (-656.149) (-663.021) [-650.281] (-643.334) * (-649.684) (-637.989) (-655.075) [-642.709] -- 0:01:12
209000 -- (-648.132) (-663.886) [-645.456] (-643.903) * [-650.833] (-642.372) (-656.784) (-637.445) -- 0:01:11
209500 -- (-647.425) (-655.068) (-651.897) [-646.159] * (-650.806) (-642.097) (-653.891) [-638.003] -- 0:01:11
210000 -- (-644.331) [-648.073] (-655.257) (-643.152) * (-644.608) [-637.627] (-655.704) (-644.768) -- 0:01:11
Average standard deviation of split frequencies: 0.015927
210500 -- (-660.089) (-655.934) [-650.123] (-658.471) * (-650.595) (-663.526) [-647.858] (-645.746) -- 0:01:11
211000 -- (-652.716) (-644.060) [-656.225] (-655.970) * (-644.875) (-656.591) (-656.747) [-643.043] -- 0:01:11
211500 -- [-646.079] (-652.123) (-649.800) (-652.085) * [-646.468] (-655.955) (-656.063) (-646.623) -- 0:01:10
212000 -- (-643.423) (-643.588) (-650.419) [-646.855] * (-648.067) (-649.866) (-663.872) [-638.736] -- 0:01:10
212500 -- (-647.450) [-652.002] (-647.736) (-657.429) * (-651.938) (-653.041) (-655.489) [-643.002] -- 0:01:10
213000 -- [-644.528] (-648.918) (-656.911) (-645.833) * (-663.913) (-655.969) (-644.816) [-644.426] -- 0:01:10
213500 -- (-652.427) (-657.247) (-655.766) [-640.888] * (-664.019) (-653.838) (-653.493) [-642.317] -- 0:01:09
214000 -- (-655.204) (-652.483) (-650.939) [-646.239] * (-648.223) [-648.128] (-646.633) (-641.615) -- 0:01:09
214500 -- [-646.607] (-664.297) (-645.124) (-656.236) * (-651.186) (-654.515) [-640.838] (-642.007) -- 0:01:09
215000 -- (-653.637) (-655.890) (-649.096) [-643.644] * (-647.010) (-652.475) (-658.020) [-644.093] -- 0:01:09
Average standard deviation of split frequencies: 0.015519
215500 -- (-654.795) (-653.331) (-662.484) [-644.067] * (-653.820) (-646.576) [-644.530] (-637.607) -- 0:01:09
216000 -- (-646.428) (-656.594) [-642.536] (-641.609) * (-654.531) (-656.630) [-644.768] (-635.927) -- 0:01:08
216500 -- [-651.416] (-649.895) (-653.861) (-638.857) * (-658.937) (-667.322) (-654.918) [-640.900] -- 0:01:08
217000 -- [-646.999] (-655.756) (-650.163) (-645.470) * (-658.038) (-660.807) (-665.413) [-643.746] -- 0:01:08
217500 -- (-651.151) (-650.333) (-650.024) [-638.449] * (-659.145) [-653.887] (-651.690) (-640.288) -- 0:01:08
218000 -- (-642.023) (-650.345) (-644.920) [-641.400] * (-660.354) (-653.700) (-649.857) [-637.596] -- 0:01:08
218500 -- (-650.112) (-648.814) (-658.556) [-640.841] * (-644.301) (-651.721) (-652.665) [-645.167] -- 0:01:07
219000 -- (-646.285) [-647.153] (-645.290) (-640.280) * [-645.823] (-647.420) (-656.569) (-646.215) -- 0:01:11
219500 -- [-644.385] (-660.136) (-655.443) (-647.030) * (-657.686) (-644.907) (-652.333) [-649.792] -- 0:01:11
220000 -- (-642.742) (-653.787) (-650.347) [-641.460] * (-658.084) (-639.253) (-656.460) [-644.462] -- 0:01:10
Average standard deviation of split frequencies: 0.013055
220500 -- (-658.370) (-646.583) (-655.384) [-639.265] * (-645.141) (-659.423) [-645.037] (-652.362) -- 0:01:10
221000 -- (-657.718) (-656.869) (-647.343) [-654.679] * (-658.238) [-645.796] (-654.128) (-652.432) -- 0:01:10
221500 -- (-653.394) (-644.846) (-652.053) [-643.967] * (-660.933) [-650.530] (-644.472) (-648.696) -- 0:01:10
222000 -- (-662.995) (-643.125) (-662.779) [-639.350] * (-657.470) (-648.469) [-653.648] (-660.120) -- 0:01:10
222500 -- (-660.788) (-644.262) (-645.185) [-644.798] * [-650.529] (-648.764) (-652.436) (-651.709) -- 0:01:09
223000 -- (-660.767) (-644.384) (-647.561) [-641.303] * (-653.961) (-648.225) [-650.343] (-658.296) -- 0:01:09
223500 -- (-662.892) (-650.515) (-648.013) [-638.048] * (-649.023) [-647.629] (-658.908) (-655.029) -- 0:01:09
224000 -- (-652.753) (-644.259) [-640.822] (-656.140) * (-647.122) (-643.526) [-657.785] (-660.149) -- 0:01:09
224500 -- (-645.663) (-651.050) [-647.752] (-646.435) * (-653.537) (-654.498) [-644.100] (-655.063) -- 0:01:09
225000 -- (-653.692) (-650.752) (-639.349) [-640.334] * (-654.597) [-654.248] (-644.823) (-659.594) -- 0:01:08
Average standard deviation of split frequencies: 0.011704
225500 -- [-650.976] (-651.147) (-653.278) (-662.606) * (-651.860) (-648.369) [-642.035] (-653.416) -- 0:01:08
226000 -- (-650.916) (-649.985) (-658.469) [-642.658] * (-651.709) [-648.447] (-649.863) (-651.492) -- 0:01:08
226500 -- (-644.360) (-645.712) (-658.697) [-635.410] * (-645.474) [-640.314] (-649.589) (-656.808) -- 0:01:08
227000 -- (-659.882) [-648.365] (-655.604) (-640.431) * (-654.542) [-643.244] (-645.542) (-650.575) -- 0:01:08
227500 -- (-652.161) (-656.235) (-648.980) [-640.769] * (-672.930) (-649.824) [-644.132] (-655.560) -- 0:01:07
228000 -- (-657.910) [-646.497] (-652.296) (-642.163) * (-660.594) (-663.258) [-636.307] (-647.362) -- 0:01:07
228500 -- (-656.952) (-659.867) (-653.573) [-647.255] * (-660.246) (-653.396) [-640.588] (-654.165) -- 0:01:07
229000 -- [-643.250] (-647.498) (-658.648) (-645.310) * (-652.665) (-640.263) [-639.769] (-656.461) -- 0:01:07
229500 -- (-658.757) (-649.269) (-653.321) [-638.410] * (-651.865) (-647.213) [-640.652] (-650.144) -- 0:01:07
230000 -- (-660.291) (-648.794) (-647.255) [-645.724] * (-656.593) (-650.311) [-642.163] (-646.423) -- 0:01:06
Average standard deviation of split frequencies: 0.012376
230500 -- (-653.861) (-650.137) (-652.009) [-644.171] * (-654.270) [-641.655] (-642.538) (-649.974) -- 0:01:10
231000 -- (-649.437) [-644.909] (-649.561) (-639.801) * (-653.225) (-639.333) [-640.343] (-653.507) -- 0:01:09
231500 -- (-655.633) (-657.675) (-647.760) [-637.279] * (-648.103) [-640.575] (-640.328) (-652.707) -- 0:01:09
232000 -- (-647.381) [-639.874] (-652.425) (-643.142) * (-649.113) (-646.159) (-652.453) [-646.300] -- 0:01:09
232500 -- (-660.452) (-642.550) (-649.922) [-645.226] * (-649.427) (-644.686) (-647.539) [-641.816] -- 0:01:09
233000 -- (-639.894) (-650.556) (-641.532) [-646.916] * (-650.086) [-643.100] (-649.063) (-653.339) -- 0:01:09
233500 -- (-659.381) (-645.977) [-646.741] (-638.346) * (-643.381) [-648.341] (-656.345) (-644.365) -- 0:01:08
234000 -- (-663.982) (-646.212) (-651.563) [-644.255] * (-653.013) [-643.363] (-649.031) (-652.358) -- 0:01:08
234500 -- (-663.092) [-647.913] (-643.059) (-636.360) * [-644.843] (-646.894) (-647.402) (-638.646) -- 0:01:08
235000 -- (-654.780) (-646.169) [-644.133] (-642.603) * [-644.510] (-649.682) (-655.636) (-648.050) -- 0:01:08
Average standard deviation of split frequencies: 0.013277
235500 -- (-652.842) (-648.405) [-651.966] (-642.642) * (-658.491) [-645.521] (-654.295) (-651.216) -- 0:01:08
236000 -- (-667.361) (-642.622) [-650.058] (-649.570) * (-653.177) (-646.466) (-654.632) [-646.590] -- 0:01:07
236500 -- (-651.559) (-634.937) (-642.333) [-638.027] * [-653.161] (-647.818) (-659.932) (-655.023) -- 0:01:07
237000 -- (-656.797) [-643.004] (-643.352) (-645.030) * (-646.719) [-649.640] (-647.327) (-651.956) -- 0:01:07
237500 -- (-653.098) (-636.728) (-646.590) [-644.673] * [-642.221] (-645.904) (-651.149) (-649.109) -- 0:01:07
238000 -- (-658.866) (-645.333) [-648.476] (-649.028) * (-647.018) [-646.193] (-654.855) (-643.833) -- 0:01:07
238500 -- (-659.584) (-655.365) [-643.375] (-640.360) * (-644.354) (-637.986) (-646.658) [-647.347] -- 0:01:07
239000 -- [-645.894] (-648.802) (-648.972) (-643.421) * (-653.968) [-644.764] (-646.824) (-640.717) -- 0:01:06
239500 -- (-642.485) (-647.938) [-654.379] (-643.046) * (-656.893) (-644.215) (-654.401) [-645.020] -- 0:01:06
240000 -- (-648.984) (-646.159) (-647.381) [-643.933] * (-658.031) (-642.805) (-656.426) [-649.778] -- 0:01:06
Average standard deviation of split frequencies: 0.012444
240500 -- (-641.870) (-661.375) (-650.044) [-638.965] * (-658.680) [-640.092] (-645.260) (-643.950) -- 0:01:06
241000 -- (-645.724) (-666.816) (-646.279) [-638.312] * (-651.678) [-639.642] (-653.266) (-657.034) -- 0:01:06
241500 -- [-648.236] (-644.515) (-654.575) (-643.859) * (-655.274) [-641.256] (-651.342) (-654.529) -- 0:01:05
242000 -- [-645.676] (-655.987) (-654.271) (-648.062) * (-659.777) (-644.397) (-654.349) [-644.493] -- 0:01:08
242500 -- (-656.908) [-647.044] (-659.217) (-644.428) * (-655.117) [-640.543] (-641.253) (-657.758) -- 0:01:08
243000 -- [-650.386] (-652.324) (-651.845) (-638.264) * (-653.606) (-654.853) [-640.414] (-644.399) -- 0:01:08
243500 -- (-645.701) [-649.059] (-647.763) (-641.745) * (-656.756) [-641.549] (-658.548) (-645.111) -- 0:01:08
244000 -- (-648.005) (-646.261) (-652.434) [-641.345] * (-659.023) (-650.737) [-644.669] (-644.180) -- 0:01:08
244500 -- [-644.092] (-643.131) (-653.649) (-649.493) * (-659.468) (-642.234) [-649.682] (-645.792) -- 0:01:07
245000 -- (-648.498) [-646.892] (-654.335) (-653.345) * (-654.978) (-654.088) [-644.524] (-644.274) -- 0:01:07
Average standard deviation of split frequencies: 0.013307
245500 -- (-646.559) [-657.030] (-648.550) (-663.435) * [-645.268] (-655.350) (-644.253) (-641.392) -- 0:01:07
246000 -- (-643.294) [-646.842] (-654.182) (-653.056) * [-646.092] (-649.047) (-650.230) (-646.729) -- 0:01:07
246500 -- (-645.258) (-660.626) [-654.996] (-656.273) * (-655.165) (-656.129) (-642.113) [-646.053] -- 0:01:07
247000 -- (-659.932) (-656.029) [-654.518] (-651.726) * (-650.580) (-656.179) [-644.356] (-640.702) -- 0:01:07
247500 -- (-657.380) (-660.893) [-645.089] (-641.296) * (-665.414) (-661.473) (-646.284) [-642.862] -- 0:01:06
248000 -- (-654.911) (-655.057) (-653.946) [-641.320] * [-651.421] (-656.973) (-650.070) (-649.293) -- 0:01:06
248500 -- (-659.569) (-659.664) (-645.135) [-647.304] * (-658.265) (-656.917) [-641.399] (-645.677) -- 0:01:06
249000 -- [-654.114] (-652.598) (-643.989) (-642.624) * (-658.348) (-645.397) (-643.127) [-645.298] -- 0:01:06
249500 -- (-650.515) (-652.974) (-662.354) [-644.837] * (-657.711) (-643.733) [-640.273] (-648.865) -- 0:01:06
250000 -- (-640.731) (-660.983) (-650.023) [-650.730] * (-655.312) (-646.304) [-637.337] (-637.453) -- 0:01:06
Average standard deviation of split frequencies: 0.013263
250500 -- (-641.389) (-661.557) (-654.644) [-646.680] * (-664.269) (-646.800) (-643.276) [-640.229] -- 0:01:05
251000 -- (-649.028) (-656.659) (-655.947) [-643.633] * (-660.399) (-650.291) [-646.323] (-647.600) -- 0:01:05
251500 -- (-653.959) [-656.770] (-651.541) (-652.785) * (-651.005) (-647.326) [-635.766] (-647.482) -- 0:01:05
252000 -- [-646.085] (-662.436) (-650.009) (-642.812) * (-660.265) (-661.724) (-644.759) [-643.938] -- 0:01:05
252500 -- (-649.373) (-655.412) [-639.693] (-652.308) * (-659.210) [-650.109] (-654.232) (-646.036) -- 0:01:05
253000 -- (-652.352) (-654.928) [-642.347] (-649.334) * [-649.688] (-646.661) (-643.232) (-646.990) -- 0:01:04
253500 -- (-644.220) [-639.416] (-656.338) (-655.290) * (-650.747) (-648.854) [-643.204] (-649.763) -- 0:01:07
254000 -- (-651.358) (-655.506) [-643.400] (-641.055) * (-656.393) (-640.024) [-639.724] (-662.242) -- 0:01:07
254500 -- (-648.807) (-643.928) (-650.931) [-648.591] * (-649.297) (-646.367) (-643.103) [-656.660] -- 0:01:07
255000 -- [-647.914] (-653.840) (-647.667) (-652.200) * (-650.828) [-647.454] (-640.718) (-666.654) -- 0:01:07
Average standard deviation of split frequencies: 0.014220
255500 -- (-653.194) (-643.651) (-658.405) [-647.326] * (-656.310) (-641.765) [-642.664] (-659.957) -- 0:01:07
256000 -- (-651.653) [-649.728] (-651.275) (-651.320) * (-652.963) (-641.495) [-640.516] (-650.279) -- 0:01:06
256500 -- [-640.705] (-655.082) (-661.972) (-642.483) * (-664.809) [-645.392] (-645.281) (-657.077) -- 0:01:06
257000 -- (-654.824) (-653.733) [-645.232] (-639.216) * [-647.451] (-653.548) (-645.555) (-658.618) -- 0:01:06
257500 -- (-643.906) [-643.280] (-662.326) (-642.153) * (-656.429) (-657.558) (-642.307) [-651.448] -- 0:01:06
258000 -- (-651.935) (-656.887) (-645.751) [-642.543] * [-641.528] (-648.976) (-641.794) (-647.245) -- 0:01:06
258500 -- (-655.789) (-643.855) [-638.929] (-651.922) * (-640.788) (-654.254) [-647.114] (-648.810) -- 0:01:05
259000 -- (-658.359) (-645.251) (-643.086) [-643.416] * (-651.560) [-643.754] (-643.973) (-646.861) -- 0:01:05
259500 -- (-657.777) (-649.938) (-639.875) [-645.844] * (-652.702) [-641.236] (-645.072) (-643.840) -- 0:01:05
260000 -- (-654.403) (-650.206) [-645.770] (-649.143) * (-643.630) (-648.780) (-646.956) [-642.585] -- 0:01:05
Average standard deviation of split frequencies: 0.013936
260500 -- (-657.488) (-646.661) (-643.284) [-645.593] * [-648.862] (-665.331) (-644.546) (-642.608) -- 0:01:05
261000 -- [-658.079] (-665.275) (-641.601) (-661.640) * [-651.706] (-658.895) (-654.986) (-652.962) -- 0:01:05
261500 -- (-643.227) (-652.273) (-645.768) [-642.250] * (-657.170) (-652.132) [-644.552] (-658.766) -- 0:01:04
262000 -- (-647.853) (-646.386) (-654.650) [-640.996] * (-643.072) (-652.155) [-648.484] (-652.097) -- 0:01:04
262500 -- (-650.570) (-653.859) [-649.160] (-658.612) * (-659.597) (-658.906) [-640.910] (-655.590) -- 0:01:04
263000 -- (-645.919) (-655.965) [-647.958] (-665.354) * (-657.205) (-652.487) [-643.355] (-653.751) -- 0:01:04
263500 -- (-656.733) (-654.298) [-654.384] (-655.544) * [-645.514] (-644.115) (-647.263) (-644.401) -- 0:01:04
264000 -- (-657.614) (-650.184) (-648.828) [-649.604] * (-646.014) (-655.409) [-645.625] (-641.003) -- 0:01:04
264500 -- (-648.532) (-649.985) (-659.039) [-642.749] * [-646.473] (-653.396) (-652.029) (-645.833) -- 0:01:03
265000 -- (-656.393) (-662.737) [-656.142] (-662.764) * [-648.778] (-654.847) (-644.712) (-656.042) -- 0:01:06
Average standard deviation of split frequencies: 0.013135
265500 -- (-654.124) [-652.317] (-647.144) (-656.513) * (-658.187) (-650.600) (-642.086) [-646.784] -- 0:01:06
266000 -- (-644.765) (-646.940) [-643.721] (-655.919) * [-648.760] (-656.721) (-645.287) (-655.017) -- 0:01:06
266500 -- (-650.523) (-644.348) [-644.040] (-658.612) * (-644.340) (-660.282) [-649.368] (-647.219) -- 0:01:06
267000 -- (-656.035) (-650.937) (-649.400) [-643.473] * (-648.157) (-664.075) [-644.428] (-649.387) -- 0:01:05
267500 -- (-655.960) [-643.744] (-654.141) (-649.693) * (-650.590) (-654.215) [-640.443] (-650.704) -- 0:01:05
268000 -- [-657.502] (-652.310) (-655.218) (-657.172) * (-642.814) (-658.254) (-646.527) [-642.270] -- 0:01:05
268500 -- (-658.807) (-648.781) (-663.119) [-642.937] * (-657.526) (-657.791) [-642.729] (-649.236) -- 0:01:05
269000 -- (-647.149) [-644.820] (-657.842) (-650.740) * (-642.935) (-641.728) (-643.429) [-655.143] -- 0:01:05
269500 -- [-642.487] (-651.841) (-667.184) (-660.417) * (-651.786) [-639.388] (-655.622) (-643.463) -- 0:01:05
270000 -- (-645.229) [-646.185] (-643.535) (-661.181) * (-644.432) (-651.288) [-638.134] (-659.358) -- 0:01:04
Average standard deviation of split frequencies: 0.013318
270500 -- (-652.551) [-646.703] (-653.350) (-663.348) * [-642.874] (-640.552) (-660.066) (-658.475) -- 0:01:04
271000 -- (-658.157) [-641.082] (-656.109) (-643.460) * [-652.734] (-648.566) (-654.886) (-654.766) -- 0:01:04
271500 -- (-649.963) (-640.591) [-648.975] (-659.109) * (-650.063) (-659.414) (-647.910) [-642.180] -- 0:01:04
272000 -- (-651.227) (-653.261) [-641.509] (-651.836) * (-653.234) (-651.865) (-644.709) [-651.256] -- 0:01:04
272500 -- (-644.634) [-641.345] (-655.548) (-654.341) * (-645.351) (-642.223) (-660.103) [-652.222] -- 0:01:04
273000 -- (-650.397) (-664.766) (-653.496) [-640.614] * (-645.079) [-650.282] (-650.508) (-650.040) -- 0:01:03
273500 -- (-657.430) [-645.440] (-645.277) (-645.655) * (-657.521) (-639.573) [-647.894] (-651.346) -- 0:01:03
274000 -- (-648.686) [-644.458] (-649.386) (-658.934) * (-653.315) (-637.542) (-657.050) [-645.654] -- 0:01:03
274500 -- [-643.489] (-661.551) (-656.323) (-643.973) * (-649.874) (-648.963) (-664.871) [-653.040] -- 0:01:03
275000 -- [-639.229] (-659.187) (-659.199) (-651.376) * [-645.109] (-649.844) (-649.401) (-649.828) -- 0:01:03
Average standard deviation of split frequencies: 0.011554
275500 -- (-647.928) [-643.724] (-658.566) (-652.916) * (-648.496) (-651.148) (-645.050) [-649.679] -- 0:01:03
276000 -- (-645.862) (-652.099) (-650.141) [-654.068] * (-646.435) [-639.404] (-651.489) (-659.043) -- 0:01:02
276500 -- (-644.325) [-652.486] (-659.632) (-662.464) * [-645.656] (-648.189) (-662.803) (-660.719) -- 0:01:05
277000 -- (-643.352) (-652.885) [-651.051] (-650.927) * (-648.156) (-638.036) [-640.762] (-652.873) -- 0:01:05
277500 -- (-649.399) [-647.045] (-652.359) (-657.161) * (-639.770) [-653.598] (-647.965) (-644.680) -- 0:01:05
278000 -- (-653.927) (-653.750) (-651.879) [-653.390] * (-646.698) [-640.555] (-656.450) (-645.206) -- 0:01:04
278500 -- (-654.972) (-649.545) (-655.571) [-646.788] * [-643.755] (-652.723) (-654.770) (-657.560) -- 0:01:04
279000 -- (-658.844) (-637.049) (-652.647) [-638.745] * (-653.917) (-647.067) (-645.601) [-655.457] -- 0:01:04
279500 -- (-663.476) [-639.638] (-662.237) (-641.896) * (-645.536) (-647.304) [-639.693] (-655.241) -- 0:01:04
280000 -- (-649.404) (-644.893) (-647.612) [-642.453] * (-642.521) (-638.220) [-641.757] (-655.579) -- 0:01:04
Average standard deviation of split frequencies: 0.010812
280500 -- (-644.790) (-657.196) (-651.997) [-651.825] * (-646.377) [-638.386] (-642.884) (-658.877) -- 0:01:04
281000 -- (-656.460) (-649.551) (-652.611) [-651.852] * (-653.023) (-637.026) [-643.713] (-659.870) -- 0:01:03
281500 -- (-644.599) [-649.747] (-656.805) (-643.082) * (-649.187) [-640.519] (-652.508) (-657.899) -- 0:01:03
282000 -- (-654.132) [-647.906] (-649.041) (-648.459) * (-657.103) (-649.692) [-637.125] (-647.575) -- 0:01:03
282500 -- (-652.361) (-649.949) (-650.278) [-645.687] * [-651.176] (-645.914) (-649.484) (-652.045) -- 0:01:03
283000 -- [-641.475] (-657.723) (-646.810) (-646.004) * (-649.263) (-644.014) (-642.774) [-652.978] -- 0:01:03
283500 -- (-652.856) (-666.709) (-643.402) [-644.906] * (-662.160) (-648.316) (-641.379) [-646.069] -- 0:01:03
284000 -- (-658.518) (-651.874) (-644.916) [-644.254] * (-657.363) (-646.994) [-657.502] (-649.160) -- 0:01:03
284500 -- (-646.770) [-653.329] (-658.510) (-646.362) * [-659.272] (-649.960) (-648.190) (-656.334) -- 0:01:02
285000 -- (-652.034) [-646.401] (-646.450) (-649.782) * [-644.552] (-652.988) (-653.437) (-647.829) -- 0:01:02
Average standard deviation of split frequencies: 0.009581
285500 -- (-648.701) (-653.197) (-655.399) [-639.558] * (-644.474) (-656.847) [-647.881] (-657.874) -- 0:01:02
286000 -- [-647.803] (-664.635) (-652.604) (-652.865) * [-652.384] (-641.715) (-652.900) (-654.532) -- 0:01:02
286500 -- (-647.476) (-657.480) (-646.122) [-643.627] * (-662.325) (-653.996) (-657.461) [-642.248] -- 0:01:02
287000 -- (-652.454) [-649.290] (-647.883) (-647.162) * (-664.581) [-638.613] (-649.422) (-656.918) -- 0:01:02
287500 -- (-659.001) (-652.874) (-656.345) [-641.845] * (-646.448) [-647.608] (-655.490) (-649.140) -- 0:01:04
288000 -- (-647.450) (-665.016) (-647.460) [-643.465] * (-651.540) [-649.827] (-657.280) (-659.336) -- 0:01:04
288500 -- (-650.436) (-654.973) (-654.674) [-645.363] * (-647.506) [-645.641] (-647.042) (-663.635) -- 0:01:04
289000 -- (-650.985) [-643.505] (-653.439) (-654.700) * (-647.247) (-650.569) [-640.156] (-648.030) -- 0:01:03
289500 -- [-646.805] (-644.170) (-662.793) (-640.719) * (-656.311) (-651.188) (-651.866) [-645.145] -- 0:01:03
290000 -- (-652.385) (-649.770) (-659.777) [-645.473] * (-656.866) [-643.194] (-657.979) (-648.374) -- 0:01:03
Average standard deviation of split frequencies: 0.010238
290500 -- (-649.916) (-650.376) [-657.903] (-658.088) * (-650.993) (-660.468) [-649.427] (-651.627) -- 0:01:03
291000 -- (-652.753) (-650.066) (-657.384) [-653.713] * [-641.255] (-652.629) (-645.359) (-646.482) -- 0:01:03
291500 -- (-640.207) (-659.196) [-647.248] (-657.306) * [-637.759] (-646.766) (-647.874) (-645.278) -- 0:01:03
292000 -- (-650.243) (-648.334) (-654.274) [-644.614] * (-649.659) (-649.852) [-654.639] (-642.787) -- 0:01:03
292500 -- (-647.288) (-651.826) [-653.150] (-655.104) * (-654.112) (-641.251) (-665.486) [-649.961] -- 0:01:02
293000 -- (-655.042) [-652.558] (-661.444) (-646.082) * (-649.665) (-644.582) [-642.572] (-664.051) -- 0:01:02
293500 -- (-644.054) (-643.516) (-657.511) [-649.228] * [-642.891] (-644.930) (-646.686) (-667.107) -- 0:01:02
294000 -- (-640.585) [-654.730] (-649.404) (-658.264) * (-658.310) [-641.461] (-651.999) (-656.303) -- 0:01:02
294500 -- (-656.986) [-653.663] (-645.165) (-645.723) * (-653.415) [-641.173] (-647.159) (-670.929) -- 0:01:02
295000 -- [-642.584] (-647.921) (-647.313) (-666.900) * (-648.480) (-643.833) [-648.680] (-652.289) -- 0:01:02
Average standard deviation of split frequencies: 0.010551
295500 -- (-643.671) (-644.241) [-650.899] (-658.649) * (-661.271) [-639.394] (-659.239) (-645.793) -- 0:01:01
296000 -- (-646.649) (-650.614) [-647.306] (-656.327) * (-656.847) (-642.912) (-658.187) [-645.694] -- 0:01:01
296500 -- (-644.763) (-639.994) [-647.778] (-660.980) * [-647.602] (-650.676) (-659.816) (-647.404) -- 0:01:01
297000 -- (-646.810) (-654.421) [-643.853] (-647.433) * (-644.246) [-638.097] (-649.166) (-649.043) -- 0:01:01
297500 -- (-651.567) [-649.345] (-653.506) (-647.686) * [-644.772] (-645.152) (-645.765) (-645.933) -- 0:01:01
298000 -- [-655.490] (-655.855) (-647.868) (-644.311) * [-641.213] (-660.215) (-653.633) (-643.393) -- 0:01:01
298500 -- [-640.778] (-652.372) (-657.131) (-653.930) * (-646.348) (-647.173) [-638.946] (-654.031) -- 0:01:01
299000 -- [-656.076] (-651.277) (-645.225) (-660.032) * [-638.144] (-641.553) (-644.100) (-653.678) -- 0:01:03
299500 -- (-652.912) (-660.982) [-645.932] (-650.909) * (-638.367) (-647.901) [-642.996] (-654.969) -- 0:01:03
300000 -- [-649.587] (-653.870) (-640.314) (-647.926) * (-639.525) (-642.959) (-641.048) [-654.268] -- 0:01:03
Average standard deviation of split frequencies: 0.010387
300500 -- (-660.342) (-659.558) (-643.662) [-643.196] * (-638.891) [-638.867] (-644.237) (-654.410) -- 0:01:02
301000 -- (-657.480) (-657.054) (-651.161) [-638.066] * [-643.722] (-641.021) (-641.357) (-642.423) -- 0:01:02
301500 -- (-647.865) (-644.316) (-642.928) [-645.383] * (-641.884) (-637.877) (-651.223) [-643.671] -- 0:01:02
302000 -- (-641.527) (-656.688) [-649.009] (-643.933) * (-637.906) [-643.854] (-660.444) (-647.432) -- 0:01:02
302500 -- (-645.510) (-658.391) (-644.457) [-639.596] * (-645.593) [-642.785] (-656.992) (-650.904) -- 0:01:02
303000 -- (-645.651) (-652.081) (-662.763) [-641.982] * [-642.052] (-643.790) (-653.711) (-642.752) -- 0:01:02
303500 -- [-638.777] (-659.214) (-661.672) (-642.824) * [-636.750] (-646.674) (-654.585) (-643.815) -- 0:01:01
304000 -- [-648.397] (-660.861) (-647.812) (-641.709) * (-643.616) [-641.536] (-646.311) (-651.775) -- 0:01:01
304500 -- (-642.600) (-660.155) (-656.604) [-640.922] * [-642.380] (-649.363) (-645.607) (-653.081) -- 0:01:01
305000 -- (-650.078) (-655.739) (-648.044) [-641.805] * [-642.922] (-646.532) (-640.935) (-660.263) -- 0:01:01
Average standard deviation of split frequencies: 0.009334
305500 -- (-650.255) (-666.077) (-660.084) [-642.369] * [-642.932] (-653.882) (-647.914) (-660.505) -- 0:01:01
306000 -- (-654.341) [-654.598] (-649.017) (-645.386) * (-647.244) (-655.345) [-642.784] (-667.332) -- 0:01:01
306500 -- (-643.284) [-639.156] (-648.541) (-642.780) * (-643.269) (-658.593) [-651.727] (-664.100) -- 0:01:01
307000 -- (-646.286) [-647.974] (-653.255) (-643.904) * (-649.571) (-657.359) [-644.208] (-647.447) -- 0:01:00
307500 -- (-652.888) [-646.461] (-651.651) (-638.795) * (-647.460) (-649.417) [-648.498] (-649.760) -- 0:01:00
308000 -- (-639.978) [-640.674] (-646.938) (-649.307) * [-649.663] (-642.557) (-649.300) (-650.867) -- 0:01:00
308500 -- (-640.417) (-651.575) [-655.050] (-643.116) * [-646.300] (-655.866) (-654.968) (-645.012) -- 0:01:00
309000 -- (-636.405) (-648.792) (-644.648) [-647.010] * [-640.669] (-645.074) (-660.776) (-650.875) -- 0:01:00
309500 -- (-644.239) [-641.799] (-651.951) (-640.626) * (-647.000) (-648.329) [-644.300] (-641.540) -- 0:01:00
310000 -- [-639.695] (-643.905) (-648.800) (-653.770) * (-644.500) (-645.681) [-640.435] (-656.149) -- 0:01:00
Average standard deviation of split frequencies: 0.009997
310500 -- [-644.132] (-645.357) (-649.422) (-664.652) * (-648.253) (-647.074) [-646.447] (-650.577) -- 0:01:02
311000 -- (-647.364) (-649.083) [-644.144] (-648.625) * [-639.144] (-654.203) (-638.566) (-641.440) -- 0:01:02
311500 -- (-637.283) (-657.488) [-641.318] (-650.295) * [-647.924] (-660.274) (-646.326) (-651.373) -- 0:01:01
312000 -- (-646.741) (-647.609) (-642.314) [-649.132] * [-640.461] (-644.230) (-649.114) (-645.204) -- 0:01:01
312500 -- [-646.922] (-654.705) (-652.581) (-658.247) * [-639.506] (-646.356) (-645.504) (-653.824) -- 0:01:01
313000 -- (-641.368) [-640.338] (-646.954) (-660.854) * [-637.281] (-644.043) (-650.460) (-670.716) -- 0:01:01
313500 -- (-639.244) (-652.768) (-648.075) [-643.635] * [-640.896] (-644.416) (-655.218) (-642.572) -- 0:01:01
314000 -- [-646.639] (-648.723) (-643.486) (-656.709) * [-639.225] (-651.011) (-654.330) (-640.717) -- 0:01:01
314500 -- (-647.593) (-645.808) (-638.130) [-642.835] * [-641.892] (-647.308) (-654.472) (-647.218) -- 0:01:01
315000 -- (-648.255) (-650.571) [-645.953] (-654.179) * (-642.350) (-648.266) (-648.938) [-643.931] -- 0:01:00
Average standard deviation of split frequencies: 0.009828
315500 -- (-652.370) (-644.388) [-647.754] (-645.427) * (-646.079) (-651.023) (-645.670) [-642.054] -- 0:01:00
316000 -- [-650.622] (-637.675) (-645.596) (-653.903) * (-658.983) (-658.460) (-647.918) [-638.834] -- 0:01:00
316500 -- (-650.863) [-638.958] (-652.100) (-652.443) * [-648.323] (-656.865) (-654.679) (-640.551) -- 0:01:00
317000 -- (-644.629) [-647.914] (-665.324) (-654.459) * (-650.226) (-647.248) (-655.733) [-643.401] -- 0:01:00
317500 -- [-647.230] (-642.708) (-646.523) (-655.549) * (-656.362) (-661.990) (-641.712) [-646.881] -- 0:01:00
318000 -- (-645.715) [-637.951] (-649.500) (-663.172) * (-652.513) [-638.324] (-658.278) (-649.051) -- 0:01:00
318500 -- (-650.522) [-644.011] (-653.130) (-659.060) * [-646.477] (-648.751) (-658.210) (-648.802) -- 0:00:59
319000 -- [-645.235] (-651.156) (-647.447) (-654.391) * (-647.915) [-639.658] (-657.577) (-653.025) -- 0:00:59
319500 -- (-647.082) (-646.831) (-652.170) [-648.530] * (-652.078) [-638.504] (-652.438) (-654.524) -- 0:00:59
320000 -- [-649.581] (-670.441) (-658.454) (-641.871) * (-661.496) (-641.996) [-645.081] (-649.416) -- 0:00:59
Average standard deviation of split frequencies: 0.010031
320500 -- [-652.442] (-650.033) (-649.704) (-648.551) * (-653.666) [-643.206] (-655.634) (-654.114) -- 0:00:59
321000 -- (-641.154) (-647.197) [-650.139] (-650.870) * (-651.934) (-642.763) (-640.582) [-645.965] -- 0:00:59
321500 -- (-658.184) [-642.379] (-652.976) (-646.683) * (-661.906) (-648.904) (-649.225) [-650.787] -- 0:00:59
322000 -- (-654.480) [-647.334] (-654.848) (-655.651) * (-645.598) (-655.047) [-640.500] (-651.738) -- 0:01:01
322500 -- [-642.418] (-647.910) (-659.392) (-655.302) * (-643.961) (-652.550) [-636.470] (-649.336) -- 0:01:00
323000 -- (-645.258) (-660.825) (-646.666) [-645.179] * (-648.613) [-647.628] (-637.845) (-654.680) -- 0:01:00
323500 -- (-648.215) (-638.729) [-643.262] (-665.994) * (-643.406) (-653.386) [-649.428] (-650.319) -- 0:01:00
324000 -- (-652.133) (-642.351) [-655.198] (-657.114) * (-641.983) [-653.641] (-643.937) (-662.775) -- 0:01:00
324500 -- (-640.649) [-644.057] (-655.938) (-663.989) * (-652.120) (-654.724) [-641.699] (-648.472) -- 0:01:00
325000 -- (-644.845) [-644.016] (-656.728) (-647.336) * (-644.178) (-656.672) [-644.914] (-649.017) -- 0:01:00
Average standard deviation of split frequencies: 0.010888
325500 -- [-646.055] (-651.631) (-646.560) (-651.976) * (-651.920) (-657.891) [-644.561] (-642.577) -- 0:01:00
326000 -- (-641.901) (-655.721) (-653.475) [-645.405] * [-646.407] (-652.661) (-643.032) (-649.023) -- 0:00:59
326500 -- [-666.997] (-641.338) (-654.600) (-655.107) * (-646.610) (-643.591) [-639.631] (-643.357) -- 0:00:59
327000 -- (-659.378) (-639.580) [-645.720] (-656.447) * (-643.044) (-649.311) (-644.211) [-650.614] -- 0:00:59
327500 -- (-652.809) [-644.563] (-643.647) (-657.399) * (-648.959) (-651.570) [-647.981] (-645.707) -- 0:00:59
328000 -- (-660.750) [-643.598] (-660.759) (-648.192) * (-642.874) (-644.598) [-638.650] (-648.662) -- 0:00:59
328500 -- (-650.302) [-640.503] (-661.251) (-652.286) * (-646.440) (-649.702) [-638.136] (-649.677) -- 0:00:59
329000 -- (-644.211) [-648.985] (-653.456) (-641.657) * (-660.943) (-655.602) (-642.073) [-644.029] -- 0:00:59
329500 -- (-660.908) [-640.775] (-645.281) (-667.516) * (-656.570) (-656.821) [-639.535] (-644.894) -- 0:00:59
330000 -- (-662.110) [-640.320] (-643.607) (-647.858) * (-659.839) (-651.947) [-645.096] (-654.390) -- 0:00:58
Average standard deviation of split frequencies: 0.010566
330500 -- (-658.221) (-643.769) [-646.062] (-643.296) * (-658.218) (-656.671) [-642.617] (-647.221) -- 0:00:58
331000 -- (-660.195) [-638.287] (-660.146) (-655.300) * (-663.671) (-642.115) (-644.272) [-640.327] -- 0:00:58
331500 -- (-662.423) [-641.246] (-671.778) (-652.409) * [-648.564] (-658.683) (-646.251) (-645.795) -- 0:00:58
332000 -- (-651.472) [-641.044] (-674.117) (-654.892) * (-648.155) (-661.141) (-649.923) [-638.028] -- 0:00:58
332500 -- [-646.952] (-640.663) (-664.831) (-650.839) * (-645.597) [-651.052] (-643.208) (-652.568) -- 0:00:58
333000 -- [-642.323] (-639.582) (-657.469) (-657.572) * (-643.788) [-654.220] (-652.415) (-642.929) -- 0:00:58
333500 -- (-647.653) (-645.975) (-649.484) [-651.343] * (-657.470) [-645.139] (-660.013) (-653.733) -- 0:00:59
334000 -- (-645.788) [-641.210] (-645.556) (-654.541) * (-658.131) (-640.720) (-663.325) [-646.113] -- 0:00:59
334500 -- [-641.990] (-642.013) (-645.518) (-652.699) * [-646.272] (-651.290) (-657.996) (-649.055) -- 0:00:59
335000 -- (-660.662) [-643.389] (-646.155) (-656.325) * [-651.277] (-650.062) (-654.055) (-660.243) -- 0:00:59
Average standard deviation of split frequencies: 0.011224
335500 -- [-644.015] (-645.735) (-645.967) (-666.918) * (-657.121) (-644.050) [-645.650] (-655.022) -- 0:00:59
336000 -- (-657.419) [-646.781] (-649.970) (-653.219) * (-654.100) [-643.422] (-649.614) (-644.579) -- 0:00:59
336500 -- [-640.924] (-645.496) (-654.219) (-647.557) * (-653.674) [-647.712] (-656.695) (-653.954) -- 0:00:59
337000 -- [-646.180] (-646.642) (-671.610) (-655.114) * (-661.686) [-656.705] (-656.791) (-653.970) -- 0:00:59
337500 -- [-650.991] (-646.072) (-650.512) (-646.549) * (-646.877) (-649.162) [-651.550] (-653.323) -- 0:00:58
338000 -- (-645.998) (-646.610) [-646.607] (-655.277) * [-643.638] (-645.397) (-658.398) (-652.021) -- 0:00:58
338500 -- (-643.609) [-638.383] (-650.645) (-648.628) * (-644.917) [-642.315] (-660.812) (-650.306) -- 0:00:58
339000 -- (-648.642) (-642.338) [-646.055] (-643.593) * (-651.986) (-645.485) [-642.673] (-654.507) -- 0:00:58
339500 -- (-650.537) [-643.760] (-643.291) (-650.124) * [-642.489] (-664.652) (-645.431) (-651.155) -- 0:00:58
340000 -- (-639.143) [-644.517] (-651.212) (-657.030) * (-648.050) (-655.960) [-640.583] (-640.415) -- 0:00:58
Average standard deviation of split frequencies: 0.010840
340500 -- [-637.778] (-642.346) (-648.483) (-651.138) * [-647.327] (-663.833) (-650.026) (-649.915) -- 0:00:58
341000 -- (-641.530) (-651.248) [-650.261] (-650.213) * [-638.708] (-653.201) (-647.592) (-658.258) -- 0:00:57
341500 -- (-648.252) [-646.617] (-639.145) (-641.854) * (-641.183) (-656.467) [-653.695] (-642.964) -- 0:00:57
342000 -- (-646.200) (-651.578) [-646.157] (-650.490) * [-640.650] (-650.592) (-648.642) (-655.669) -- 0:00:57
342500 -- (-646.366) [-640.720] (-650.320) (-646.778) * [-645.005] (-660.062) (-649.002) (-651.134) -- 0:00:57
343000 -- (-649.085) [-648.426] (-654.250) (-664.031) * [-639.337] (-650.619) (-642.717) (-637.561) -- 0:00:57
343500 -- (-642.116) (-658.607) [-647.684] (-659.891) * (-650.844) [-646.820] (-654.774) (-657.845) -- 0:00:57
344000 -- (-648.317) (-650.673) [-648.482] (-651.454) * (-652.875) [-645.798] (-658.914) (-654.994) -- 0:00:57
344500 -- (-643.597) [-639.568] (-644.349) (-657.788) * (-640.717) [-644.177] (-646.837) (-662.312) -- 0:00:57
345000 -- [-641.812] (-656.393) (-653.476) (-660.683) * [-644.228] (-651.019) (-644.074) (-655.792) -- 0:00:58
Average standard deviation of split frequencies: 0.010975
345500 -- [-640.006] (-654.264) (-661.044) (-657.583) * (-655.686) (-642.378) [-642.724] (-652.340) -- 0:00:58
346000 -- [-643.681] (-654.161) (-643.385) (-650.923) * (-640.227) (-645.693) [-637.909] (-645.627) -- 0:00:58
346500 -- (-638.248) (-653.169) [-644.332] (-676.751) * (-656.428) (-651.815) (-664.536) [-642.823] -- 0:00:58
347000 -- (-643.284) (-649.341) [-651.465] (-656.751) * [-642.753] (-664.211) (-647.552) (-643.220) -- 0:00:58
347500 -- (-647.357) (-646.383) [-646.078] (-666.838) * (-651.238) (-649.754) (-650.775) [-646.699] -- 0:00:58
348000 -- (-640.576) [-649.304] (-645.517) (-659.479) * (-645.545) (-649.362) [-648.151] (-647.623) -- 0:00:58
348500 -- (-648.203) [-649.673] (-650.744) (-644.429) * (-653.874) (-651.994) (-658.490) [-644.652] -- 0:00:57
349000 -- [-645.035] (-667.763) (-655.635) (-642.979) * (-655.435) (-642.951) (-652.177) [-640.613] -- 0:00:57
349500 -- (-644.810) [-649.312] (-637.814) (-656.062) * (-655.842) (-659.022) (-658.963) [-646.385] -- 0:00:57
350000 -- (-647.470) (-645.239) [-642.037] (-657.066) * [-652.105] (-643.951) (-660.015) (-653.174) -- 0:00:57
Average standard deviation of split frequencies: 0.010605
350500 -- (-649.521) (-653.602) [-639.241] (-650.309) * (-657.889) (-644.338) (-646.446) [-642.519] -- 0:00:57
351000 -- [-645.076] (-651.879) (-642.499) (-658.205) * (-653.495) [-649.352] (-645.300) (-647.654) -- 0:00:57
351500 -- (-656.311) (-658.160) [-644.156] (-644.783) * [-643.889] (-645.419) (-647.652) (-653.248) -- 0:00:57
352000 -- (-647.397) [-648.683] (-641.243) (-653.223) * [-650.703] (-646.954) (-648.189) (-657.885) -- 0:00:57
352500 -- (-647.486) (-647.678) [-643.156] (-647.846) * (-643.953) (-657.313) [-643.379] (-654.749) -- 0:00:56
353000 -- (-650.681) [-640.220] (-646.929) (-655.050) * (-645.740) [-652.535] (-646.104) (-653.261) -- 0:00:56
353500 -- (-664.609) [-645.232] (-645.329) (-645.901) * (-655.103) (-664.832) (-649.278) [-638.665] -- 0:00:56
354000 -- (-654.338) (-655.470) [-638.898] (-659.600) * [-652.358] (-646.275) (-657.511) (-644.887) -- 0:00:56
354500 -- (-647.685) (-648.396) [-643.855] (-651.530) * (-639.599) (-654.747) (-652.484) [-646.051] -- 0:00:56
355000 -- [-642.769] (-654.748) (-643.226) (-642.159) * (-642.396) [-644.422] (-654.854) (-646.415) -- 0:00:56
Average standard deviation of split frequencies: 0.011139
355500 -- [-642.812] (-661.388) (-654.578) (-647.495) * (-644.316) (-661.808) (-650.453) [-636.999] -- 0:00:56
356000 -- [-640.331] (-657.725) (-652.776) (-640.822) * [-642.867] (-648.104) (-656.193) (-652.123) -- 0:00:57
356500 -- (-658.008) (-648.420) (-646.568) [-649.922] * (-646.185) (-650.316) (-648.893) [-641.876] -- 0:00:57
357000 -- [-650.182] (-652.654) (-648.983) (-650.543) * [-644.399] (-649.354) (-645.050) (-642.791) -- 0:00:57
357500 -- (-651.712) [-648.192] (-651.798) (-644.093) * (-639.755) [-645.344] (-656.394) (-637.509) -- 0:00:57
358000 -- (-646.714) (-651.668) (-654.153) [-643.462] * [-645.141] (-652.525) (-652.486) (-646.529) -- 0:00:57
358500 -- [-644.555] (-663.898) (-655.272) (-653.548) * [-641.949] (-641.859) (-657.332) (-660.208) -- 0:00:57
359000 -- (-651.122) (-656.785) [-656.225] (-654.112) * (-644.944) [-644.111] (-648.098) (-660.411) -- 0:00:57
359500 -- (-646.564) [-646.130] (-646.136) (-645.550) * (-640.584) [-641.848] (-657.533) (-660.995) -- 0:00:57
360000 -- (-643.952) [-641.589] (-658.229) (-654.156) * (-647.082) [-644.311] (-646.247) (-663.305) -- 0:00:56
Average standard deviation of split frequencies: 0.011763
360500 -- (-651.983) [-640.525] (-658.156) (-651.571) * (-636.022) (-649.454) (-657.128) [-654.724] -- 0:00:56
361000 -- (-654.413) (-651.472) [-646.889] (-647.486) * (-667.317) [-648.331] (-657.465) (-658.926) -- 0:00:56
361500 -- (-664.644) (-667.767) [-642.321] (-655.565) * (-661.369) [-647.315] (-645.278) (-654.759) -- 0:00:56
362000 -- [-647.956] (-651.801) (-644.280) (-652.001) * (-667.189) [-651.186] (-649.830) (-658.115) -- 0:00:56
362500 -- (-643.823) (-662.901) (-643.239) [-653.530] * [-646.913] (-656.455) (-646.790) (-656.167) -- 0:00:56
363000 -- (-651.716) (-660.030) [-650.885] (-644.892) * (-651.640) [-651.327] (-653.474) (-643.015) -- 0:00:56
363500 -- [-643.486] (-664.011) (-656.539) (-650.838) * [-645.163] (-661.341) (-646.193) (-650.222) -- 0:00:56
364000 -- [-649.326] (-649.195) (-656.022) (-646.704) * [-640.269] (-650.477) (-658.315) (-645.627) -- 0:00:55
364500 -- (-647.939) (-660.499) (-654.199) [-642.005] * (-640.098) (-650.406) (-661.564) [-644.465] -- 0:00:55
365000 -- [-652.733] (-655.724) (-648.754) (-657.472) * (-647.239) (-649.754) (-657.104) [-641.670] -- 0:00:55
Average standard deviation of split frequencies: 0.012397
365500 -- (-646.930) (-656.718) [-644.245] (-659.010) * [-639.258] (-655.543) (-649.757) (-645.739) -- 0:00:55
366000 -- (-656.944) (-650.256) [-641.700] (-661.484) * (-647.117) (-645.040) (-646.940) [-641.053] -- 0:00:55
366500 -- (-653.373) (-643.320) [-648.546] (-655.007) * (-647.812) (-643.633) [-638.683] (-648.685) -- 0:00:55
367000 -- (-655.829) (-641.500) [-643.541] (-661.571) * [-643.155] (-651.877) (-644.676) (-652.660) -- 0:00:55
367500 -- (-648.240) (-658.414) (-649.851) [-648.276] * [-645.715] (-653.956) (-644.517) (-652.090) -- 0:00:56
368000 -- [-647.559] (-653.155) (-646.057) (-651.626) * [-640.887] (-653.899) (-643.639) (-656.100) -- 0:00:56
368500 -- [-644.200] (-654.784) (-659.250) (-651.537) * [-644.304] (-659.682) (-657.961) (-649.704) -- 0:00:56
369000 -- (-647.139) (-650.356) [-659.485] (-646.081) * (-640.180) (-650.526) (-658.799) [-638.652] -- 0:00:56
369500 -- [-647.912] (-644.849) (-655.868) (-649.409) * [-637.098] (-662.416) (-655.188) (-657.117) -- 0:00:56
370000 -- (-639.021) (-639.251) [-648.801] (-640.921) * [-642.966] (-651.026) (-652.503) (-655.542) -- 0:00:56
Average standard deviation of split frequencies: 0.011684
370500 -- [-652.411] (-642.824) (-661.050) (-649.348) * (-646.976) [-642.449] (-660.898) (-659.992) -- 0:00:56
371000 -- (-642.352) (-644.196) [-642.099] (-660.071) * [-637.050] (-642.238) (-654.455) (-656.983) -- 0:00:55
371500 -- (-653.350) (-645.525) [-638.408] (-643.916) * (-645.364) [-646.776] (-654.877) (-654.120) -- 0:00:55
372000 -- (-648.483) [-643.048] (-648.566) (-650.728) * (-643.264) [-642.485] (-646.831) (-654.007) -- 0:00:55
372500 -- [-646.306] (-665.526) (-640.998) (-653.014) * (-647.323) (-642.551) [-642.023] (-655.179) -- 0:00:55
373000 -- [-657.004] (-648.736) (-661.149) (-646.556) * [-643.488] (-645.631) (-651.270) (-654.255) -- 0:00:55
373500 -- (-657.869) [-645.257] (-648.625) (-649.009) * [-643.348] (-651.406) (-661.733) (-651.897) -- 0:00:55
374000 -- (-661.808) [-643.736] (-650.956) (-652.148) * (-639.657) [-642.448] (-654.766) (-655.656) -- 0:00:55
374500 -- (-652.917) (-643.386) [-639.690] (-637.232) * [-640.811] (-651.902) (-649.726) (-642.380) -- 0:00:55
375000 -- (-655.212) (-642.698) (-646.594) [-646.873] * [-643.474] (-647.507) (-653.656) (-651.223) -- 0:00:55
Average standard deviation of split frequencies: 0.011519
375500 -- (-651.761) [-641.441] (-659.437) (-642.027) * [-653.985] (-650.254) (-654.141) (-650.411) -- 0:00:54
376000 -- [-641.082] (-644.611) (-652.420) (-659.809) * (-641.298) [-656.074] (-652.147) (-654.989) -- 0:00:54
376500 -- (-665.333) [-637.975] (-643.725) (-645.264) * [-640.234] (-658.283) (-654.685) (-654.859) -- 0:00:54
377000 -- (-652.798) (-640.877) (-647.430) [-655.926] * (-645.763) [-638.214] (-658.347) (-659.211) -- 0:00:54
377500 -- [-640.759] (-641.554) (-653.753) (-654.120) * [-641.931] (-646.441) (-663.663) (-649.088) -- 0:00:54
378000 -- (-646.702) [-647.821] (-652.735) (-647.191) * [-642.330] (-652.947) (-660.400) (-645.322) -- 0:00:54
378500 -- (-653.968) [-647.954] (-645.521) (-652.502) * [-641.550] (-660.063) (-643.933) (-655.310) -- 0:00:54
379000 -- (-664.051) [-642.395] (-643.203) (-649.399) * [-641.357] (-640.165) (-652.428) (-654.517) -- 0:00:55
379500 -- [-642.138] (-643.381) (-650.141) (-664.520) * (-638.184) [-644.615] (-659.051) (-655.017) -- 0:00:55
380000 -- [-637.593] (-642.878) (-650.638) (-653.928) * (-645.511) [-643.869] (-660.786) (-651.952) -- 0:00:55
Average standard deviation of split frequencies: 0.011145
380500 -- (-642.914) [-641.374] (-646.547) (-651.305) * [-645.301] (-648.330) (-661.230) (-651.814) -- 0:00:55
381000 -- (-648.701) (-646.117) [-644.742] (-648.077) * (-650.530) (-650.759) [-655.714] (-646.688) -- 0:00:55
381500 -- (-662.016) [-640.510] (-644.285) (-643.533) * [-650.319] (-654.300) (-650.553) (-643.010) -- 0:00:55
382000 -- (-663.616) (-638.101) [-643.398] (-653.791) * (-640.023) (-653.021) (-644.950) [-641.445] -- 0:00:55
382500 -- (-661.013) (-641.541) [-643.633] (-647.398) * (-648.456) (-647.656) (-644.641) [-640.787] -- 0:00:54
383000 -- (-642.503) [-640.254] (-646.004) (-643.177) * [-643.517] (-661.751) (-653.953) (-641.254) -- 0:00:54
383500 -- (-641.752) [-643.049] (-650.660) (-655.423) * (-648.827) (-645.176) (-643.403) [-640.337] -- 0:00:54
384000 -- (-648.151) [-645.564] (-655.493) (-646.963) * (-647.948) (-652.965) [-642.364] (-639.173) -- 0:00:54
384500 -- (-652.169) (-643.356) [-645.907] (-655.365) * (-648.046) (-658.706) (-642.625) [-648.714] -- 0:00:54
385000 -- (-648.394) [-640.620] (-650.509) (-651.459) * (-652.278) (-648.362) (-644.566) [-639.061] -- 0:00:54
Average standard deviation of split frequencies: 0.011063
385500 -- (-651.278) [-638.156] (-648.105) (-653.417) * (-658.794) (-645.765) (-652.081) [-640.038] -- 0:00:54
386000 -- (-642.895) [-637.605] (-646.855) (-646.879) * (-650.304) (-645.107) (-655.265) [-638.655] -- 0:00:54
386500 -- (-641.622) [-640.549] (-660.005) (-648.276) * (-660.737) (-650.328) (-656.089) [-641.107] -- 0:00:53
387000 -- (-646.266) (-653.386) [-650.858] (-646.527) * (-647.338) [-648.420] (-653.876) (-637.329) -- 0:00:53
387500 -- (-667.266) (-656.027) [-646.166] (-649.168) * (-646.925) (-646.592) (-648.288) [-639.692] -- 0:00:53
388000 -- (-656.100) (-640.070) [-646.939] (-650.233) * [-644.517] (-656.506) (-654.597) (-642.912) -- 0:00:53
388500 -- (-657.159) (-653.680) (-641.180) [-641.462] * (-653.880) (-659.872) (-653.902) [-641.986] -- 0:00:53
389000 -- (-657.201) [-650.566] (-645.257) (-643.717) * (-653.872) (-649.399) (-644.742) [-638.683] -- 0:00:53
389500 -- (-650.819) [-642.147] (-657.495) (-645.590) * (-653.099) (-643.623) [-640.189] (-646.994) -- 0:00:53
390000 -- (-656.279) (-651.865) [-648.925] (-648.276) * (-656.440) [-649.828] (-652.162) (-642.128) -- 0:00:53
Average standard deviation of split frequencies: 0.010292
390500 -- (-650.053) (-652.381) (-646.075) [-648.127] * (-652.760) (-657.689) [-651.292] (-651.420) -- 0:00:54
391000 -- [-653.463] (-655.027) (-648.266) (-640.534) * (-656.438) (-664.265) [-642.906] (-652.984) -- 0:00:54
391500 -- (-652.602) [-646.267] (-642.671) (-646.134) * (-658.597) (-658.147) [-651.835] (-655.276) -- 0:00:54
392000 -- (-656.847) (-644.609) (-653.713) [-649.060] * (-655.781) (-653.890) [-644.719] (-658.989) -- 0:00:54
392500 -- (-654.170) [-643.312] (-644.308) (-653.178) * (-645.843) [-656.011] (-648.845) (-648.173) -- 0:00:54
393000 -- (-664.680) (-648.327) [-645.194] (-647.763) * (-651.034) (-660.420) [-641.626] (-656.616) -- 0:00:54
393500 -- (-655.235) (-642.657) (-651.387) [-653.350] * (-651.287) (-657.632) [-642.375] (-649.737) -- 0:00:53
394000 -- (-642.558) (-656.001) [-653.371] (-657.279) * (-654.338) (-649.958) (-657.458) [-646.944] -- 0:00:53
394500 -- [-650.916] (-652.931) (-657.485) (-642.593) * (-657.757) (-650.728) (-656.982) [-643.429] -- 0:00:53
395000 -- [-647.791] (-650.459) (-648.690) (-650.269) * (-664.654) (-644.952) (-644.284) [-645.170] -- 0:00:53
Average standard deviation of split frequencies: 0.010119
395500 -- (-659.208) [-653.216] (-648.767) (-658.226) * (-642.038) (-664.191) (-653.605) [-645.724] -- 0:00:53
396000 -- [-649.830] (-658.878) (-660.900) (-647.565) * (-652.908) (-645.284) [-651.654] (-650.185) -- 0:00:53
396500 -- (-656.131) [-647.472] (-651.288) (-641.666) * (-651.017) (-645.445) (-652.578) [-646.129] -- 0:00:53
397000 -- (-655.236) (-651.350) [-649.372] (-641.223) * [-643.661] (-651.137) (-654.722) (-658.436) -- 0:00:53
397500 -- (-652.950) (-653.408) (-652.865) [-639.269] * [-644.133] (-651.262) (-647.642) (-657.736) -- 0:00:53
398000 -- (-647.363) (-651.056) [-639.305] (-645.171) * [-643.869] (-664.116) (-650.153) (-653.707) -- 0:00:52
398500 -- (-644.099) [-636.634] (-656.303) (-647.014) * (-649.545) (-659.217) [-643.534] (-658.309) -- 0:00:52
399000 -- (-644.223) (-650.665) [-642.857] (-646.357) * [-643.997] (-647.744) (-650.062) (-653.339) -- 0:00:52
399500 -- (-646.898) (-659.693) [-647.480] (-646.088) * (-641.541) [-652.981] (-650.338) (-656.450) -- 0:00:52
400000 -- (-647.823) (-652.421) [-650.871] (-647.416) * (-649.471) (-651.562) [-642.165] (-647.802) -- 0:00:52
Average standard deviation of split frequencies: 0.010451
400500 -- [-648.371] (-653.922) (-659.250) (-641.050) * (-639.480) [-657.420] (-642.044) (-648.076) -- 0:00:52
401000 -- (-640.885) (-655.820) (-648.794) [-642.263] * (-642.352) (-651.459) [-657.420] (-641.104) -- 0:00:52
401500 -- [-652.218] (-657.915) (-647.730) (-640.262) * (-645.561) (-654.834) [-638.427] (-656.341) -- 0:00:52
402000 -- [-645.209] (-654.945) (-648.742) (-636.967) * (-651.505) (-650.394) (-647.216) [-650.847] -- 0:00:53
402500 -- (-644.868) (-640.761) (-649.500) [-637.112] * (-653.108) (-647.418) (-651.203) [-643.826] -- 0:00:53
403000 -- [-643.666] (-658.743) (-642.310) (-650.893) * (-653.665) (-650.350) (-662.047) [-644.861] -- 0:00:53
403500 -- (-640.099) (-661.906) [-644.684] (-646.356) * (-647.363) [-644.475] (-650.507) (-643.756) -- 0:00:53
404000 -- (-642.869) (-654.321) (-650.494) [-640.797] * [-636.841] (-667.111) (-647.255) (-647.711) -- 0:00:53
404500 -- (-652.472) (-652.912) (-652.381) [-649.405] * [-638.643] (-646.421) (-641.098) (-652.108) -- 0:00:52
405000 -- (-660.339) (-645.796) [-649.918] (-649.347) * (-646.478) [-643.531] (-649.624) (-657.266) -- 0:00:52
Average standard deviation of split frequencies: 0.009031
405500 -- (-659.166) (-649.413) (-645.381) [-644.073] * (-648.527) [-639.060] (-649.850) (-656.126) -- 0:00:52
406000 -- (-644.656) (-651.959) (-650.474) [-640.741] * (-642.733) [-640.192] (-654.696) (-650.077) -- 0:00:52
406500 -- (-644.211) (-657.918) (-646.391) [-649.600] * (-640.924) (-646.651) (-657.376) [-646.701] -- 0:00:52
407000 -- (-647.719) (-662.024) (-651.208) [-645.807] * (-653.470) [-645.830] (-655.576) (-655.456) -- 0:00:52
407500 -- [-643.797] (-658.273) (-645.125) (-654.585) * (-658.964) [-639.460] (-660.415) (-646.178) -- 0:00:52
408000 -- (-649.042) (-654.353) [-647.314] (-650.405) * (-657.059) [-640.166] (-661.428) (-651.793) -- 0:00:52
408500 -- (-651.127) (-649.828) (-647.607) [-648.519] * (-658.723) (-640.341) (-639.973) [-640.008] -- 0:00:52
409000 -- (-664.988) (-650.226) (-654.297) [-650.045] * (-657.461) [-639.312] (-648.120) (-648.356) -- 0:00:52
409500 -- (-655.687) (-643.188) (-650.088) [-649.945] * (-662.978) [-637.936] (-647.660) (-650.391) -- 0:00:51
410000 -- (-651.463) (-658.486) (-650.797) [-653.060] * [-650.270] (-648.521) (-644.257) (-649.544) -- 0:00:51
Average standard deviation of split frequencies: 0.009048
410500 -- [-641.606] (-661.099) (-644.810) (-657.422) * [-640.413] (-659.212) (-652.383) (-652.424) -- 0:00:51
411000 -- (-640.589) (-655.259) [-650.085] (-652.426) * [-644.457] (-656.620) (-645.253) (-649.028) -- 0:00:51
411500 -- (-643.533) (-657.001) [-645.336] (-648.134) * (-651.284) (-669.085) (-641.848) [-643.314] -- 0:00:51
412000 -- [-638.912] (-660.023) (-649.638) (-644.901) * (-647.742) [-647.901] (-652.238) (-640.582) -- 0:00:51
412500 -- (-639.030) (-660.908) (-654.976) [-645.080] * (-655.530) (-650.426) [-643.568] (-646.076) -- 0:00:51
413000 -- [-642.683] (-642.995) (-651.639) (-645.407) * (-653.605) (-645.883) (-643.188) [-645.254] -- 0:00:51
413500 -- [-641.774] (-647.865) (-671.794) (-638.124) * (-642.297) (-646.999) [-643.138] (-654.403) -- 0:00:52
414000 -- (-649.754) [-641.910] (-656.736) (-640.796) * (-643.550) (-646.714) [-639.563] (-649.256) -- 0:00:52
414500 -- (-647.462) (-654.853) (-659.431) [-641.202] * (-646.999) (-652.759) (-655.007) [-650.918] -- 0:00:52
415000 -- (-655.956) (-639.434) (-656.980) [-640.377] * [-651.548] (-661.171) (-655.498) (-647.131) -- 0:00:52
Average standard deviation of split frequencies: 0.009349
415500 -- (-649.173) [-646.957] (-648.351) (-638.788) * [-641.881] (-653.079) (-662.446) (-651.020) -- 0:00:52
416000 -- (-647.046) (-651.329) (-653.603) [-642.814] * (-646.607) (-649.784) [-643.097] (-652.445) -- 0:00:51
416500 -- (-652.364) (-651.965) [-650.877] (-640.243) * (-644.980) [-644.161] (-647.372) (-655.322) -- 0:00:51
417000 -- [-650.469] (-639.597) (-649.921) (-643.804) * [-643.933] (-654.796) (-661.173) (-654.299) -- 0:00:51
417500 -- (-645.537) [-638.556] (-642.244) (-649.827) * [-645.096] (-659.147) (-658.040) (-646.439) -- 0:00:51
418000 -- [-650.666] (-646.987) (-645.925) (-653.122) * (-650.597) (-667.908) (-664.197) [-639.101] -- 0:00:51
418500 -- (-647.169) [-642.181] (-646.449) (-650.125) * (-646.170) (-657.855) (-644.217) [-645.071] -- 0:00:51
419000 -- (-645.545) [-646.312] (-653.620) (-642.267) * (-640.428) (-661.940) [-643.536] (-656.109) -- 0:00:51
419500 -- [-643.708] (-658.167) (-656.029) (-656.011) * (-644.397) (-656.370) (-647.830) [-656.072] -- 0:00:51
420000 -- [-642.930] (-658.515) (-646.569) (-655.511) * (-653.475) (-656.409) [-647.042] (-648.292) -- 0:00:51
Average standard deviation of split frequencies: 0.010015
420500 -- (-645.324) [-656.452] (-655.754) (-654.571) * (-643.154) (-661.713) [-636.266] (-646.905) -- 0:00:50
421000 -- (-651.502) (-655.483) [-643.326] (-643.798) * [-649.505] (-651.824) (-648.745) (-643.972) -- 0:00:50
421500 -- (-648.493) [-643.145] (-645.121) (-647.173) * [-637.965] (-642.123) (-651.369) (-661.021) -- 0:00:50
422000 -- (-648.319) (-652.701) [-643.103] (-637.741) * (-655.202) [-647.099] (-652.685) (-644.708) -- 0:00:50
422500 -- (-641.905) [-645.361] (-653.181) (-656.435) * (-650.281) (-660.281) [-645.223] (-652.075) -- 0:00:50
423000 -- (-650.131) [-646.287] (-650.545) (-644.036) * (-660.134) [-658.123] (-649.052) (-648.293) -- 0:00:50
423500 -- [-646.874] (-657.176) (-655.347) (-652.263) * (-650.335) (-655.717) [-647.919] (-661.602) -- 0:00:50
424000 -- (-660.143) (-659.496) [-650.510] (-643.624) * (-660.484) (-658.861) [-646.367] (-649.554) -- 0:00:50
424500 -- [-645.117] (-654.515) (-652.153) (-646.491) * (-657.873) (-658.010) [-647.652] (-647.775) -- 0:00:51
425000 -- (-637.265) (-661.311) (-649.479) [-646.185] * [-659.133] (-656.585) (-650.568) (-649.385) -- 0:00:51
Average standard deviation of split frequencies: 0.010675
425500 -- (-655.177) [-650.740] (-653.873) (-648.608) * (-650.672) (-652.215) (-642.594) [-640.870] -- 0:00:51
426000 -- (-656.728) (-648.338) (-656.985) [-645.235] * (-655.725) (-650.011) [-640.993] (-653.470) -- 0:00:51
426500 -- (-648.189) [-643.630] (-651.770) (-650.065) * (-653.289) [-648.572] (-653.106) (-655.780) -- 0:00:51
427000 -- [-643.513] (-653.911) (-652.498) (-651.021) * (-657.641) [-648.062] (-646.087) (-660.531) -- 0:00:50
427500 -- [-646.110] (-649.015) (-656.624) (-650.532) * (-661.777) (-648.851) [-640.271] (-661.780) -- 0:00:50
428000 -- [-648.076] (-653.156) (-656.930) (-639.923) * (-654.941) (-642.291) [-648.560] (-656.019) -- 0:00:50
428500 -- (-649.975) (-648.960) (-654.309) [-642.783] * (-658.146) (-650.946) (-644.326) [-646.441] -- 0:00:50
429000 -- (-652.813) (-654.917) [-648.745] (-657.345) * (-663.294) (-651.984) (-650.635) [-646.207] -- 0:00:50
429500 -- (-654.063) (-658.304) [-651.709] (-650.300) * (-658.504) (-646.546) [-639.329] (-651.801) -- 0:00:50
430000 -- [-650.567] (-650.755) (-647.819) (-647.361) * (-652.576) [-644.804] (-650.962) (-646.063) -- 0:00:50
Average standard deviation of split frequencies: 0.010399
430500 -- (-654.239) (-654.450) [-645.508] (-641.998) * (-646.165) (-642.805) (-658.515) [-653.403] -- 0:00:50
431000 -- (-648.729) (-659.714) [-643.903] (-653.921) * [-644.698] (-649.800) (-650.217) (-649.290) -- 0:00:50
431500 -- (-649.735) [-642.020] (-645.018) (-655.472) * (-647.589) [-649.690] (-649.907) (-649.915) -- 0:00:50
432000 -- (-650.559) [-649.916] (-644.843) (-661.132) * (-643.697) (-642.818) (-654.619) [-644.838] -- 0:00:49
432500 -- (-659.020) (-651.276) (-646.328) [-656.716] * (-652.869) (-646.110) (-648.633) [-646.842] -- 0:00:49
433000 -- (-649.120) (-654.152) [-648.945] (-646.643) * (-653.091) (-648.142) [-647.578] (-652.184) -- 0:00:49
433500 -- (-642.882) (-648.983) [-641.365] (-651.242) * (-660.901) (-659.318) [-643.054] (-645.650) -- 0:00:49
434000 -- (-656.760) (-644.329) [-639.887] (-645.005) * (-661.081) [-645.080] (-648.105) (-647.998) -- 0:00:49
434500 -- (-660.777) (-648.960) [-637.134] (-642.978) * (-651.296) (-652.394) (-646.047) [-644.316] -- 0:00:49
435000 -- (-662.934) (-654.932) (-645.332) [-650.737] * (-657.892) (-643.686) [-655.886] (-644.552) -- 0:00:49
Average standard deviation of split frequencies: 0.010430
435500 -- [-648.601] (-653.539) (-644.034) (-651.976) * (-655.651) (-646.137) [-644.315] (-659.449) -- 0:00:49
436000 -- (-646.575) (-644.908) (-640.772) [-655.430] * (-648.076) (-658.260) (-646.422) [-643.137] -- 0:00:50
436500 -- [-645.454] (-659.981) (-643.080) (-646.929) * (-648.693) (-654.368) [-643.100] (-643.965) -- 0:00:50
437000 -- (-649.513) [-647.447] (-644.483) (-643.248) * (-653.827) (-643.061) (-644.351) [-646.507] -- 0:00:50
437500 -- (-655.640) (-645.416) [-642.943] (-649.142) * (-654.566) (-646.679) [-648.029] (-649.152) -- 0:00:50
438000 -- (-660.149) [-655.984] (-645.499) (-656.816) * (-657.919) (-649.361) [-652.464] (-641.694) -- 0:00:50
438500 -- (-654.105) (-653.367) [-643.625] (-637.946) * [-647.124] (-655.566) (-664.854) (-637.610) -- 0:00:49
439000 -- (-656.629) [-645.027] (-647.704) (-646.128) * (-656.874) (-654.337) (-646.825) [-646.682] -- 0:00:49
439500 -- (-654.803) (-643.568) (-659.483) [-647.102] * (-663.826) (-648.097) (-647.104) [-640.806] -- 0:00:49
440000 -- [-641.710] (-653.157) (-659.929) (-645.146) * (-654.940) (-676.642) (-647.565) [-640.928] -- 0:00:49
Average standard deviation of split frequencies: 0.009360
440500 -- [-638.263] (-657.391) (-658.995) (-647.727) * [-651.529] (-649.347) (-641.757) (-652.329) -- 0:00:49
441000 -- (-645.907) (-654.577) (-649.581) [-646.938] * (-646.692) (-651.059) [-647.364] (-649.812) -- 0:00:49
441500 -- (-649.041) (-652.795) (-656.028) [-643.957] * (-645.843) (-645.805) [-644.789] (-651.876) -- 0:00:49
442000 -- (-643.452) (-650.094) (-644.669) [-652.198] * (-645.511) [-645.745] (-640.836) (-652.738) -- 0:00:49
442500 -- [-642.135] (-650.690) (-652.042) (-663.191) * (-662.393) [-641.095] (-643.184) (-650.589) -- 0:00:49
443000 -- [-644.720] (-657.365) (-646.382) (-657.081) * (-657.663) (-650.446) [-640.648] (-645.032) -- 0:00:49
443500 -- [-635.244] (-646.636) (-649.406) (-661.825) * (-648.089) [-652.736] (-638.581) (-645.066) -- 0:00:48
444000 -- (-641.651) (-649.012) [-647.914] (-651.047) * (-651.505) (-655.660) [-641.295] (-643.661) -- 0:00:48
444500 -- (-641.564) (-648.883) [-649.198] (-650.515) * (-654.449) (-646.241) [-641.723] (-640.928) -- 0:00:48
445000 -- [-637.701] (-644.665) (-651.585) (-656.727) * (-644.726) (-651.069) [-642.307] (-649.998) -- 0:00:48
Average standard deviation of split frequencies: 0.009711
445500 -- (-637.425) (-648.872) [-651.384] (-647.812) * (-663.734) (-658.309) [-643.049] (-641.287) -- 0:00:48
446000 -- (-639.447) (-648.253) (-653.521) [-645.851] * (-648.725) (-646.044) [-638.456] (-661.958) -- 0:00:48
446500 -- [-646.392] (-650.616) (-660.778) (-650.945) * (-644.185) (-654.099) [-644.227] (-656.701) -- 0:00:48
447000 -- (-638.951) (-657.191) (-646.519) [-644.932] * [-647.065] (-652.687) (-637.928) (-650.858) -- 0:00:48
447500 -- [-640.217] (-651.067) (-651.861) (-648.628) * (-659.655) (-642.159) [-647.236] (-658.186) -- 0:00:49
448000 -- (-646.335) (-660.135) [-648.593] (-649.323) * (-646.955) (-651.623) [-642.996] (-653.473) -- 0:00:49
448500 -- [-649.911] (-658.166) (-652.704) (-644.928) * (-660.827) (-659.995) (-639.916) [-643.597] -- 0:00:49
449000 -- [-642.967] (-662.159) (-648.703) (-650.442) * (-654.789) [-650.440] (-638.580) (-652.165) -- 0:00:49
449500 -- (-642.967) (-659.203) [-643.694] (-654.020) * (-661.853) [-648.269] (-643.829) (-652.688) -- 0:00:48
450000 -- (-648.235) [-651.921] (-650.622) (-665.363) * (-654.784) (-647.971) [-647.003] (-642.001) -- 0:00:48
Average standard deviation of split frequencies: 0.010091
450500 -- (-643.104) [-648.454] (-651.252) (-650.373) * (-658.560) (-650.387) [-644.704] (-653.369) -- 0:00:48
451000 -- [-639.653] (-647.636) (-644.249) (-656.228) * (-644.160) (-666.539) [-641.567] (-654.961) -- 0:00:48
451500 -- (-656.164) [-646.796] (-647.168) (-664.408) * (-652.278) (-651.924) (-643.500) [-653.225] -- 0:00:48
452000 -- (-646.280) [-646.509] (-655.401) (-661.607) * (-660.700) (-642.246) [-648.026] (-646.528) -- 0:00:48
452500 -- [-648.841] (-659.410) (-652.608) (-639.163) * (-642.935) (-650.452) [-642.717] (-648.419) -- 0:00:48
453000 -- [-652.050] (-644.072) (-662.792) (-649.390) * [-649.189] (-644.562) (-657.318) (-648.452) -- 0:00:48
453500 -- (-639.502) (-656.586) (-654.980) [-651.687] * (-646.708) (-643.939) (-655.524) [-654.250] -- 0:00:48
454000 -- (-646.698) (-649.036) (-642.479) [-650.735] * (-643.887) (-652.899) (-646.386) [-647.250] -- 0:00:48
454500 -- [-652.888] (-650.454) (-655.543) (-646.830) * [-646.026] (-647.128) (-655.998) (-655.909) -- 0:00:48
455000 -- (-645.264) [-647.275] (-644.600) (-643.181) * [-643.715] (-658.416) (-654.606) (-648.123) -- 0:00:47
Average standard deviation of split frequencies: 0.010912
455500 -- (-646.901) (-654.402) (-649.600) [-640.523] * (-659.002) (-654.949) [-642.032] (-652.958) -- 0:00:47
456000 -- (-647.864) (-653.323) (-651.068) [-638.005] * [-651.195] (-648.212) (-652.427) (-667.924) -- 0:00:47
456500 -- (-651.815) (-651.483) (-653.411) [-642.737] * (-650.319) [-643.130] (-649.682) (-648.431) -- 0:00:47
457000 -- [-643.026] (-643.580) (-664.261) (-642.234) * (-659.448) (-646.894) [-651.870] (-642.795) -- 0:00:47
457500 -- (-656.841) [-648.171] (-650.058) (-648.528) * (-656.466) (-649.804) [-643.274] (-653.400) -- 0:00:47
458000 -- (-653.856) [-645.471] (-650.723) (-663.515) * [-652.035] (-647.697) (-654.334) (-642.270) -- 0:00:47
458500 -- (-657.390) (-648.683) (-652.435) [-660.766] * (-657.181) [-651.344] (-646.714) (-643.757) -- 0:00:47
459000 -- (-655.589) (-649.130) [-647.410] (-646.867) * [-654.904] (-643.619) (-650.222) (-653.365) -- 0:00:48
459500 -- (-657.654) (-645.846) (-647.526) [-642.727] * (-658.222) (-654.547) (-648.410) [-642.949] -- 0:00:48
460000 -- (-656.515) (-655.251) [-647.163] (-658.327) * [-655.005] (-644.187) (-648.567) (-655.533) -- 0:00:48
Average standard deviation of split frequencies: 0.010858
460500 -- (-658.474) [-644.297] (-667.463) (-659.936) * (-656.150) [-642.392] (-651.277) (-655.155) -- 0:00:48
461000 -- (-640.828) [-653.130] (-660.986) (-648.122) * (-649.886) [-641.938] (-650.701) (-649.354) -- 0:00:47
461500 -- (-653.607) (-659.963) (-662.049) [-644.888] * (-647.715) [-643.717] (-654.928) (-660.050) -- 0:00:47
462000 -- (-649.685) [-646.988] (-655.203) (-644.303) * (-660.100) (-645.760) [-646.756] (-647.029) -- 0:00:47
462500 -- (-651.305) [-645.850] (-655.871) (-650.685) * (-665.472) [-645.185] (-652.977) (-650.159) -- 0:00:47
463000 -- (-645.936) (-646.373) (-653.801) [-649.441] * (-652.481) [-648.904] (-650.000) (-652.728) -- 0:00:47
463500 -- (-654.156) [-649.046] (-656.231) (-652.286) * (-647.195) (-645.799) [-643.094] (-645.450) -- 0:00:47
464000 -- (-656.144) (-648.396) (-658.231) [-644.467] * (-643.402) (-654.136) (-646.397) [-648.938] -- 0:00:47
464500 -- (-656.372) (-651.652) (-660.276) [-647.279] * (-648.078) [-650.465] (-648.989) (-659.784) -- 0:00:47
465000 -- (-656.886) (-657.401) (-645.845) [-642.236] * (-652.479) (-665.354) (-652.632) [-640.172] -- 0:00:47
Average standard deviation of split frequencies: 0.009530
465500 -- (-652.598) (-649.204) [-645.941] (-654.131) * (-650.876) (-651.021) (-660.296) [-640.025] -- 0:00:47
466000 -- (-656.417) (-646.366) [-643.897] (-657.337) * (-652.237) (-650.114) (-658.676) [-643.103] -- 0:00:46
466500 -- (-650.616) (-649.076) (-654.300) [-648.011] * (-653.419) (-655.352) (-659.183) [-649.203] -- 0:00:46
467000 -- [-637.796] (-648.518) (-643.988) (-656.447) * (-659.563) [-648.321] (-651.552) (-640.007) -- 0:00:46
467500 -- (-644.847) (-656.986) [-644.202] (-652.066) * (-655.857) (-651.910) (-655.816) [-650.288] -- 0:00:46
468000 -- (-644.234) (-656.867) [-644.068] (-643.973) * (-650.145) [-645.829] (-646.942) (-644.857) -- 0:00:46
468500 -- (-656.093) (-651.417) (-644.416) [-654.301] * (-658.113) [-647.506] (-645.542) (-647.255) -- 0:00:46
469000 -- [-649.763] (-653.410) (-653.639) (-655.532) * (-640.263) (-654.100) (-661.741) [-646.660] -- 0:00:46
469500 -- (-654.374) (-652.340) (-645.529) [-648.663] * [-645.885] (-647.815) (-671.272) (-639.455) -- 0:00:46
470000 -- (-662.662) [-642.444] (-649.364) (-668.103) * [-641.370] (-653.524) (-664.508) (-644.544) -- 0:00:47
Average standard deviation of split frequencies: 0.009404
470500 -- (-658.406) (-652.425) [-641.992] (-648.535) * (-652.917) (-649.450) (-666.462) [-650.731] -- 0:00:47
471000 -- [-652.911] (-655.614) (-646.810) (-668.832) * [-651.922] (-651.592) (-651.769) (-655.821) -- 0:00:47
471500 -- [-651.528] (-662.561) (-646.342) (-656.457) * [-641.535] (-656.109) (-652.777) (-650.614) -- 0:00:47
472000 -- (-654.002) (-657.076) [-643.023] (-665.919) * [-649.535] (-659.102) (-643.173) (-648.844) -- 0:00:46
472500 -- (-649.572) [-642.891] (-644.018) (-657.124) * [-644.251] (-654.386) (-642.212) (-652.120) -- 0:00:46
473000 -- (-650.750) (-658.930) (-644.967) [-642.604] * [-653.628] (-650.746) (-648.578) (-658.115) -- 0:00:46
473500 -- (-651.329) (-653.390) (-646.353) [-648.142] * [-644.828] (-653.492) (-649.256) (-646.234) -- 0:00:46
474000 -- (-647.249) (-654.187) (-649.275) [-641.816] * (-651.449) (-655.141) [-642.705] (-647.452) -- 0:00:46
474500 -- (-640.082) [-648.314] (-650.451) (-659.735) * [-647.010] (-645.273) (-654.166) (-654.569) -- 0:00:46
475000 -- (-642.563) (-647.625) [-645.573] (-660.801) * (-646.029) (-645.719) [-649.949] (-661.546) -- 0:00:46
Average standard deviation of split frequencies: 0.009787
475500 -- [-650.288] (-644.715) (-656.867) (-655.043) * (-647.836) [-649.266] (-649.242) (-653.635) -- 0:00:46
476000 -- (-650.274) (-652.925) [-639.771] (-655.751) * (-652.087) (-643.083) [-642.839] (-655.728) -- 0:00:46
476500 -- (-647.637) (-655.877) [-642.374] (-653.380) * (-655.254) [-646.360] (-649.829) (-657.809) -- 0:00:46
477000 -- [-641.288] (-651.346) (-645.837) (-653.589) * [-646.170] (-644.552) (-643.031) (-658.773) -- 0:00:46
477500 -- [-638.434] (-649.786) (-650.293) (-658.463) * (-654.289) [-645.445] (-654.657) (-658.889) -- 0:00:45
478000 -- [-638.304] (-663.949) (-649.096) (-648.123) * (-650.628) (-652.994) [-649.769] (-654.532) -- 0:00:45
478500 -- (-645.683) (-649.110) [-640.959] (-652.049) * [-646.355] (-649.771) (-657.810) (-652.721) -- 0:00:45
479000 -- (-646.389) (-660.958) (-646.457) [-647.245] * (-652.647) [-645.852] (-653.475) (-652.637) -- 0:00:45
479500 -- (-658.721) (-648.430) [-646.623] (-646.476) * (-651.772) (-660.662) (-653.110) [-648.508] -- 0:00:45
480000 -- (-657.462) (-644.436) (-651.834) [-642.456] * [-639.404] (-652.227) (-646.653) (-663.242) -- 0:00:45
Average standard deviation of split frequencies: 0.009807
480500 -- (-649.868) (-643.763) [-639.201] (-650.461) * (-654.115) (-646.231) (-653.409) [-643.471] -- 0:00:45
481000 -- (-663.343) (-654.010) [-642.979] (-648.588) * [-640.958] (-646.896) (-654.383) (-655.250) -- 0:00:45
481500 -- (-662.011) (-658.192) [-654.790] (-638.395) * (-652.543) [-649.203] (-647.181) (-655.197) -- 0:00:46
482000 -- (-649.654) (-654.004) [-642.005] (-639.723) * (-652.954) [-657.123] (-654.744) (-658.615) -- 0:00:46
482500 -- (-653.328) (-661.222) (-649.368) [-648.568] * (-662.234) (-656.617) [-635.117] (-652.036) -- 0:00:46
483000 -- [-643.870] (-663.189) (-648.760) (-647.057) * (-644.101) [-648.200] (-642.231) (-653.290) -- 0:00:46
483500 -- (-640.868) (-659.780) (-653.031) [-637.366] * [-647.002] (-646.874) (-652.800) (-652.639) -- 0:00:45
484000 -- (-640.148) (-650.147) (-648.797) [-641.842] * (-651.355) (-653.776) (-636.671) [-639.100] -- 0:00:45
484500 -- (-647.125) (-652.511) [-648.262] (-658.913) * (-652.668) (-657.148) [-637.448] (-661.809) -- 0:00:45
485000 -- [-647.947] (-646.442) (-658.701) (-660.656) * (-655.003) [-652.898] (-647.347) (-638.560) -- 0:00:45
Average standard deviation of split frequencies: 0.009547
485500 -- (-646.216) (-660.057) [-650.992] (-655.840) * (-648.261) (-658.197) [-638.090] (-643.630) -- 0:00:45
486000 -- (-642.816) (-650.281) [-642.170] (-663.290) * [-650.106] (-646.764) (-643.664) (-663.471) -- 0:00:45
486500 -- (-647.730) (-653.604) [-643.190] (-654.871) * (-651.318) [-650.208] (-648.397) (-661.544) -- 0:00:45
487000 -- [-646.865] (-648.598) (-658.740) (-653.945) * (-654.554) (-649.518) (-647.036) [-644.798] -- 0:00:45
487500 -- [-644.449] (-643.464) (-650.551) (-665.074) * [-643.784] (-659.874) (-658.270) (-650.508) -- 0:00:45
488000 -- (-645.842) (-648.971) [-654.462] (-656.924) * [-641.992] (-649.366) (-656.069) (-646.992) -- 0:00:45
488500 -- (-647.776) [-655.953] (-648.112) (-656.522) * (-646.611) (-642.111) (-658.256) [-641.466] -- 0:00:45
489000 -- (-659.490) (-650.062) [-649.793] (-657.659) * (-659.541) (-644.421) [-656.793] (-639.361) -- 0:00:44
489500 -- (-656.449) (-653.739) (-649.215) [-648.660] * (-645.841) [-641.686] (-676.316) (-644.493) -- 0:00:44
490000 -- (-655.198) (-653.648) (-651.474) [-641.854] * (-649.847) (-640.231) [-644.397] (-646.966) -- 0:00:44
Average standard deviation of split frequencies: 0.010012
490500 -- (-654.193) (-656.617) [-648.723] (-646.442) * (-653.967) (-647.327) (-637.100) [-643.727] -- 0:00:44
491000 -- (-652.896) [-644.861] (-660.079) (-657.529) * (-648.913) (-659.114) [-640.444] (-650.438) -- 0:00:44
491500 -- [-641.604] (-653.357) (-648.214) (-654.576) * (-648.329) (-656.766) (-647.343) [-640.947] -- 0:00:44
492000 -- (-659.250) [-645.210] (-647.774) (-656.817) * (-651.494) (-658.806) [-640.789] (-640.000) -- 0:00:44
492500 -- (-662.131) [-642.394] (-650.341) (-646.502) * (-652.827) (-658.122) [-638.733] (-644.631) -- 0:00:44
493000 -- (-652.466) (-655.468) [-654.603] (-656.709) * (-644.699) (-649.515) [-642.402] (-657.447) -- 0:00:45
493500 -- [-640.847] (-650.185) (-652.766) (-653.786) * (-644.609) (-661.542) [-639.123] (-660.074) -- 0:00:45
494000 -- (-645.397) [-645.088] (-648.355) (-654.780) * [-644.383] (-659.740) (-652.142) (-649.403) -- 0:00:45
494500 -- (-651.796) (-657.309) [-650.855] (-651.959) * [-641.454] (-654.919) (-642.557) (-655.614) -- 0:00:44
495000 -- (-647.082) [-647.434] (-657.919) (-649.369) * [-652.657] (-646.538) (-652.679) (-660.586) -- 0:00:44
Average standard deviation of split frequencies: 0.009304
495500 -- [-652.057] (-651.361) (-656.434) (-655.653) * (-647.091) (-647.257) [-643.174] (-658.464) -- 0:00:44
496000 -- (-649.991) [-649.594] (-654.127) (-649.888) * (-651.468) (-664.421) [-642.958] (-659.012) -- 0:00:44
496500 -- [-640.192] (-643.081) (-649.997) (-661.677) * (-658.918) [-654.633] (-654.199) (-650.384) -- 0:00:44
497000 -- [-643.732] (-644.431) (-649.061) (-650.376) * (-646.727) (-663.558) (-639.245) [-647.924] -- 0:00:44
497500 -- [-642.111] (-643.390) (-649.716) (-652.123) * [-646.466] (-663.412) (-653.682) (-654.888) -- 0:00:44
498000 -- (-658.067) (-644.955) [-641.816] (-647.733) * (-659.015) (-650.198) [-645.668] (-657.311) -- 0:00:44
498500 -- (-666.299) (-650.247) (-647.159) [-641.990] * (-654.891) [-649.097] (-642.277) (-649.678) -- 0:00:44
499000 -- [-662.468] (-655.771) (-654.491) (-647.144) * (-651.736) [-648.983] (-647.356) (-648.799) -- 0:00:44
499500 -- (-656.044) [-650.626] (-644.289) (-647.997) * (-643.030) [-649.118] (-642.851) (-649.207) -- 0:00:44
500000 -- (-650.151) [-644.122] (-647.615) (-645.586) * (-648.629) (-654.834) (-644.860) [-650.575] -- 0:00:44
Average standard deviation of split frequencies: 0.009259
500500 -- (-653.685) [-643.608] (-646.587) (-656.263) * [-656.334] (-647.281) (-638.961) (-652.981) -- 0:00:43
501000 -- (-644.976) (-656.745) [-647.303] (-655.486) * (-647.084) (-653.837) [-641.936] (-650.686) -- 0:00:43
501500 -- (-659.250) (-652.966) [-647.588] (-653.445) * (-649.295) (-652.528) [-637.217] (-645.483) -- 0:00:43
502000 -- [-646.045] (-647.828) (-644.425) (-652.425) * (-643.636) (-654.037) [-637.195] (-644.919) -- 0:00:43
502500 -- (-660.762) (-652.044) [-645.685] (-648.621) * (-644.100) (-663.292) (-649.422) [-658.273] -- 0:00:43
503000 -- (-646.615) (-651.483) [-644.285] (-647.994) * [-638.003] (-663.668) (-658.314) (-641.353) -- 0:00:43
503500 -- (-641.560) (-654.020) [-648.576] (-649.726) * (-640.044) [-654.746] (-647.746) (-649.369) -- 0:00:43
504000 -- (-642.126) (-648.570) [-645.225] (-655.750) * [-640.030] (-645.270) (-651.757) (-643.633) -- 0:00:43
504500 -- [-639.712] (-648.884) (-646.846) (-652.339) * (-644.546) (-646.842) [-639.743] (-652.236) -- 0:00:44
505000 -- [-649.018] (-649.161) (-656.615) (-659.121) * (-644.143) (-644.798) [-642.889] (-648.005) -- 0:00:44
Average standard deviation of split frequencies: 0.008540
505500 -- (-652.160) [-643.964] (-652.230) (-663.127) * (-643.185) [-644.376] (-655.044) (-660.488) -- 0:00:44
506000 -- (-654.064) (-649.610) [-648.099] (-655.733) * (-649.110) (-642.523) (-650.491) [-647.844] -- 0:00:43
506500 -- (-654.214) [-648.920] (-655.758) (-664.692) * (-660.836) [-641.050] (-643.020) (-660.212) -- 0:00:43
507000 -- (-660.283) (-645.478) (-649.796) [-643.337] * (-664.193) (-649.694) [-650.137] (-659.476) -- 0:00:43
507500 -- (-652.095) [-642.576] (-655.969) (-655.487) * (-656.361) [-646.453] (-649.178) (-660.091) -- 0:00:43
508000 -- (-656.774) [-650.309] (-651.853) (-645.777) * [-651.555] (-644.767) (-653.814) (-651.028) -- 0:00:43
508500 -- (-661.890) (-651.151) (-647.770) [-645.452] * (-655.985) [-648.406] (-653.834) (-648.496) -- 0:00:43
509000 -- (-646.280) [-653.287] (-651.554) (-654.694) * (-656.586) (-642.346) (-653.021) [-651.076] -- 0:00:43
509500 -- (-646.886) (-650.898) (-651.417) [-660.142] * (-646.804) [-647.036] (-653.955) (-651.098) -- 0:00:43
510000 -- (-655.556) (-651.128) [-650.890] (-651.419) * [-643.449] (-656.298) (-648.082) (-647.348) -- 0:00:43
Average standard deviation of split frequencies: 0.008634
510500 -- [-652.039] (-644.565) (-655.892) (-648.533) * [-646.902] (-660.466) (-647.293) (-642.085) -- 0:00:43
511000 -- (-649.459) [-655.018] (-658.978) (-648.830) * (-647.576) (-652.595) (-649.707) [-650.880] -- 0:00:43
511500 -- (-650.328) (-652.003) (-655.573) [-648.654] * (-645.346) (-657.326) [-641.345] (-649.721) -- 0:00:42
512000 -- (-645.871) [-648.908] (-660.743) (-648.764) * (-646.413) (-650.725) [-649.664] (-651.698) -- 0:00:42
512500 -- [-640.855] (-653.525) (-650.592) (-653.050) * [-642.926] (-648.021) (-646.603) (-648.965) -- 0:00:42
513000 -- (-650.618) [-643.963] (-654.579) (-657.839) * (-645.255) (-653.084) (-653.022) [-650.060] -- 0:00:42
513500 -- (-648.774) [-650.784] (-651.123) (-643.143) * [-648.730] (-644.433) (-649.255) (-666.588) -- 0:00:42
514000 -- (-649.943) [-637.113] (-659.756) (-644.971) * (-657.378) [-641.987] (-643.493) (-659.191) -- 0:00:42
514500 -- [-648.320] (-641.248) (-656.327) (-659.002) * [-661.457] (-649.607) (-648.788) (-656.441) -- 0:00:42
515000 -- (-648.681) (-644.210) (-656.567) [-643.458] * (-654.273) (-659.687) [-645.474] (-647.715) -- 0:00:42
Average standard deviation of split frequencies: 0.009297
515500 -- [-647.455] (-637.541) (-644.866) (-644.540) * (-658.530) [-641.511] (-647.143) (-648.524) -- 0:00:43
516000 -- (-654.766) [-649.627] (-648.313) (-649.137) * (-656.252) (-653.038) [-639.634] (-654.334) -- 0:00:43
516500 -- (-660.839) (-647.090) (-643.402) [-641.657] * (-655.038) [-649.806] (-642.646) (-654.952) -- 0:00:43
517000 -- (-661.839) (-648.823) (-647.438) [-645.985] * (-657.061) (-653.618) (-640.307) [-643.775] -- 0:00:42
517500 -- (-648.057) [-643.202] (-657.989) (-647.763) * (-651.297) [-649.405] (-643.777) (-652.380) -- 0:00:42
518000 -- (-649.337) [-646.153] (-656.975) (-646.611) * (-655.687) (-655.049) (-640.457) [-650.385] -- 0:00:42
518500 -- (-651.511) (-647.395) [-648.713] (-642.398) * (-659.051) [-654.024] (-643.186) (-650.840) -- 0:00:42
519000 -- (-651.057) (-655.851) (-645.153) [-654.452] * (-649.524) [-650.348] (-646.661) (-661.751) -- 0:00:42
519500 -- (-659.563) [-650.996] (-655.670) (-658.353) * (-658.815) [-654.296] (-642.239) (-649.037) -- 0:00:42
520000 -- (-654.790) (-656.352) [-655.486] (-654.803) * (-658.695) (-650.682) (-649.299) [-652.500] -- 0:00:42
Average standard deviation of split frequencies: 0.009107
520500 -- (-655.912) (-644.343) [-648.751] (-651.049) * (-658.027) (-649.892) [-637.241] (-655.657) -- 0:00:42
521000 -- (-652.390) (-650.448) [-644.320] (-653.470) * [-652.360] (-653.152) (-638.957) (-649.921) -- 0:00:42
521500 -- (-650.634) (-657.105) (-656.477) [-641.873] * (-648.449) (-651.986) [-645.159] (-654.385) -- 0:00:42
522000 -- (-649.281) (-654.140) (-652.009) [-643.064] * (-656.228) [-641.498] (-645.723) (-668.909) -- 0:00:42
522500 -- [-650.832] (-651.057) (-661.390) (-655.040) * (-654.427) (-649.369) [-642.872] (-650.349) -- 0:00:42
523000 -- (-648.944) (-648.897) (-659.325) [-649.182] * (-650.119) (-643.935) [-639.244] (-641.828) -- 0:00:41
523500 -- (-654.237) (-644.157) (-658.686) [-645.322] * (-647.445) [-653.955] (-647.827) (-641.874) -- 0:00:41
524000 -- (-658.311) (-649.805) (-659.352) [-645.832] * (-658.630) [-646.036] (-655.812) (-646.161) -- 0:00:41
524500 -- [-654.255] (-654.348) (-649.767) (-644.779) * (-652.684) (-650.523) [-645.099] (-652.801) -- 0:00:41
525000 -- (-656.340) (-647.719) (-659.050) [-646.272] * (-659.051) [-636.221] (-651.168) (-655.750) -- 0:00:41
Average standard deviation of split frequencies: 0.009331
525500 -- (-654.226) (-644.793) (-655.932) [-644.330] * (-647.410) (-646.808) [-647.773] (-648.096) -- 0:00:41
526000 -- (-664.844) [-642.006] (-658.509) (-641.776) * (-654.631) (-645.134) (-656.360) [-645.603] -- 0:00:41
526500 -- (-652.975) (-645.689) [-651.715] (-645.561) * (-654.432) [-643.980] (-653.697) (-641.172) -- 0:00:41
527000 -- (-645.604) (-645.892) [-640.884] (-652.173) * (-649.578) (-644.208) (-652.396) [-641.616] -- 0:00:42
527500 -- (-646.211) [-644.674] (-658.004) (-655.395) * [-653.015] (-641.188) (-656.762) (-653.489) -- 0:00:42
528000 -- (-655.520) (-656.369) [-649.161] (-663.817) * (-654.507) (-651.784) [-647.594] (-642.446) -- 0:00:42
528500 -- (-655.669) (-652.062) [-645.256] (-663.268) * (-651.332) (-648.487) [-646.932] (-645.827) -- 0:00:41
529000 -- (-657.404) [-644.443] (-656.538) (-649.936) * (-648.843) (-654.514) (-653.868) [-643.107] -- 0:00:41
529500 -- [-649.619] (-652.121) (-644.647) (-671.319) * [-643.514] (-646.185) (-645.982) (-654.152) -- 0:00:41
530000 -- (-659.235) (-652.776) (-651.096) [-645.920] * (-651.421) (-652.612) (-650.353) [-653.004] -- 0:00:41
Average standard deviation of split frequencies: 0.009249
530500 -- (-654.728) (-652.887) [-644.171] (-649.440) * (-657.007) (-650.663) [-644.911] (-655.109) -- 0:00:41
531000 -- (-655.076) (-650.364) [-646.208] (-661.162) * (-661.465) (-650.566) [-654.955] (-658.377) -- 0:00:41
531500 -- (-649.293) (-644.139) [-642.905] (-664.913) * [-644.026] (-657.621) (-660.817) (-661.779) -- 0:00:41
532000 -- (-654.542) (-653.626) [-645.714] (-666.593) * (-654.430) [-642.188] (-658.512) (-654.869) -- 0:00:41
532500 -- (-658.554) (-651.207) [-662.920] (-652.884) * (-654.625) [-646.694] (-642.007) (-649.656) -- 0:00:41
533000 -- (-654.866) (-653.685) [-645.310] (-662.292) * (-657.107) (-654.881) [-645.947] (-661.101) -- 0:00:41
533500 -- (-648.964) [-648.531] (-652.699) (-648.478) * [-651.395] (-654.542) (-655.575) (-649.690) -- 0:00:41
534000 -- (-648.068) (-651.706) [-640.707] (-657.129) * (-644.982) [-643.652] (-658.057) (-648.418) -- 0:00:41
534500 -- [-646.662] (-642.754) (-663.943) (-660.815) * [-644.158] (-658.387) (-658.267) (-657.886) -- 0:00:40
535000 -- (-649.230) (-655.175) (-656.832) [-654.829] * (-651.598) (-646.646) (-664.713) [-647.228] -- 0:00:40
Average standard deviation of split frequencies: 0.008795
535500 -- (-652.167) (-649.236) (-654.544) [-645.320] * (-648.502) [-645.269] (-660.679) (-643.324) -- 0:00:40
536000 -- (-650.720) [-649.819] (-642.197) (-652.465) * [-647.945] (-644.086) (-655.570) (-654.294) -- 0:00:40
536500 -- [-645.426] (-652.884) (-662.629) (-658.609) * (-641.782) [-643.671] (-659.965) (-654.135) -- 0:00:40
537000 -- (-643.067) (-655.990) (-653.775) [-642.781] * [-651.647] (-649.976) (-652.361) (-650.031) -- 0:00:40
537500 -- [-640.510] (-653.124) (-639.838) (-642.358) * (-645.017) (-640.757) [-643.740] (-651.417) -- 0:00:40
538000 -- (-647.032) (-657.807) [-646.925] (-647.085) * (-645.526) (-655.317) (-653.646) [-646.118] -- 0:00:41
538500 -- [-641.450] (-645.992) (-641.055) (-655.501) * (-651.056) (-648.549) [-645.952] (-649.298) -- 0:00:41
539000 -- (-647.177) (-650.998) [-636.557] (-637.775) * (-657.531) [-644.006] (-652.730) (-646.011) -- 0:00:41
539500 -- [-644.355] (-643.526) (-641.791) (-641.839) * (-645.362) [-648.129] (-662.520) (-650.194) -- 0:00:40
540000 -- (-652.164) [-642.859] (-645.583) (-654.114) * [-644.669] (-649.890) (-650.700) (-644.736) -- 0:00:40
Average standard deviation of split frequencies: 0.008411
540500 -- (-656.882) [-643.060] (-643.227) (-662.551) * (-638.463) (-652.757) [-643.232] (-643.128) -- 0:00:40
541000 -- (-653.951) (-642.402) [-646.515] (-646.937) * (-669.713) (-654.090) (-655.215) [-644.846] -- 0:00:40
541500 -- (-660.454) [-639.279] (-645.968) (-654.549) * [-643.419] (-656.398) (-653.921) (-642.011) -- 0:00:40
542000 -- (-660.437) (-648.203) (-647.132) [-643.550] * (-651.387) (-647.621) (-653.094) [-642.534] -- 0:00:40
542500 -- [-649.052] (-649.822) (-643.932) (-650.285) * (-648.232) (-651.225) (-652.986) [-647.479] -- 0:00:40
543000 -- (-647.275) (-647.239) [-646.548] (-642.580) * (-661.649) (-648.618) [-638.175] (-652.319) -- 0:00:40
543500 -- (-661.673) (-648.270) [-639.306] (-655.319) * (-646.368) (-648.817) [-636.841] (-639.252) -- 0:00:40
544000 -- (-657.036) (-641.386) [-642.529] (-664.020) * (-645.883) (-657.326) [-642.744] (-652.143) -- 0:00:40
544500 -- (-645.994) [-641.763] (-645.162) (-653.358) * (-647.286) (-664.851) [-645.917] (-652.773) -- 0:00:40
545000 -- (-650.650) [-638.909] (-650.392) (-646.436) * [-649.274] (-652.255) (-649.290) (-653.446) -- 0:00:40
Average standard deviation of split frequencies: 0.008278
545500 -- (-649.632) (-643.479) (-646.847) [-646.677] * (-651.243) (-655.962) [-645.404] (-645.825) -- 0:00:39
546000 -- (-650.397) (-647.472) [-640.634] (-648.121) * (-650.418) (-642.746) [-652.816] (-655.856) -- 0:00:39
546500 -- (-647.591) [-642.086] (-642.807) (-652.270) * (-651.886) (-657.450) (-645.876) [-642.818] -- 0:00:39
547000 -- (-652.258) [-641.780] (-644.948) (-657.212) * (-643.300) (-660.279) [-643.404] (-644.135) -- 0:00:39
547500 -- (-658.969) [-637.093] (-650.436) (-652.010) * (-654.784) (-654.522) (-649.974) [-646.176] -- 0:00:39
548000 -- (-640.628) (-642.175) [-648.623] (-656.019) * (-648.418) (-644.264) [-643.771] (-642.159) -- 0:00:39
548500 -- (-647.875) [-640.253] (-658.237) (-658.302) * [-653.212] (-653.857) (-650.308) (-639.661) -- 0:00:39
549000 -- (-652.051) (-639.372) (-650.052) [-645.407] * (-656.751) (-653.586) (-652.020) [-642.543] -- 0:00:39
549500 -- (-649.731) (-659.155) [-657.365] (-656.122) * (-645.655) (-656.844) (-645.027) [-651.590] -- 0:00:40
550000 -- [-645.235] (-645.975) (-655.062) (-656.816) * [-644.477] (-657.103) (-657.745) (-651.050) -- 0:00:40
Average standard deviation of split frequencies: 0.007956
550500 -- [-643.797] (-641.583) (-663.796) (-639.963) * (-651.141) (-659.808) [-639.684] (-644.761) -- 0:00:40
551000 -- [-643.699] (-646.281) (-658.173) (-653.134) * (-652.711) (-640.998) (-638.557) [-637.806] -- 0:00:39
551500 -- (-639.731) (-648.524) [-645.968] (-657.677) * (-655.197) (-642.023) [-642.516] (-651.940) -- 0:00:39
552000 -- (-651.206) (-642.260) [-649.000] (-653.544) * [-656.299] (-648.935) (-639.319) (-644.424) -- 0:00:39
552500 -- (-640.710) (-653.825) [-646.892] (-651.761) * (-654.745) (-653.743) (-647.848) [-648.815] -- 0:00:39
553000 -- (-648.830) [-650.626] (-651.824) (-653.553) * (-652.865) (-649.621) (-648.373) [-639.838] -- 0:00:39
553500 -- (-638.629) (-657.166) [-641.928] (-646.040) * (-651.287) [-641.773] (-658.278) (-643.344) -- 0:00:39
554000 -- (-651.754) (-659.214) [-639.499] (-656.999) * (-644.012) [-653.895] (-659.136) (-658.172) -- 0:00:39
554500 -- (-649.914) (-662.717) [-640.653] (-644.648) * (-651.132) [-644.968] (-659.143) (-654.595) -- 0:00:39
555000 -- (-657.325) (-652.011) [-639.483] (-644.468) * (-664.008) [-643.025] (-659.783) (-647.993) -- 0:00:39
Average standard deviation of split frequencies: 0.007431
555500 -- (-662.015) [-645.388] (-637.536) (-660.095) * (-650.471) [-639.232] (-653.991) (-649.100) -- 0:00:39
556000 -- (-654.349) (-653.811) [-638.739] (-659.473) * (-649.102) (-653.355) (-645.365) [-645.028] -- 0:00:39
556500 -- (-649.705) (-662.094) (-637.668) [-643.271] * (-650.301) (-655.333) (-653.358) [-637.534] -- 0:00:39
557000 -- [-642.884] (-648.272) (-646.554) (-653.053) * (-645.508) (-648.826) (-649.267) [-645.394] -- 0:00:38
557500 -- (-644.151) [-646.799] (-640.565) (-652.514) * [-646.520] (-643.498) (-657.423) (-640.873) -- 0:00:38
558000 -- [-643.176] (-656.877) (-643.633) (-658.251) * [-642.720] (-642.445) (-649.240) (-671.763) -- 0:00:38
558500 -- [-645.471] (-657.547) (-637.656) (-660.152) * (-653.842) [-641.597] (-642.473) (-655.125) -- 0:00:38
559000 -- (-643.223) (-658.600) [-641.131] (-655.650) * (-655.453) [-646.475] (-659.758) (-644.084) -- 0:00:38
559500 -- (-640.607) (-667.113) [-642.874] (-655.755) * (-651.426) (-640.870) (-665.055) [-641.224] -- 0:00:38
560000 -- (-643.273) (-656.227) [-647.925] (-654.443) * (-661.252) [-642.258] (-649.442) (-639.516) -- 0:00:38
Average standard deviation of split frequencies: 0.007122
560500 -- (-638.265) (-654.693) [-645.065] (-647.284) * (-652.882) [-639.283] (-639.328) (-642.274) -- 0:00:38
561000 -- [-637.619] (-656.069) (-638.214) (-655.892) * (-657.292) (-647.804) [-639.286] (-650.244) -- 0:00:39
561500 -- (-640.380) (-651.989) [-638.982] (-647.499) * (-668.782) (-649.510) [-640.330] (-645.104) -- 0:00:39
562000 -- (-651.218) (-661.653) [-637.664] (-652.907) * (-650.095) (-665.047) [-643.668] (-651.203) -- 0:00:38
562500 -- (-640.808) (-644.951) [-641.161] (-651.264) * (-655.968) (-656.833) [-641.072] (-657.635) -- 0:00:38
563000 -- (-638.386) (-647.668) [-640.658] (-669.142) * (-651.748) (-655.814) [-643.347] (-648.080) -- 0:00:38
563500 -- [-642.600] (-662.891) (-647.174) (-651.171) * [-650.196] (-657.462) (-647.091) (-647.416) -- 0:00:38
564000 -- [-646.128] (-652.023) (-644.294) (-662.864) * (-649.883) (-648.685) (-654.126) [-648.433] -- 0:00:38
564500 -- (-649.336) [-653.707] (-653.784) (-657.189) * (-654.965) (-653.910) (-656.645) [-654.361] -- 0:00:38
565000 -- (-641.553) (-657.910) (-643.150) [-651.084] * (-660.085) (-653.998) [-648.524] (-646.686) -- 0:00:38
Average standard deviation of split frequencies: 0.006712
565500 -- [-638.113] (-657.912) (-637.966) (-653.675) * [-650.073] (-642.723) (-654.776) (-659.656) -- 0:00:38
566000 -- (-641.793) [-644.766] (-647.829) (-650.060) * (-650.731) [-648.646] (-646.369) (-656.060) -- 0:00:38
566500 -- (-652.505) (-652.235) [-638.083] (-650.519) * (-659.265) [-642.209] (-647.529) (-661.138) -- 0:00:38
567000 -- (-651.693) [-652.116] (-649.101) (-655.311) * (-643.823) (-645.071) [-638.436] (-655.703) -- 0:00:38
567500 -- (-648.870) (-655.708) (-646.479) [-649.159] * (-645.970) [-641.938] (-642.206) (-658.570) -- 0:00:38
568000 -- [-650.343] (-661.739) (-650.268) (-641.828) * (-645.133) [-643.783] (-648.788) (-656.653) -- 0:00:38
568500 -- [-645.326] (-655.196) (-652.995) (-648.351) * (-646.620) [-639.923] (-645.493) (-661.620) -- 0:00:37
569000 -- (-657.733) (-651.104) (-654.690) [-649.823] * (-654.513) (-647.110) [-645.509] (-655.017) -- 0:00:37
569500 -- (-651.530) [-653.164] (-647.489) (-665.378) * (-662.514) (-655.898) [-638.973] (-644.711) -- 0:00:37
570000 -- (-658.085) (-643.590) [-646.358] (-664.239) * (-661.760) (-642.239) [-648.718] (-648.893) -- 0:00:37
Average standard deviation of split frequencies: 0.006706
570500 -- (-638.245) [-647.988] (-651.876) (-654.999) * (-660.481) (-649.751) [-642.406] (-654.128) -- 0:00:37
571000 -- (-652.013) [-655.736] (-645.182) (-658.139) * (-654.867) (-658.251) [-636.140] (-652.536) -- 0:00:37
571500 -- (-646.934) [-642.851] (-654.277) (-657.207) * (-647.860) (-653.324) (-639.009) [-647.124] -- 0:00:37
572000 -- (-650.917) (-649.302) (-656.890) [-639.981] * [-648.758] (-655.164) (-645.439) (-650.119) -- 0:00:38
572500 -- (-647.501) (-653.348) (-650.884) [-649.119] * (-650.326) (-650.085) [-642.751] (-642.180) -- 0:00:38
573000 -- (-644.845) (-658.523) (-660.108) [-646.661] * (-661.270) [-641.056] (-639.288) (-641.481) -- 0:00:38
573500 -- [-643.260] (-653.725) (-651.425) (-643.253) * (-658.271) [-649.965] (-642.629) (-659.751) -- 0:00:37
574000 -- (-661.021) (-652.628) [-648.529] (-641.181) * (-652.650) (-651.357) [-638.852] (-643.777) -- 0:00:37
574500 -- (-659.341) (-649.201) [-644.149] (-656.779) * (-652.308) [-644.118] (-641.293) (-649.952) -- 0:00:37
575000 -- (-643.435) [-649.640] (-642.328) (-652.794) * [-646.261] (-646.159) (-644.313) (-664.566) -- 0:00:37
Average standard deviation of split frequencies: 0.005831
575500 -- [-651.190] (-649.328) (-652.521) (-648.922) * (-659.353) (-641.585) [-636.118] (-656.559) -- 0:00:37
576000 -- (-651.064) (-657.033) [-637.190] (-657.989) * (-656.587) (-646.472) [-639.707] (-659.462) -- 0:00:37
576500 -- (-645.207) (-660.287) [-642.449] (-643.178) * (-665.311) (-652.980) (-643.708) [-644.096] -- 0:00:37
577000 -- (-652.118) (-663.027) [-636.188] (-655.146) * (-642.752) (-668.789) [-641.344] (-639.663) -- 0:00:37
577500 -- (-650.460) [-647.611] (-649.725) (-655.990) * (-645.459) (-650.326) [-639.308] (-643.165) -- 0:00:37
578000 -- (-649.892) (-658.144) [-647.843] (-649.475) * (-654.434) (-643.310) (-640.588) [-639.405] -- 0:00:37
578500 -- (-646.602) (-664.741) [-654.128] (-648.245) * (-645.665) (-656.609) [-645.846] (-640.618) -- 0:00:37
579000 -- [-639.920] (-654.730) (-644.145) (-647.828) * (-642.591) (-646.134) [-637.836] (-651.668) -- 0:00:37
579500 -- (-662.410) (-654.043) (-658.176) [-646.665] * (-662.018) (-652.444) (-656.302) [-644.441] -- 0:00:37
580000 -- [-645.299] (-653.878) (-655.518) (-645.093) * (-651.902) (-650.505) (-645.744) [-638.554] -- 0:00:36
Average standard deviation of split frequencies: 0.006241
580500 -- (-657.333) (-654.352) (-645.772) [-640.653] * (-647.308) [-639.435] (-655.280) (-640.155) -- 0:00:36
581000 -- (-657.727) (-647.913) [-645.406] (-643.949) * (-647.516) (-648.765) [-640.225] (-641.264) -- 0:00:36
581500 -- (-642.739) [-645.889] (-645.346) (-641.165) * (-662.224) (-654.813) (-644.320) [-648.328] -- 0:00:36
582000 -- (-652.324) (-654.682) (-653.215) [-645.222] * (-651.491) (-644.358) (-654.830) [-647.078] -- 0:00:36
582500 -- (-656.166) (-649.089) [-644.068] (-642.254) * (-650.293) [-642.124] (-651.392) (-650.333) -- 0:00:36
583000 -- (-660.291) (-640.043) (-654.587) [-639.251] * (-650.098) (-648.852) [-645.159] (-665.029) -- 0:00:36
583500 -- (-646.702) (-645.492) (-646.075) [-640.273] * (-652.371) (-650.460) [-646.338] (-659.844) -- 0:00:37
584000 -- (-653.544) (-653.934) (-641.917) [-656.986] * [-653.806] (-655.179) (-652.582) (-664.427) -- 0:00:37
584500 -- (-650.571) (-650.683) [-639.789] (-659.332) * (-654.029) (-664.582) [-640.887] (-652.410) -- 0:00:36
585000 -- [-643.623] (-646.493) (-645.299) (-657.774) * (-647.125) (-653.992) [-641.181] (-653.544) -- 0:00:36
Average standard deviation of split frequencies: 0.006938
585500 -- (-654.925) [-644.479] (-646.103) (-653.724) * (-651.881) (-643.824) (-648.827) [-651.013] -- 0:00:36
586000 -- (-644.415) (-649.318) [-636.737] (-657.389) * (-653.537) (-659.297) [-645.712] (-645.014) -- 0:00:36
586500 -- (-644.229) (-654.135) (-644.693) [-657.436] * (-659.414) (-656.078) [-642.300] (-646.257) -- 0:00:36
587000 -- (-649.393) [-641.179] (-647.052) (-647.286) * (-647.702) (-655.752) [-651.594] (-655.667) -- 0:00:36
587500 -- [-646.601] (-642.760) (-647.224) (-658.443) * (-662.314) [-649.983] (-652.464) (-648.037) -- 0:00:36
588000 -- (-661.129) [-640.906] (-647.577) (-652.600) * (-655.841) [-649.711] (-640.574) (-649.458) -- 0:00:36
588500 -- (-662.912) (-647.290) (-648.699) [-637.949] * [-642.197] (-643.732) (-640.940) (-654.570) -- 0:00:36
589000 -- (-666.884) [-644.301] (-649.715) (-634.603) * (-645.968) (-652.176) (-645.471) [-646.767] -- 0:00:36
589500 -- (-646.755) (-642.504) (-655.691) [-639.517] * (-651.833) (-655.725) [-643.961] (-638.020) -- 0:00:36
590000 -- (-650.807) (-642.424) (-662.106) [-638.214] * (-658.828) (-646.467) [-649.058] (-650.562) -- 0:00:36
Average standard deviation of split frequencies: 0.006834
590500 -- (-649.357) (-649.252) (-646.617) [-636.997] * (-649.540) [-649.267] (-643.374) (-652.219) -- 0:00:36
591000 -- (-649.824) (-665.948) (-649.512) [-639.168] * (-661.226) (-648.380) [-642.842] (-651.027) -- 0:00:35
591500 -- (-658.265) (-656.584) (-663.853) [-639.312] * (-659.174) (-652.894) [-639.835] (-657.679) -- 0:00:35
592000 -- (-649.804) (-650.977) [-647.097] (-647.099) * (-651.706) (-645.882) (-642.154) [-651.616] -- 0:00:35
592500 -- (-657.999) (-643.586) [-642.265] (-645.351) * [-651.772] (-653.858) (-640.757) (-644.353) -- 0:00:35
593000 -- (-659.445) (-646.138) [-643.728] (-643.695) * (-649.699) (-649.819) (-643.474) [-649.129] -- 0:00:35
593500 -- (-649.142) [-644.664] (-652.655) (-646.519) * [-643.879] (-661.415) (-642.269) (-642.865) -- 0:00:35
594000 -- (-648.335) (-650.348) (-650.871) [-642.005] * (-657.600) (-649.333) [-643.984] (-646.579) -- 0:00:35
594500 -- (-668.656) (-648.079) [-649.341] (-641.028) * (-656.284) [-642.115] (-647.573) (-659.342) -- 0:00:35
595000 -- (-651.089) (-642.367) (-642.165) [-640.678] * (-648.032) (-664.466) (-643.029) [-651.137] -- 0:00:36
Average standard deviation of split frequencies: 0.007415
595500 -- (-644.158) (-656.459) [-639.908] (-639.946) * (-644.901) (-654.494) [-645.987] (-658.746) -- 0:00:36
596000 -- (-654.800) (-640.696) (-641.748) [-638.179] * (-654.713) (-652.044) [-645.966] (-651.338) -- 0:00:35
596500 -- (-650.172) (-653.311) [-644.780] (-639.118) * (-648.774) (-647.194) (-649.574) [-649.569] -- 0:00:35
597000 -- (-649.591) (-661.161) [-655.473] (-641.702) * [-651.657] (-655.485) (-645.391) (-646.141) -- 0:00:35
597500 -- (-648.039) (-648.848) (-651.139) [-639.232] * (-656.581) (-648.668) (-647.642) [-643.151] -- 0:00:35
598000 -- [-650.712] (-663.179) (-653.056) (-642.339) * (-645.868) (-653.402) (-640.247) [-642.174] -- 0:00:35
598500 -- (-655.314) (-661.209) [-650.934] (-645.043) * (-649.123) (-663.880) (-649.604) [-643.467] -- 0:00:35
599000 -- [-660.623] (-659.291) (-645.625) (-643.539) * [-644.640] (-655.613) (-651.538) (-654.637) -- 0:00:35
599500 -- (-657.194) (-654.810) (-644.986) [-652.610] * (-658.429) (-652.183) (-656.485) [-648.883] -- 0:00:35
600000 -- (-659.617) (-643.917) [-639.758] (-638.733) * (-660.171) [-644.209] (-660.689) (-646.070) -- 0:00:35
Average standard deviation of split frequencies: 0.007652
600500 -- (-648.389) (-650.976) (-641.661) [-656.070] * (-654.653) [-643.689] (-650.320) (-647.135) -- 0:00:35
601000 -- (-651.359) (-647.996) [-640.155] (-653.185) * (-660.771) [-646.355] (-655.904) (-648.039) -- 0:00:35
601500 -- [-643.879] (-645.877) (-664.975) (-659.894) * (-656.963) [-642.223] (-654.230) (-641.333) -- 0:00:35
602000 -- (-652.034) (-656.942) [-640.350] (-649.236) * (-651.746) [-642.264] (-649.922) (-642.036) -- 0:00:35
602500 -- [-643.949] (-660.140) (-653.348) (-655.377) * (-651.174) (-654.869) (-657.338) [-646.595] -- 0:00:34
603000 -- (-652.504) (-658.515) (-647.681) [-638.524] * (-659.253) (-653.770) [-644.541] (-648.461) -- 0:00:34
603500 -- (-653.059) (-658.483) [-650.661] (-651.816) * (-665.076) [-650.711] (-646.283) (-645.946) -- 0:00:34
604000 -- [-650.682] (-660.388) (-655.842) (-657.521) * (-656.378) [-651.484] (-650.451) (-643.178) -- 0:00:34
604500 -- (-652.646) [-647.330] (-655.354) (-660.560) * (-660.816) (-651.018) (-643.945) [-643.973] -- 0:00:34
605000 -- (-648.649) [-650.570] (-652.584) (-660.485) * (-648.926) (-647.701) (-648.187) [-646.511] -- 0:00:34
Average standard deviation of split frequencies: 0.008654
605500 -- (-651.366) (-648.908) [-644.466] (-653.139) * (-650.640) (-651.046) [-646.252] (-650.783) -- 0:00:34
606000 -- (-646.857) [-645.894] (-642.463) (-653.079) * (-658.313) [-642.370] (-649.442) (-650.920) -- 0:00:34
606500 -- (-653.227) [-649.499] (-644.419) (-643.410) * (-652.543) [-642.009] (-646.588) (-658.482) -- 0:00:35
607000 -- (-660.104) (-651.614) (-642.142) [-648.457] * (-651.678) [-646.804] (-653.559) (-656.359) -- 0:00:34
607500 -- (-655.739) (-651.432) [-643.065] (-652.864) * [-652.754] (-651.081) (-661.966) (-656.698) -- 0:00:34
608000 -- [-646.063] (-654.868) (-647.327) (-641.990) * (-646.312) [-640.002] (-659.456) (-655.915) -- 0:00:34
608500 -- (-659.510) [-652.560] (-642.489) (-647.574) * (-648.931) (-651.098) [-651.479] (-639.085) -- 0:00:34
609000 -- (-658.595) (-652.250) [-637.679] (-646.146) * (-644.879) [-646.922] (-655.592) (-653.434) -- 0:00:34
609500 -- (-655.060) (-653.026) (-641.745) [-646.151] * (-649.538) [-640.955] (-659.563) (-645.157) -- 0:00:34
610000 -- [-642.575] (-661.239) (-649.698) (-653.522) * (-642.202) [-646.686] (-659.744) (-654.898) -- 0:00:34
Average standard deviation of split frequencies: 0.009360
610500 -- [-658.000] (-654.144) (-650.790) (-668.552) * (-641.807) [-645.254] (-652.109) (-642.740) -- 0:00:34
611000 -- (-653.888) (-645.694) [-648.119] (-654.070) * (-654.121) (-646.478) [-657.608] (-650.740) -- 0:00:34
611500 -- [-653.231] (-642.907) (-647.419) (-646.724) * (-652.584) [-647.621] (-652.044) (-656.483) -- 0:00:34
612000 -- (-638.419) (-647.971) [-652.809] (-657.671) * (-658.189) (-647.275) [-643.499] (-651.476) -- 0:00:34
612500 -- (-649.955) [-647.738] (-649.968) (-651.701) * (-648.391) [-638.884] (-649.297) (-654.492) -- 0:00:34
613000 -- [-639.239] (-645.439) (-650.792) (-653.083) * (-644.570) (-656.386) [-651.520] (-656.032) -- 0:00:34
613500 -- (-653.418) (-650.853) [-653.042] (-644.879) * (-659.907) (-654.119) [-645.716] (-650.803) -- 0:00:34
614000 -- (-654.798) [-640.220] (-658.194) (-643.754) * (-640.925) [-641.850] (-644.799) (-654.649) -- 0:00:33
614500 -- [-638.545] (-648.125) (-660.020) (-657.431) * [-642.626] (-651.998) (-655.419) (-651.122) -- 0:00:33
615000 -- (-646.328) [-645.684] (-647.445) (-650.364) * [-640.571] (-645.839) (-649.805) (-643.550) -- 0:00:33
Average standard deviation of split frequencies: 0.009040
615500 -- (-657.658) [-644.567] (-654.880) (-642.596) * [-648.486] (-653.786) (-647.270) (-645.906) -- 0:00:33
616000 -- (-658.710) (-655.121) [-640.988] (-656.207) * (-660.821) (-647.367) (-655.454) [-641.603] -- 0:00:33
616500 -- (-655.141) (-649.025) (-654.456) [-640.937] * (-648.396) [-649.893] (-650.160) (-662.058) -- 0:00:33
617000 -- [-650.274] (-646.512) (-646.705) (-640.668) * (-655.876) (-649.912) (-653.361) [-640.159] -- 0:00:33
617500 -- [-647.342] (-640.290) (-648.514) (-644.508) * (-651.769) (-652.681) [-648.578] (-642.863) -- 0:00:33
618000 -- (-648.743) (-643.671) (-651.627) [-639.549] * (-653.100) (-651.938) (-651.199) [-659.203] -- 0:00:33
618500 -- (-646.061) [-637.960] (-648.393) (-650.136) * (-647.186) (-655.782) (-658.567) [-651.062] -- 0:00:33
619000 -- (-641.383) (-649.094) (-657.355) [-642.779] * (-646.820) (-651.879) (-654.781) [-650.745] -- 0:00:33
619500 -- (-651.328) [-650.371] (-645.577) (-656.766) * (-656.839) (-661.078) [-650.154] (-642.064) -- 0:00:33
620000 -- [-640.552] (-647.605) (-655.438) (-662.247) * (-649.184) [-647.340] (-650.212) (-653.934) -- 0:00:33
Average standard deviation of split frequencies: 0.009019
620500 -- (-659.101) (-664.245) (-641.162) [-646.116] * (-653.929) (-649.510) (-647.454) [-642.200] -- 0:00:33
621000 -- (-641.780) [-643.606] (-644.793) (-645.772) * (-648.031) [-647.870] (-664.399) (-637.030) -- 0:00:33
621500 -- (-646.262) (-650.038) (-646.451) [-643.327] * (-649.279) [-646.986] (-649.367) (-664.863) -- 0:00:33
622000 -- [-645.689] (-651.277) (-658.118) (-644.406) * (-657.418) (-653.586) (-649.497) [-655.234] -- 0:00:33
622500 -- (-656.420) (-655.200) (-646.948) [-646.197] * (-654.395) (-637.934) (-652.863) [-648.822] -- 0:00:33
623000 -- (-660.920) (-643.962) (-646.975) [-642.214] * (-656.455) (-647.793) (-641.769) [-642.996] -- 0:00:33
623500 -- (-642.482) [-646.567] (-661.033) (-644.461) * (-643.353) (-645.863) (-644.146) [-641.198] -- 0:00:33
624000 -- (-659.856) (-645.697) (-645.061) [-640.076] * (-642.996) (-648.160) (-649.771) [-648.137] -- 0:00:33
624500 -- (-651.243) (-644.794) (-646.874) [-638.132] * [-646.157] (-657.799) (-648.696) (-646.621) -- 0:00:33
625000 -- (-660.958) (-648.747) (-645.648) [-642.751] * (-648.779) (-649.971) [-641.492] (-644.855) -- 0:00:33
Average standard deviation of split frequencies: 0.008754
625500 -- (-653.571) [-636.687] (-647.090) (-652.135) * (-639.804) (-653.836) [-648.132] (-643.195) -- 0:00:32
626000 -- [-651.411] (-649.743) (-646.476) (-647.803) * [-638.232] (-656.345) (-641.768) (-647.272) -- 0:00:32
626500 -- (-644.785) [-647.501] (-673.187) (-639.915) * [-640.603] (-665.996) (-656.740) (-644.006) -- 0:00:32
627000 -- (-648.437) (-657.337) (-648.382) [-646.575] * [-649.406] (-643.379) (-644.351) (-644.653) -- 0:00:32
627500 -- (-653.286) (-653.125) (-647.003) [-645.331] * [-647.960] (-656.404) (-652.149) (-652.382) -- 0:00:32
628000 -- (-647.263) [-643.822] (-640.621) (-641.452) * (-647.809) (-659.445) (-650.025) [-640.881] -- 0:00:32
628500 -- [-642.341] (-654.978) (-654.775) (-643.640) * (-647.948) (-664.454) (-656.609) [-645.591] -- 0:00:32
629000 -- (-642.951) (-644.860) [-650.590] (-647.278) * (-652.059) (-657.503) (-661.260) [-641.905] -- 0:00:32
629500 -- [-643.927] (-652.022) (-645.237) (-642.336) * (-653.653) [-648.446] (-651.786) (-653.689) -- 0:00:32
630000 -- (-643.328) (-651.603) (-649.018) [-646.735] * (-644.926) (-649.646) [-634.564] (-642.348) -- 0:00:32
Average standard deviation of split frequencies: 0.009189
630500 -- (-644.341) [-647.158] (-646.317) (-650.243) * (-650.667) (-656.573) (-645.106) [-642.739] -- 0:00:32
631000 -- (-661.396) [-644.030] (-656.583) (-646.934) * (-653.622) (-654.807) (-650.417) [-639.703] -- 0:00:32
631500 -- (-655.302) (-656.996) (-657.746) [-657.837] * (-655.972) (-661.137) (-652.379) [-644.369] -- 0:00:32
632000 -- (-656.701) (-652.205) [-642.100] (-650.206) * (-649.750) [-656.335] (-657.378) (-654.351) -- 0:00:32
632500 -- (-649.770) (-649.203) [-646.754] (-649.975) * (-656.229) (-652.095) (-645.256) [-650.360] -- 0:00:32
633000 -- (-654.684) (-647.463) [-653.013] (-643.162) * (-662.077) (-655.421) (-641.361) [-647.650] -- 0:00:32
633500 -- [-649.749] (-643.760) (-645.624) (-650.152) * (-652.860) (-662.331) [-636.719] (-644.317) -- 0:00:32
634000 -- [-658.096] (-646.059) (-650.993) (-651.480) * (-657.471) (-655.352) [-639.346] (-649.881) -- 0:00:32
634500 -- (-643.546) (-652.230) [-639.850] (-653.367) * (-653.163) (-653.073) [-640.864] (-655.677) -- 0:00:32
635000 -- (-644.302) [-660.020] (-639.570) (-655.310) * (-656.430) (-642.547) [-639.801] (-653.819) -- 0:00:32
Average standard deviation of split frequencies: 0.007829
635500 -- (-642.540) (-650.652) (-657.222) [-646.632] * (-647.888) (-649.818) [-638.264] (-654.108) -- 0:00:32
636000 -- [-638.302] (-663.555) (-646.930) (-660.766) * (-651.689) (-660.844) (-644.214) [-643.003] -- 0:00:32
636500 -- (-647.549) [-642.018] (-647.310) (-652.233) * [-645.979] (-661.616) (-637.534) (-656.495) -- 0:00:31
637000 -- (-647.177) (-652.740) [-649.367] (-661.040) * (-659.266) (-660.050) [-637.799] (-643.888) -- 0:00:31
637500 -- (-656.439) [-646.091] (-644.393) (-650.642) * (-646.689) (-646.414) [-644.076] (-646.870) -- 0:00:31
638000 -- [-658.810] (-653.793) (-642.055) (-653.144) * (-643.103) (-658.017) [-645.184] (-650.961) -- 0:00:31
638500 -- (-654.795) (-645.733) (-649.306) [-641.528] * (-651.901) (-662.855) [-637.201] (-645.518) -- 0:00:31
639000 -- (-648.320) (-656.091) (-653.657) [-644.697] * [-640.441] (-657.859) (-642.203) (-655.136) -- 0:00:31
639500 -- (-650.063) (-643.859) [-649.265] (-638.139) * (-645.083) (-669.684) [-641.205] (-658.203) -- 0:00:31
640000 -- (-661.784) (-646.330) (-660.968) [-639.872] * (-640.790) (-652.781) [-639.394] (-652.488) -- 0:00:31
Average standard deviation of split frequencies: 0.008570
640500 -- (-661.992) (-644.551) (-652.283) [-641.736] * [-641.180] (-659.624) (-648.843) (-658.205) -- 0:00:31
641000 -- (-647.328) (-657.898) [-643.036] (-652.124) * [-642.188] (-647.293) (-658.132) (-654.590) -- 0:00:31
641500 -- (-652.152) (-650.115) (-649.934) [-644.462] * [-636.253] (-654.384) (-645.071) (-653.785) -- 0:00:31
642000 -- (-664.093) [-647.707] (-654.245) (-643.072) * (-642.340) (-651.295) [-642.611] (-657.080) -- 0:00:31
642500 -- (-651.803) (-648.806) [-642.562] (-644.812) * [-643.048] (-643.956) (-649.861) (-657.121) -- 0:00:31
643000 -- (-657.309) (-654.006) [-636.750] (-642.592) * [-637.589] (-648.717) (-646.072) (-660.667) -- 0:00:31
643500 -- (-651.878) (-653.330) (-658.765) [-645.845] * (-638.568) (-651.223) (-654.010) [-640.495] -- 0:00:31
644000 -- (-657.528) (-644.743) (-645.490) [-640.596] * (-647.925) (-658.898) [-645.891] (-649.158) -- 0:00:31
644500 -- (-647.854) (-647.367) [-639.085] (-646.959) * (-659.688) (-644.743) (-661.268) [-650.190] -- 0:00:31
645000 -- (-647.400) (-644.085) [-641.956] (-657.900) * (-652.095) (-651.796) (-661.189) [-652.539] -- 0:00:31
Average standard deviation of split frequencies: 0.008413
645500 -- (-653.616) (-644.152) (-658.044) [-638.886] * (-648.647) (-650.025) (-651.236) [-641.728] -- 0:00:31
646000 -- (-664.142) (-644.860) [-639.382] (-653.698) * [-644.270] (-653.068) (-652.750) (-662.594) -- 0:00:31
646500 -- (-645.189) (-652.313) (-645.034) [-651.798] * (-643.924) [-649.771] (-642.360) (-655.707) -- 0:00:31
647000 -- (-647.870) (-648.231) [-644.947] (-641.955) * (-653.069) (-648.671) [-640.255] (-659.209) -- 0:00:31
647500 -- (-651.770) (-644.598) [-645.022] (-661.685) * (-665.580) [-646.692] (-648.765) (-664.127) -- 0:00:31
648000 -- [-647.509] (-651.167) (-651.965) (-640.103) * (-651.604) [-644.304] (-647.261) (-655.042) -- 0:00:30
648500 -- (-655.503) (-653.133) (-650.170) [-638.770] * (-660.492) (-657.062) (-645.825) [-652.250] -- 0:00:30
649000 -- (-660.603) (-655.913) [-642.542] (-645.867) * (-655.153) (-646.660) [-641.943] (-656.935) -- 0:00:30
649500 -- (-649.301) [-643.622] (-643.924) (-668.982) * (-653.692) [-644.401] (-651.291) (-665.155) -- 0:00:30
650000 -- [-644.864] (-655.948) (-661.536) (-659.393) * (-659.603) [-651.238] (-642.999) (-655.402) -- 0:00:30
Average standard deviation of split frequencies: 0.008950
650500 -- (-659.412) (-654.114) (-646.760) [-640.537] * (-669.295) (-659.723) (-643.513) [-649.752] -- 0:00:30
651000 -- [-654.126] (-643.894) (-654.772) (-641.532) * (-658.272) (-652.446) [-647.671] (-651.899) -- 0:00:30
651500 -- [-651.331] (-650.276) (-655.575) (-643.235) * (-650.820) (-640.083) [-650.640] (-650.921) -- 0:00:30
652000 -- [-641.023] (-648.854) (-649.253) (-647.241) * [-644.554] (-658.559) (-652.995) (-645.856) -- 0:00:30
652500 -- (-654.354) (-651.061) (-659.579) [-642.827] * [-643.572] (-661.806) (-648.748) (-648.123) -- 0:00:30
653000 -- [-641.540] (-649.679) (-660.395) (-647.878) * (-638.861) (-657.041) [-642.800] (-657.257) -- 0:00:30
653500 -- [-640.371] (-658.542) (-641.886) (-653.619) * (-644.173) [-645.819] (-650.336) (-649.430) -- 0:00:30
654000 -- (-637.260) (-652.107) [-637.981] (-646.580) * (-643.357) (-644.433) [-642.057] (-659.017) -- 0:00:30
654500 -- (-658.336) (-656.865) (-648.765) [-638.451] * (-641.537) [-643.848] (-652.741) (-642.463) -- 0:00:30
655000 -- [-641.314] (-645.217) (-652.648) (-646.533) * [-638.163] (-645.135) (-663.993) (-647.806) -- 0:00:30
Average standard deviation of split frequencies: 0.008201
655500 -- [-644.552] (-660.916) (-643.904) (-645.628) * [-635.457] (-647.370) (-654.543) (-663.390) -- 0:00:30
656000 -- [-650.655] (-656.797) (-654.106) (-654.457) * [-643.936] (-653.912) (-659.453) (-653.892) -- 0:00:30
656500 -- (-656.662) (-647.232) (-655.522) [-641.324] * [-647.286] (-644.376) (-661.635) (-667.348) -- 0:00:30
657000 -- (-657.636) (-640.674) [-648.688] (-638.864) * (-639.368) [-646.847] (-647.435) (-649.668) -- 0:00:30
657500 -- (-659.171) (-641.266) (-650.094) [-641.237] * [-639.679] (-648.090) (-657.356) (-644.869) -- 0:00:30
658000 -- (-655.541) (-645.815) (-650.033) [-641.891] * (-643.194) (-649.512) (-654.115) [-649.038] -- 0:00:30
658500 -- (-645.755) (-645.274) (-650.900) [-640.609] * (-645.391) [-644.485] (-656.796) (-642.604) -- 0:00:30
659000 -- (-644.949) (-646.603) [-642.673] (-637.483) * [-635.749] (-655.442) (-646.617) (-640.654) -- 0:00:30
659500 -- (-647.154) (-646.794) (-645.715) [-643.040] * (-648.967) [-646.147] (-652.263) (-653.497) -- 0:00:29
660000 -- [-643.169] (-659.218) (-645.557) (-644.991) * [-645.088] (-654.109) (-652.412) (-659.966) -- 0:00:29
Average standard deviation of split frequencies: 0.008101
660500 -- (-641.784) (-652.724) (-666.003) [-644.592] * [-640.936] (-653.997) (-649.736) (-652.901) -- 0:00:29
661000 -- (-645.632) (-646.804) (-642.596) [-643.734] * (-640.154) (-652.697) [-651.402] (-649.434) -- 0:00:29
661500 -- (-648.869) (-659.137) (-652.912) [-640.247] * (-641.890) (-650.261) [-647.839] (-648.432) -- 0:00:29
662000 -- (-649.913) (-646.777) (-671.694) [-640.144] * [-641.593] (-641.687) (-647.069) (-645.535) -- 0:00:29
662500 -- (-665.581) (-650.857) (-662.865) [-646.802] * [-638.235] (-642.769) (-657.321) (-642.957) -- 0:00:29
663000 -- (-645.354) (-644.840) (-660.593) [-641.599] * (-641.931) [-643.023] (-659.995) (-649.639) -- 0:00:29
663500 -- [-642.384] (-652.622) (-667.469) (-638.470) * (-639.262) [-638.939] (-657.065) (-647.158) -- 0:00:29
664000 -- [-645.175] (-657.987) (-650.508) (-645.453) * [-642.950] (-654.412) (-642.863) (-646.916) -- 0:00:29
664500 -- [-642.012] (-653.638) (-650.148) (-649.269) * (-637.817) [-638.338] (-641.059) (-649.327) -- 0:00:29
665000 -- [-639.734] (-656.492) (-658.883) (-667.151) * [-638.311] (-646.783) (-663.555) (-654.017) -- 0:00:29
Average standard deviation of split frequencies: 0.007911
665500 -- (-641.186) (-648.576) (-645.873) [-643.027] * [-643.219] (-657.573) (-661.407) (-652.058) -- 0:00:29
666000 -- (-647.409) [-647.507] (-643.568) (-648.640) * [-638.351] (-648.309) (-657.725) (-650.064) -- 0:00:29
666500 -- (-652.936) [-639.507] (-645.312) (-650.500) * [-636.005] (-649.878) (-647.794) (-653.613) -- 0:00:29
667000 -- [-653.949] (-646.050) (-652.820) (-647.333) * [-639.311] (-647.661) (-661.657) (-645.026) -- 0:00:29
667500 -- (-643.319) [-641.200] (-656.814) (-648.655) * [-638.594] (-644.299) (-662.344) (-646.093) -- 0:00:29
668000 -- (-652.740) [-645.089] (-665.111) (-647.048) * (-641.098) [-649.210] (-659.152) (-652.104) -- 0:00:29
668500 -- [-648.859] (-645.769) (-657.682) (-658.771) * (-640.319) [-643.282] (-654.829) (-662.333) -- 0:00:29
669000 -- (-641.912) (-643.925) [-649.860] (-663.626) * [-636.227] (-657.296) (-657.098) (-665.459) -- 0:00:29
669500 -- [-640.702] (-651.334) (-651.538) (-645.055) * [-638.831] (-639.947) (-647.434) (-651.690) -- 0:00:29
670000 -- (-640.029) [-648.645] (-664.028) (-657.709) * [-641.357] (-644.322) (-656.809) (-660.586) -- 0:00:29
Average standard deviation of split frequencies: 0.007690
670500 -- [-642.150] (-644.228) (-654.232) (-648.209) * (-650.390) [-646.414] (-642.780) (-660.384) -- 0:00:28
671000 -- [-643.941] (-651.560) (-653.801) (-657.089) * (-642.156) (-654.348) [-649.971] (-648.963) -- 0:00:28
671500 -- (-658.696) (-649.54 