--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:12:20 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0569/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1130.17 -1133.20
2 -1130.15 -1135.21
--------------------------------------
TOTAL -1130.16 -1134.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.880884 0.090030 0.333726 1.471695 0.841678 1381.20 1441.10 1.001
r(A<->C){all} 0.156950 0.018879 0.000143 0.434036 0.121697 269.47 272.92 1.000
r(A<->G){all} 0.219692 0.025750 0.000004 0.535514 0.187958 203.03 278.21 1.000
r(A<->T){all} 0.163635 0.019917 0.000152 0.451055 0.125939 157.36 208.44 1.010
r(C<->G){all} 0.138678 0.015283 0.000018 0.386072 0.104770 172.09 234.64 1.006
r(C<->T){all} 0.167294 0.019674 0.000118 0.444086 0.129491 197.21 213.07 1.000
r(G<->T){all} 0.153752 0.018463 0.000009 0.425846 0.115669 152.41 208.73 1.001
pi(A){all} 0.213645 0.000198 0.187920 0.242613 0.213465 1419.75 1460.37 1.000
pi(C){all} 0.279044 0.000247 0.247019 0.308589 0.278587 1121.47 1224.95 1.000
pi(G){all} 0.301160 0.000256 0.269018 0.331803 0.300805 1252.03 1376.51 1.000
pi(T){all} 0.206151 0.000195 0.178155 0.232452 0.205853 1198.29 1346.40 1.000
alpha{1,2} 0.321367 0.153263 0.001089 1.114004 0.193087 1204.66 1352.83 1.000
alpha{3} 0.405755 0.232830 0.000188 1.369902 0.232116 1038.69 1107.06 1.000
pinvar{all} 0.995775 0.000014 0.988866 0.999881 0.996723 1378.54 1387.28 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1089.515289
Model 2: PositiveSelection -1089.179229
Model 0: one-ratio -1089.179107
Model 7: beta -1089.515289
Model 8: beta&w>1 -1089.179222
Model 0 vs 1 0.672364000000016
Model 2 vs 1 0.6721199999997225
Model 8 vs 7 0.6721339999999145
>C1
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C2
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALTVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C3
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C4
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C5
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C6
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=271
C1 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C2 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C3 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C4 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C5 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C6 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
**************************************************
C1 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C2 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C3 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C4 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C5 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C6 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
**************************************************
C1 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C2 DRYWPEHSTIALTVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C3 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C4 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C5 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C6 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
************:*************************************
C1 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C2 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C3 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C4 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C5 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C6 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
**************************************************
C1 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C2 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C3 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C4 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C5 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C6 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
**************************************************
C1 PADAEWYYNTVNIGDPVIVKE
C2 PADAEWYYNTVNIGDPVIVKE
C3 PADAEWYYNTVNIGDPVIVKE
C4 PADAEWYYNTVNIGDPVIVKE
C5 PADAEWYYNTVNIGDPVIVKE
C6 PADAEWYYNTVNIGDPVIVKE
*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8130]--->[8130]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.499 Mb, Max= 30.827 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C2 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C3 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C4 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C5 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
C6 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
**************************************************
C1 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C2 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C3 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C4 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C5 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
C6 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
**************************************************
C1 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C2 DRYWPEHSTIALTVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C3 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C4 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C5 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
C6 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
************:*************************************
C1 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C2 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C3 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C4 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C5 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
C6 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
**************************************************
C1 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C2 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C3 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C4 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C5 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
C6 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
**************************************************
C1 PADAEWYYNTVNIGDPVIVKE
C2 PADAEWYYNTVNIGDPVIVKE
C3 PADAEWYYNTVNIGDPVIVKE
C4 PADAEWYYNTVNIGDPVIVKE
C5 PADAEWYYNTVNIGDPVIVKE
C6 PADAEWYYNTVNIGDPVIVKE
*********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.63 C1 C2 99.63
TOP 1 0 99.63 C2 C1 99.63
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.63 C2 C3 99.63
TOP 2 1 99.63 C3 C2 99.63
BOT 1 3 99.63 C2 C4 99.63
TOP 3 1 99.63 C4 C2 99.63
BOT 1 4 99.63 C2 C5 99.63
TOP 4 1 99.63 C5 C2 99.63
BOT 1 5 99.63 C2 C6 99.63
TOP 5 1 99.63 C6 C2 99.63
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.93
AVG 1 C2 * 99.63
AVG 2 C3 * 99.93
AVG 3 C4 * 99.93
AVG 4 C5 * 99.93
AVG 5 C6 * 99.93
TOT TOT * 99.88
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
C2 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
C3 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
C4 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
C5 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
C6 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
**************************************************
C1 CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
C2 CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
C3 CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
C4 CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
C5 CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
C6 CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
**************************************************
C1 ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
C2 ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
C3 ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
C4 ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
C5 ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
C6 ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
**************************************************
C1 GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
C2 GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
C3 GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
C4 GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
C5 GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
C6 GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
**************************************************
C1 TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
C2 TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
C3 TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
C4 TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
C5 TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
C6 TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
**************************************************
C1 TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
C2 TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
C3 TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
C4 TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
C5 TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
C6 TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
**************************************************
C1 GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
C2 GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCACGGTGGGCAACCT
C3 GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
C4 GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
C5 GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
C6 GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
************************************.*************
C1 GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
C2 GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
C3 GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
C4 GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
C5 GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
C6 GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
**************************************************
C1 CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
C2 CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
C3 CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
C4 CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
C5 CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
C6 CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
**************************************************
C1 CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
C2 CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
C3 CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
C4 CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
C5 CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
C6 CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
**************************************************
C1 GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
C2 GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
C3 GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
C4 GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
C5 GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
C6 GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
**************************************************
C1 ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
C2 ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
C3 ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
C4 ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
C5 ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
C6 ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
**************************************************
C1 GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
C2 GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
C3 GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
C4 GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
C5 GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
C6 GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
**************************************************
C1 CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
C2 CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
C3 CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
C4 CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
C5 CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
C6 CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
**************************************************
C1 TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
C2 TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
C3 TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
C4 TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
C5 TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
C6 TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
**************************************************
C1 CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
C2 CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
C3 CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
C4 CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
C5 CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
C6 CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
**************************************************
C1 AATCGTGAAGGAA
C2 AATCGTGAAGGAA
C3 AATCGTGAAGGAA
C4 AATCGTGAAGGAA
C5 AATCGTGAAGGAA
C6 AATCGTGAAGGAA
*************
>C1
ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
AATCGTGAAGGAA
>C2
ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCACGGTGGGCAACCT
GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
AATCGTGAAGGAA
>C3
ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
AATCGTGAAGGAA
>C4
ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
AATCGTGAAGGAA
>C5
ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
AATCGTGAAGGAA
>C6
ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT
CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA
ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG
GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC
TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA
TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT
GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT
GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT
CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC
CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT
GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT
ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC
GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC
CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG
TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC
CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT
AATCGTGAAGGAA
>C1
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C2
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALTVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C3
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C4
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C5
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
>C6
MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
PADAEWYYNTVNIGDPVIVKE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 813 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579795849
Setting output file names to "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 277291629
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0645164710
Seed = 2131354602
Swapseed = 1579795849
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1822.935734 -- -24.965149
Chain 2 -- -1822.934184 -- -24.965149
Chain 3 -- -1822.934289 -- -24.965149
Chain 4 -- -1822.935838 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1822.934289 -- -24.965149
Chain 2 -- -1822.935734 -- -24.965149
Chain 3 -- -1822.934289 -- -24.965149
Chain 4 -- -1822.935838 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1822.936] (-1822.934) (-1822.934) (-1822.936) * [-1822.934] (-1822.936) (-1822.934) (-1822.936)
500 -- (-1151.662) (-1138.137) [-1138.717] (-1140.092) * (-1141.514) [-1132.625] (-1141.778) (-1136.359) -- 0:00:00
1000 -- (-1135.156) [-1132.847] (-1139.392) (-1130.311) * [-1130.879] (-1136.546) (-1131.865) (-1136.917) -- 0:00:00
1500 -- (-1135.332) (-1136.399) (-1131.442) [-1135.912] * [-1134.283] (-1129.985) (-1133.347) (-1135.524) -- 0:00:00
2000 -- (-1132.790) [-1135.468] (-1138.509) (-1141.757) * (-1139.051) (-1131.376) (-1136.072) [-1135.616] -- 0:00:00
2500 -- (-1132.450) (-1140.768) (-1136.898) [-1137.539] * (-1130.456) [-1132.402] (-1131.793) (-1132.993) -- 0:00:00
3000 -- (-1133.938) (-1139.901) [-1135.743] (-1136.121) * (-1137.629) [-1143.775] (-1133.672) (-1134.055) -- 0:00:00
3500 -- (-1134.662) (-1138.335) (-1136.289) [-1138.195] * (-1138.967) (-1136.467) [-1140.151] (-1140.740) -- 0:00:00
4000 -- (-1133.415) (-1135.080) [-1138.162] (-1138.184) * (-1143.070) (-1139.296) [-1135.600] (-1131.210) -- 0:00:00
4500 -- [-1133.596] (-1133.900) (-1133.111) (-1136.797) * (-1134.278) [-1134.206] (-1134.522) (-1138.606) -- 0:00:00
5000 -- [-1134.632] (-1141.326) (-1136.171) (-1134.198) * [-1132.469] (-1137.877) (-1131.730) (-1132.870) -- 0:00:00
Average standard deviation of split frequencies: 0.052378
5500 -- (-1140.750) [-1136.304] (-1134.149) (-1134.412) * (-1139.377) (-1139.859) (-1136.697) [-1132.496] -- 0:00:00
6000 -- [-1136.098] (-1137.168) (-1138.722) (-1132.272) * (-1141.612) (-1133.535) [-1131.655] (-1140.076) -- 0:00:00
6500 -- (-1137.911) (-1137.527) (-1131.545) [-1134.755] * (-1140.800) [-1136.321] (-1139.083) (-1136.544) -- 0:00:00
7000 -- (-1139.009) (-1144.107) (-1140.062) [-1137.901] * [-1135.893] (-1139.002) (-1131.673) (-1139.365) -- 0:00:00
7500 -- [-1133.869] (-1137.763) (-1135.871) (-1136.573) * (-1136.225) [-1136.891] (-1133.665) (-1139.733) -- 0:02:12
8000 -- [-1133.197] (-1135.688) (-1133.226) (-1134.468) * (-1140.423) (-1135.150) [-1138.493] (-1137.268) -- 0:02:04
8500 -- (-1130.846) (-1141.236) (-1147.478) [-1132.514] * (-1140.464) (-1136.214) (-1141.355) [-1138.377] -- 0:01:56
9000 -- (-1136.149) (-1139.150) [-1140.847] (-1132.500) * (-1142.367) [-1139.412] (-1138.955) (-1135.569) -- 0:01:50
9500 -- (-1139.040) (-1133.706) (-1132.266) [-1130.024] * [-1140.647] (-1129.133) (-1139.293) (-1130.648) -- 0:01:44
10000 -- (-1151.302) (-1134.737) [-1134.644] (-1136.519) * (-1142.879) (-1133.848) (-1141.362) [-1134.929] -- 0:01:39
Average standard deviation of split frequencies: 0.070309
10500 -- (-1145.789) [-1133.278] (-1136.750) (-1136.582) * (-1137.026) [-1129.628] (-1136.558) (-1139.129) -- 0:01:34
11000 -- (-1132.991) (-1133.723) [-1137.589] (-1134.755) * (-1139.348) (-1132.719) (-1139.428) [-1135.160] -- 0:01:29
11500 -- (-1143.070) (-1135.868) [-1134.199] (-1133.743) * (-1132.440) (-1137.162) [-1136.481] (-1131.545) -- 0:01:25
12000 -- (-1135.669) (-1140.074) [-1141.353] (-1142.412) * (-1139.907) (-1137.816) [-1136.692] (-1136.324) -- 0:01:22
12500 -- [-1137.085] (-1133.442) (-1138.626) (-1132.385) * (-1135.928) [-1133.593] (-1138.314) (-1131.856) -- 0:01:19
13000 -- (-1141.401) [-1135.343] (-1135.488) (-1133.321) * (-1140.891) [-1130.385] (-1135.181) (-1139.043) -- 0:01:15
13500 -- [-1132.936] (-1136.831) (-1134.146) (-1134.796) * (-1141.457) (-1134.214) [-1134.887] (-1134.201) -- 0:01:13
14000 -- (-1131.803) (-1143.002) (-1137.709) [-1130.177] * (-1138.643) (-1138.749) (-1132.531) [-1130.007] -- 0:01:10
14500 -- (-1129.457) [-1134.400] (-1133.145) (-1132.665) * (-1137.719) (-1137.951) (-1144.087) [-1132.388] -- 0:01:07
15000 -- (-1134.938) (-1138.621) [-1133.919] (-1136.911) * (-1136.616) [-1130.935] (-1140.018) (-1134.077) -- 0:01:05
Average standard deviation of split frequencies: 0.050260
15500 -- (-1129.051) [-1134.269] (-1144.173) (-1133.442) * [-1133.619] (-1141.458) (-1130.445) (-1133.348) -- 0:01:03
16000 -- [-1129.321] (-1138.986) (-1136.749) (-1133.790) * (-1137.087) (-1141.934) [-1132.699] (-1130.267) -- 0:01:01
16500 -- (-1131.209) [-1133.743] (-1132.595) (-1132.715) * [-1135.619] (-1136.515) (-1141.600) (-1137.286) -- 0:00:59
17000 -- [-1130.940] (-1135.669) (-1143.138) (-1132.974) * (-1135.359) (-1140.456) (-1132.623) [-1135.544] -- 0:00:57
17500 -- (-1131.356) (-1132.096) [-1141.239] (-1130.442) * (-1131.556) (-1140.595) [-1137.655] (-1141.406) -- 0:00:56
18000 -- (-1131.022) (-1130.637) [-1133.704] (-1132.353) * (-1135.310) (-1134.270) (-1138.479) [-1131.631] -- 0:00:54
18500 -- (-1133.136) [-1132.150] (-1135.738) (-1136.743) * (-1138.916) (-1138.626) (-1133.413) [-1135.499] -- 0:00:53
19000 -- (-1131.695) (-1137.508) [-1135.585] (-1132.547) * (-1134.435) (-1134.497) [-1133.421] (-1137.439) -- 0:00:51
19500 -- (-1134.238) (-1138.003) [-1133.612] (-1130.597) * (-1136.358) (-1132.361) (-1134.118) [-1133.995] -- 0:00:50
20000 -- (-1134.021) (-1134.678) (-1131.862) [-1132.771] * [-1133.949] (-1139.372) (-1133.655) (-1133.814) -- 0:00:49
Average standard deviation of split frequencies: 0.054744
20500 -- (-1131.720) [-1133.893] (-1145.729) (-1133.597) * (-1134.082) (-1132.622) [-1136.058] (-1131.719) -- 0:00:47
21000 -- (-1130.452) (-1138.545) (-1132.528) [-1132.158] * [-1127.928] (-1138.715) (-1138.588) (-1140.486) -- 0:01:33
21500 -- (-1132.634) (-1144.491) (-1129.379) [-1130.121] * (-1139.344) (-1136.426) (-1131.797) [-1131.558] -- 0:01:31
22000 -- (-1133.129) [-1130.443] (-1134.828) (-1130.834) * (-1138.601) (-1137.571) [-1134.211] (-1132.185) -- 0:01:28
22500 -- (-1131.639) [-1137.316] (-1132.160) (-1130.667) * (-1131.655) (-1139.065) [-1136.455] (-1137.848) -- 0:01:26
23000 -- (-1129.611) [-1131.313] (-1132.264) (-1132.010) * (-1141.295) (-1136.973) (-1142.883) [-1129.592] -- 0:01:24
23500 -- (-1129.881) [-1139.447] (-1130.854) (-1132.736) * (-1130.757) (-1149.942) [-1139.216] (-1142.595) -- 0:01:23
24000 -- (-1130.053) (-1130.019) [-1130.642] (-1130.738) * (-1137.090) (-1136.631) [-1134.328] (-1144.208) -- 0:01:21
24500 -- [-1127.229] (-1137.335) (-1131.236) (-1132.022) * (-1135.754) (-1134.987) (-1148.864) [-1141.715] -- 0:01:19
25000 -- [-1129.517] (-1132.329) (-1132.071) (-1131.037) * (-1136.545) [-1136.288] (-1134.739) (-1134.745) -- 0:01:18
Average standard deviation of split frequencies: 0.048086
25500 -- (-1129.254) (-1130.370) [-1130.950] (-1129.943) * (-1134.617) (-1138.618) [-1136.531] (-1133.290) -- 0:01:16
26000 -- (-1129.022) (-1133.119) (-1132.883) [-1129.114] * [-1131.987] (-1140.088) (-1141.151) (-1139.431) -- 0:01:14
26500 -- [-1127.640] (-1132.460) (-1128.289) (-1129.294) * [-1138.304] (-1140.843) (-1138.507) (-1133.228) -- 0:01:13
27000 -- [-1129.095] (-1130.948) (-1131.184) (-1130.338) * [-1136.500] (-1138.511) (-1140.447) (-1134.927) -- 0:01:12
27500 -- [-1130.541] (-1128.884) (-1135.227) (-1130.637) * (-1134.666) (-1136.899) (-1137.249) [-1132.091] -- 0:01:10
28000 -- (-1131.836) [-1131.739] (-1134.275) (-1130.357) * (-1137.387) [-1134.230] (-1135.876) (-1137.888) -- 0:01:09
28500 -- [-1132.696] (-1132.635) (-1134.439) (-1131.451) * (-1136.571) (-1135.557) [-1137.074] (-1136.522) -- 0:01:08
29000 -- (-1131.144) (-1129.236) (-1134.907) [-1133.027] * (-1133.993) (-1133.407) (-1137.672) [-1140.566] -- 0:01:06
29500 -- (-1129.177) (-1129.447) (-1132.321) [-1133.308] * (-1136.247) (-1135.151) (-1140.647) [-1132.973] -- 0:01:05
30000 -- (-1129.145) (-1131.480) [-1131.987] (-1133.163) * (-1132.652) (-1132.695) (-1137.756) [-1133.315] -- 0:01:04
Average standard deviation of split frequencies: 0.049776
30500 -- [-1129.252] (-1132.511) (-1133.918) (-1133.687) * (-1138.428) (-1133.280) (-1148.192) [-1136.825] -- 0:01:03
31000 -- (-1130.091) [-1132.361] (-1131.695) (-1133.841) * (-1140.486) (-1129.130) (-1137.577) [-1134.714] -- 0:01:02
31500 -- (-1130.496) (-1129.618) [-1132.516] (-1133.817) * (-1128.964) (-1132.105) [-1136.474] (-1135.646) -- 0:01:01
32000 -- (-1130.389) (-1132.807) [-1128.697] (-1133.815) * (-1130.406) (-1129.990) [-1135.440] (-1136.024) -- 0:01:00
32500 -- [-1128.947] (-1129.664) (-1131.388) (-1132.996) * (-1133.476) (-1131.334) (-1147.857) [-1131.846] -- 0:00:59
33000 -- (-1132.027) (-1131.407) [-1132.187] (-1132.489) * (-1128.771) (-1132.048) (-1139.236) [-1131.647] -- 0:00:58
33500 -- [-1128.896] (-1131.015) (-1130.060) (-1133.442) * (-1128.590) [-1130.273] (-1137.570) (-1131.672) -- 0:00:57
34000 -- (-1132.447) (-1131.428) [-1130.177] (-1135.976) * (-1129.433) (-1131.828) [-1132.744] (-1137.234) -- 0:00:56
34500 -- (-1135.033) (-1132.128) [-1130.284] (-1131.313) * (-1130.572) (-1132.737) [-1132.559] (-1137.064) -- 0:00:55
35000 -- (-1131.982) (-1132.895) (-1132.090) [-1132.148] * [-1129.870] (-1129.782) (-1137.458) (-1132.467) -- 0:01:22
Average standard deviation of split frequencies: 0.042921
35500 -- (-1132.225) [-1131.062] (-1132.582) (-1135.622) * (-1132.265) (-1132.513) [-1138.981] (-1140.311) -- 0:01:21
36000 -- (-1131.811) (-1134.646) (-1130.226) [-1131.758] * [-1128.787] (-1130.324) (-1144.989) (-1139.603) -- 0:01:20
36500 -- (-1132.453) [-1132.422] (-1129.529) (-1131.234) * [-1129.257] (-1133.047) (-1143.084) (-1134.038) -- 0:01:19
37000 -- (-1132.129) (-1130.612) (-1130.824) [-1131.379] * (-1129.444) (-1129.847) (-1136.729) [-1131.403] -- 0:01:18
37500 -- [-1127.715] (-1130.611) (-1131.070) (-1131.614) * (-1131.995) (-1130.825) (-1145.252) [-1137.197] -- 0:01:17
38000 -- (-1131.193) (-1130.317) (-1129.646) [-1132.252] * (-1133.724) (-1131.643) [-1139.431] (-1138.760) -- 0:01:15
38500 -- (-1132.771) [-1128.720] (-1129.960) (-1131.723) * (-1132.753) (-1131.526) [-1131.268] (-1136.439) -- 0:01:14
39000 -- (-1130.257) (-1129.759) [-1136.786] (-1131.536) * (-1132.087) (-1143.499) (-1137.726) [-1142.694] -- 0:01:13
39500 -- (-1130.453) [-1130.496] (-1133.651) (-1131.671) * (-1133.444) (-1133.362) [-1144.776] (-1137.397) -- 0:01:12
40000 -- (-1129.941) [-1130.439] (-1132.436) (-1130.240) * (-1131.590) (-1135.454) (-1131.491) [-1132.821] -- 0:01:12
Average standard deviation of split frequencies: 0.025760
40500 -- (-1133.162) (-1128.483) [-1131.828] (-1130.327) * [-1129.139] (-1139.163) (-1128.478) (-1135.300) -- 0:01:11
41000 -- [-1130.102] (-1130.708) (-1134.835) (-1130.617) * (-1130.443) (-1136.860) [-1129.262] (-1142.388) -- 0:01:10
41500 -- [-1131.035] (-1128.927) (-1134.419) (-1132.448) * (-1128.719) [-1132.239] (-1128.033) (-1135.793) -- 0:01:09
42000 -- [-1129.074] (-1131.299) (-1134.291) (-1131.023) * (-1129.643) (-1131.648) [-1130.957] (-1133.184) -- 0:01:08
42500 -- (-1131.762) (-1131.870) [-1132.144] (-1131.705) * (-1128.843) (-1132.918) (-1129.028) [-1136.917] -- 0:01:07
43000 -- (-1131.063) (-1133.345) [-1131.983] (-1133.946) * (-1132.893) (-1131.973) (-1129.912) [-1135.568] -- 0:01:06
43500 -- (-1129.542) [-1131.897] (-1133.545) (-1130.327) * (-1131.433) (-1130.608) [-1132.207] (-1134.536) -- 0:01:05
44000 -- (-1131.845) (-1129.421) [-1131.095] (-1131.252) * [-1128.567] (-1133.742) (-1132.398) (-1135.335) -- 0:01:05
44500 -- (-1128.415) [-1128.928] (-1131.450) (-1130.642) * (-1129.033) (-1132.301) (-1131.078) [-1133.129] -- 0:01:04
45000 -- (-1128.737) (-1131.699) (-1132.424) [-1131.308] * (-1129.940) (-1132.996) (-1132.707) [-1132.688] -- 0:01:03
Average standard deviation of split frequencies: 0.024400
45500 -- (-1131.518) [-1135.026] (-1129.983) (-1131.247) * [-1129.493] (-1130.388) (-1129.948) (-1134.421) -- 0:01:02
46000 -- (-1135.785) [-1128.027] (-1133.946) (-1131.194) * (-1131.238) [-1130.118] (-1131.638) (-1141.930) -- 0:01:02
46500 -- (-1134.123) (-1131.680) (-1134.518) [-1130.158] * (-1129.665) [-1130.458] (-1128.556) (-1141.648) -- 0:01:01
47000 -- [-1132.493] (-1129.317) (-1132.697) (-1133.452) * [-1128.956] (-1129.381) (-1131.892) (-1135.571) -- 0:01:00
47500 -- [-1133.242] (-1130.814) (-1134.244) (-1133.058) * (-1130.651) (-1130.893) (-1133.844) [-1136.559] -- 0:01:00
48000 -- (-1129.756) (-1129.347) (-1139.322) [-1132.187] * (-1130.729) (-1132.545) (-1129.405) [-1134.503] -- 0:00:59
48500 -- (-1129.328) [-1129.243] (-1131.440) (-1133.492) * (-1128.256) [-1133.524] (-1132.171) (-1136.138) -- 0:00:58
49000 -- (-1130.702) (-1132.992) [-1131.503] (-1131.861) * [-1127.838] (-1135.263) (-1131.880) (-1133.116) -- 0:00:58
49500 -- (-1130.465) [-1130.564] (-1130.945) (-1133.824) * (-1129.849) (-1134.054) (-1134.091) [-1134.439] -- 0:01:16
50000 -- (-1130.847) (-1129.834) (-1131.999) [-1130.890] * [-1134.223] (-1133.013) (-1131.807) (-1144.329) -- 0:01:16
Average standard deviation of split frequencies: 0.028758
50500 -- (-1131.782) [-1129.423] (-1129.376) (-1132.110) * (-1131.905) (-1134.573) [-1137.144] (-1146.590) -- 0:01:15
51000 -- (-1131.172) (-1129.671) [-1128.977] (-1132.141) * [-1131.247] (-1131.074) (-1131.937) (-1131.164) -- 0:01:14
51500 -- (-1134.369) (-1129.983) (-1132.103) [-1130.191] * (-1132.328) (-1133.709) (-1131.774) [-1133.532] -- 0:01:13
52000 -- [-1135.445] (-1130.896) (-1131.636) (-1131.694) * (-1130.633) [-1130.536] (-1134.026) (-1133.338) -- 0:01:12
52500 -- (-1131.422) (-1132.560) (-1134.537) [-1131.277] * (-1129.677) (-1130.424) (-1135.067) [-1132.547] -- 0:01:12
53000 -- [-1130.581] (-1131.698) (-1134.816) (-1132.321) * [-1130.635] (-1131.465) (-1133.181) (-1130.573) -- 0:01:11
53500 -- (-1131.814) (-1132.687) (-1131.180) [-1131.698] * (-1134.487) (-1131.189) [-1130.306] (-1131.401) -- 0:01:10
54000 -- [-1133.729] (-1131.243) (-1132.368) (-1132.445) * (-1137.028) (-1130.153) (-1129.726) [-1130.460] -- 0:01:10
54500 -- (-1133.443) (-1132.623) [-1132.155] (-1130.166) * (-1129.960) (-1128.277) [-1130.722] (-1131.781) -- 0:01:09
55000 -- (-1132.398) (-1129.596) (-1131.298) [-1129.097] * [-1130.199] (-1131.306) (-1129.775) (-1131.959) -- 0:01:08
Average standard deviation of split frequencies: 0.029463
55500 -- (-1133.050) (-1129.370) [-1131.967] (-1130.714) * (-1128.770) (-1130.151) (-1130.011) [-1130.555] -- 0:01:08
56000 -- (-1131.306) (-1129.949) (-1133.539) [-1133.575] * (-1130.028) [-1128.548] (-1129.062) (-1134.853) -- 0:01:07
56500 -- (-1132.805) [-1131.997] (-1131.393) (-1130.694) * (-1129.907) (-1130.303) (-1130.605) [-1131.725] -- 0:01:06
57000 -- [-1130.834] (-1128.071) (-1130.721) (-1131.789) * [-1133.876] (-1132.460) (-1130.138) (-1134.147) -- 0:01:06
57500 -- (-1133.281) [-1130.683] (-1131.721) (-1129.801) * (-1132.733) (-1131.238) (-1129.544) [-1133.148] -- 0:01:05
58000 -- (-1130.570) (-1131.316) (-1131.488) [-1129.537] * [-1132.015] (-1132.143) (-1132.880) (-1131.222) -- 0:01:04
58500 -- [-1132.059] (-1128.385) (-1132.886) (-1130.918) * [-1132.183] (-1132.091) (-1132.289) (-1132.635) -- 0:01:04
59000 -- (-1131.623) (-1129.680) (-1132.212) [-1131.143] * (-1132.006) (-1131.744) (-1130.761) [-1131.592] -- 0:01:03
59500 -- (-1133.119) (-1134.938) [-1132.666] (-1130.837) * (-1130.355) (-1136.294) [-1130.667] (-1131.091) -- 0:01:03
60000 -- (-1133.717) (-1131.789) [-1130.444] (-1133.591) * (-1131.905) [-1130.830] (-1129.992) (-1135.087) -- 0:01:02
Average standard deviation of split frequencies: 0.024477
60500 -- [-1131.547] (-1131.051) (-1133.540) (-1133.992) * (-1133.645) (-1131.346) (-1136.515) [-1132.565] -- 0:01:02
61000 -- [-1129.998] (-1131.068) (-1133.613) (-1133.588) * [-1133.470] (-1130.333) (-1133.280) (-1132.656) -- 0:01:01
61500 -- [-1130.363] (-1129.601) (-1134.106) (-1135.145) * (-1129.978) [-1132.487] (-1130.299) (-1131.679) -- 0:01:01
62000 -- [-1130.775] (-1130.847) (-1132.370) (-1130.698) * (-1131.148) (-1131.633) [-1131.686] (-1133.010) -- 0:01:00
62500 -- (-1128.332) (-1130.897) (-1131.450) [-1130.096] * (-1131.726) [-1133.139] (-1132.037) (-1130.654) -- 0:01:00
63000 -- (-1129.764) (-1129.057) (-1131.605) [-1131.533] * [-1129.954] (-1131.252) (-1131.882) (-1131.164) -- 0:00:59
63500 -- (-1132.472) [-1129.252] (-1132.779) (-1130.940) * [-1130.673] (-1132.154) (-1131.583) (-1132.520) -- 0:01:13
64000 -- (-1135.104) [-1129.958] (-1132.249) (-1136.229) * (-1130.222) (-1130.844) [-1130.333] (-1132.597) -- 0:01:13
64500 -- [-1136.635] (-1135.011) (-1129.787) (-1138.674) * (-1130.339) (-1130.969) [-1130.940] (-1129.215) -- 0:01:12
65000 -- (-1132.862) [-1128.200] (-1131.710) (-1131.915) * (-1130.327) (-1131.173) [-1135.061] (-1130.410) -- 0:01:11
Average standard deviation of split frequencies: 0.021785
65500 -- (-1135.192) [-1130.891] (-1130.840) (-1131.119) * [-1131.279] (-1133.156) (-1131.209) (-1130.700) -- 0:01:11
66000 -- (-1134.013) [-1130.359] (-1130.436) (-1129.606) * [-1131.684] (-1130.947) (-1132.231) (-1131.379) -- 0:01:10
66500 -- (-1131.451) (-1131.021) [-1129.929] (-1131.166) * [-1129.042] (-1132.535) (-1131.524) (-1132.618) -- 0:01:10
67000 -- (-1133.952) (-1130.459) [-1129.850] (-1133.958) * (-1134.784) (-1136.896) (-1131.666) [-1130.139] -- 0:01:09
67500 -- (-1133.098) [-1128.548] (-1133.965) (-1131.071) * (-1135.266) (-1135.573) [-1133.391] (-1136.563) -- 0:01:09
68000 -- (-1130.666) (-1130.676) (-1130.991) [-1131.923] * [-1132.049] (-1140.487) (-1134.868) (-1137.069) -- 0:01:08
68500 -- (-1131.238) [-1131.275] (-1134.932) (-1134.626) * [-1129.813] (-1133.593) (-1133.628) (-1130.437) -- 0:01:07
69000 -- [-1131.053] (-1130.607) (-1128.352) (-1132.721) * (-1131.670) (-1132.708) (-1131.226) [-1130.396] -- 0:01:07
69500 -- (-1134.940) [-1132.352] (-1133.692) (-1130.893) * (-1131.767) (-1132.533) [-1130.080] (-1136.552) -- 0:01:06
70000 -- (-1133.796) (-1130.272) [-1129.817] (-1133.230) * [-1132.576] (-1132.128) (-1133.284) (-1130.048) -- 0:01:06
Average standard deviation of split frequencies: 0.024460
70500 -- (-1135.571) (-1130.650) (-1131.057) [-1138.356] * (-1132.601) [-1129.972] (-1130.605) (-1130.830) -- 0:01:05
71000 -- (-1135.565) [-1130.328] (-1131.231) (-1131.023) * (-1131.725) (-1132.321) [-1131.822] (-1130.666) -- 0:01:05
71500 -- [-1129.054] (-1135.106) (-1128.588) (-1133.614) * (-1133.736) (-1132.178) [-1131.080] (-1131.047) -- 0:01:04
72000 -- (-1132.091) (-1130.811) [-1128.639] (-1130.161) * (-1129.891) (-1130.653) [-1131.655] (-1128.846) -- 0:01:04
72500 -- (-1132.795) (-1130.576) [-1128.625] (-1128.915) * [-1131.021] (-1134.498) (-1130.950) (-1132.838) -- 0:01:03
73000 -- (-1131.711) [-1130.615] (-1129.420) (-1130.465) * (-1130.883) (-1130.687) [-1136.113] (-1128.056) -- 0:01:03
73500 -- (-1129.647) (-1130.307) [-1129.208] (-1131.425) * [-1132.417] (-1129.971) (-1135.020) (-1131.127) -- 0:01:03
74000 -- (-1129.681) (-1131.155) (-1132.892) [-1131.341] * (-1134.457) (-1130.956) (-1131.249) [-1130.358] -- 0:01:02
74500 -- (-1134.187) (-1132.468) [-1132.703] (-1132.306) * (-1134.396) (-1131.110) (-1134.318) [-1129.697] -- 0:01:02
75000 -- (-1129.910) (-1131.425) (-1129.975) [-1130.698] * (-1131.340) [-1130.587] (-1131.330) (-1131.933) -- 0:01:01
Average standard deviation of split frequencies: 0.020779
75500 -- (-1130.610) (-1133.946) (-1132.475) [-1127.979] * [-1130.020] (-1130.940) (-1131.729) (-1130.367) -- 0:01:01
76000 -- [-1131.798] (-1134.158) (-1131.343) (-1132.286) * [-1131.335] (-1131.452) (-1130.682) (-1130.514) -- 0:01:00
76500 -- [-1133.046] (-1132.571) (-1129.133) (-1131.578) * [-1133.914] (-1129.361) (-1130.967) (-1130.733) -- 0:01:00
77000 -- (-1131.198) (-1131.491) (-1131.657) [-1129.769] * (-1130.660) (-1129.697) [-1130.222] (-1129.459) -- 0:00:59
77500 -- (-1131.216) [-1129.822] (-1129.302) (-1132.129) * (-1130.331) (-1133.019) (-1131.266) [-1131.833] -- 0:00:59
78000 -- (-1133.006) [-1130.826] (-1132.283) (-1131.442) * (-1130.822) (-1130.420) (-1131.244) [-1131.873] -- 0:00:59
78500 -- [-1130.294] (-1130.141) (-1133.447) (-1130.593) * (-1130.956) (-1129.772) (-1131.829) [-1135.265] -- 0:01:10
79000 -- (-1128.975) (-1131.870) [-1129.489] (-1129.105) * [-1131.752] (-1131.135) (-1130.359) (-1131.246) -- 0:01:09
79500 -- (-1128.531) (-1131.211) (-1130.449) [-1130.967] * (-1130.867) (-1132.833) (-1130.540) [-1130.676] -- 0:01:09
80000 -- [-1128.729] (-1129.545) (-1134.215) (-1139.121) * (-1134.032) (-1131.836) (-1131.056) [-1129.835] -- 0:01:09
Average standard deviation of split frequencies: 0.021530
80500 -- [-1132.780] (-1130.281) (-1134.381) (-1131.872) * (-1133.849) (-1133.731) (-1133.293) [-1131.157] -- 0:01:08
81000 -- [-1131.806] (-1130.412) (-1135.900) (-1131.633) * (-1137.736) [-1132.059] (-1131.790) (-1131.376) -- 0:01:08
81500 -- [-1130.376] (-1130.736) (-1139.668) (-1132.566) * (-1132.577) (-1131.237) [-1131.945] (-1131.542) -- 0:01:07
82000 -- (-1130.628) [-1129.213] (-1137.440) (-1132.066) * (-1133.773) (-1130.381) (-1129.345) [-1132.137] -- 0:01:07
82500 -- (-1130.525) [-1128.374] (-1134.355) (-1135.286) * [-1131.809] (-1131.676) (-1130.631) (-1132.404) -- 0:01:06
83000 -- (-1130.290) (-1130.937) (-1133.472) [-1131.169] * (-1131.669) [-1132.622] (-1132.005) (-1132.842) -- 0:01:06
83500 -- (-1130.264) [-1131.734] (-1134.834) (-1130.824) * (-1134.746) [-1132.885] (-1131.910) (-1133.575) -- 0:01:05
84000 -- (-1133.147) (-1131.834) [-1130.544] (-1131.048) * (-1130.415) (-1129.548) [-1130.584] (-1132.000) -- 0:01:05
84500 -- [-1132.627] (-1133.277) (-1132.544) (-1128.291) * (-1135.307) (-1132.449) [-1131.428] (-1132.132) -- 0:01:05
85000 -- (-1132.876) (-1132.940) (-1130.009) [-1128.363] * (-1132.032) (-1130.064) (-1134.999) [-1131.673] -- 0:01:04
Average standard deviation of split frequencies: 0.018911
85500 -- [-1130.636] (-1129.962) (-1130.845) (-1132.201) * [-1130.169] (-1131.873) (-1137.501) (-1131.272) -- 0:01:04
86000 -- (-1129.318) (-1130.588) (-1136.557) [-1129.270] * (-1132.368) (-1130.370) (-1132.291) [-1133.216] -- 0:01:03
86500 -- (-1130.589) (-1131.452) [-1131.801] (-1128.926) * (-1131.975) [-1130.635] (-1130.989) (-1132.023) -- 0:01:03
87000 -- [-1128.284] (-1133.485) (-1135.373) (-1131.611) * [-1135.384] (-1129.658) (-1132.494) (-1132.906) -- 0:01:02
87500 -- [-1132.909] (-1131.733) (-1130.286) (-1132.219) * (-1137.686) [-1130.615] (-1130.392) (-1132.016) -- 0:01:02
88000 -- [-1130.462] (-1129.773) (-1132.827) (-1132.678) * (-1132.946) (-1131.543) (-1133.139) [-1130.173] -- 0:01:02
88500 -- (-1134.696) (-1131.411) [-1130.807] (-1133.663) * (-1133.486) (-1130.053) (-1132.557) [-1129.447] -- 0:01:01
89000 -- (-1132.276) (-1129.711) (-1130.814) [-1129.124] * (-1131.442) [-1129.979] (-1133.011) (-1130.419) -- 0:01:01
89500 -- (-1131.003) (-1133.729) [-1130.862] (-1135.622) * (-1130.911) (-1133.717) [-1130.500] (-1131.630) -- 0:01:01
90000 -- [-1130.037] (-1130.158) (-1131.842) (-1129.797) * [-1130.570] (-1133.868) (-1130.861) (-1130.947) -- 0:01:00
Average standard deviation of split frequencies: 0.017678
90500 -- [-1130.044] (-1131.010) (-1130.656) (-1130.741) * (-1136.704) (-1132.286) [-1132.964] (-1135.143) -- 0:01:00
91000 -- (-1132.817) [-1133.690] (-1130.293) (-1130.613) * [-1133.183] (-1131.103) (-1132.518) (-1132.094) -- 0:00:59
91500 -- [-1128.893] (-1130.848) (-1133.164) (-1131.698) * [-1130.992] (-1129.371) (-1135.773) (-1132.044) -- 0:00:59
92000 -- (-1132.353) (-1129.990) (-1130.702) [-1129.626] * (-1130.561) (-1128.563) [-1133.157] (-1131.012) -- 0:00:59
92500 -- (-1130.265) (-1129.069) (-1130.642) [-1128.372] * (-1131.821) (-1132.050) [-1130.716] (-1132.472) -- 0:00:58
93000 -- [-1131.743] (-1129.571) (-1132.903) (-1133.948) * (-1134.208) (-1132.504) (-1131.347) [-1132.489] -- 0:00:58
93500 -- (-1133.211) (-1131.922) (-1130.412) [-1133.318] * (-1133.471) [-1131.879] (-1132.703) (-1130.213) -- 0:01:07
94000 -- [-1130.651] (-1135.135) (-1133.736) (-1136.340) * (-1131.215) (-1130.780) [-1128.295] (-1132.530) -- 0:01:07
94500 -- [-1130.649] (-1130.757) (-1129.816) (-1130.120) * (-1136.072) (-1130.129) [-1129.091] (-1131.932) -- 0:01:07
95000 -- (-1130.716) (-1131.317) [-1130.913] (-1129.102) * (-1133.071) (-1134.240) [-1131.604] (-1134.524) -- 0:01:06
Average standard deviation of split frequencies: 0.017316
95500 -- (-1136.924) [-1131.942] (-1131.383) (-1128.953) * (-1129.419) (-1131.900) [-1131.069] (-1137.116) -- 0:01:06
96000 -- (-1131.211) (-1128.314) [-1132.058] (-1132.647) * (-1132.788) (-1131.022) [-1131.315] (-1132.411) -- 0:01:05
96500 -- (-1133.464) (-1134.284) [-1129.567] (-1133.349) * (-1130.658) (-1130.657) [-1131.410] (-1132.460) -- 0:01:05
97000 -- (-1136.160) (-1134.597) (-1136.326) [-1132.403] * (-1132.601) [-1131.086] (-1129.305) (-1129.784) -- 0:01:05
97500 -- (-1134.070) [-1131.835] (-1131.432) (-1131.567) * (-1133.237) [-1134.346] (-1130.798) (-1131.458) -- 0:01:04
98000 -- [-1130.387] (-1131.355) (-1133.273) (-1137.479) * (-1134.621) [-1131.949] (-1131.506) (-1130.480) -- 0:01:04
98500 -- (-1132.619) (-1130.600) [-1130.933] (-1132.107) * (-1135.316) (-1130.258) [-1131.999] (-1134.748) -- 0:01:04
99000 -- (-1132.784) (-1132.610) (-1134.702) [-1133.387] * (-1131.043) (-1129.545) [-1134.334] (-1134.046) -- 0:01:03
99500 -- (-1133.853) (-1144.195) (-1133.032) [-1130.846] * (-1133.460) [-1131.772] (-1131.736) (-1132.175) -- 0:01:03
100000 -- (-1132.826) [-1133.963] (-1131.033) (-1131.045) * (-1130.537) [-1131.633] (-1131.425) (-1130.389) -- 0:01:02
Average standard deviation of split frequencies: 0.014295
100500 -- (-1130.784) (-1132.260) [-1130.358] (-1132.266) * (-1132.528) (-1131.132) [-1131.427] (-1132.459) -- 0:01:02
101000 -- [-1132.355] (-1132.317) (-1133.528) (-1130.009) * (-1131.227) (-1130.960) (-1131.829) [-1130.868] -- 0:01:02
101500 -- (-1133.180) (-1131.046) [-1128.534] (-1131.409) * (-1130.489) [-1132.205] (-1130.192) (-1130.313) -- 0:01:01
102000 -- (-1132.182) [-1129.781] (-1130.009) (-1128.376) * (-1131.738) (-1133.028) (-1131.781) [-1130.383] -- 0:01:01
102500 -- (-1130.735) (-1132.491) [-1128.537] (-1128.947) * (-1135.103) (-1129.765) [-1132.596] (-1134.949) -- 0:01:01
103000 -- (-1132.729) (-1131.873) [-1131.876] (-1130.909) * (-1130.161) (-1131.186) (-1129.205) [-1131.360] -- 0:01:00
103500 -- (-1131.531) (-1131.803) [-1134.640] (-1132.852) * (-1131.137) (-1131.563) [-1134.519] (-1131.657) -- 0:01:00
104000 -- (-1132.191) (-1135.091) [-1132.303] (-1131.728) * [-1135.570] (-1130.049) (-1130.797) (-1130.636) -- 0:01:00
104500 -- (-1133.388) (-1133.475) [-1130.668] (-1130.054) * (-1135.835) [-1130.776] (-1131.783) (-1131.871) -- 0:00:59
105000 -- (-1133.843) [-1130.567] (-1130.973) (-1132.120) * (-1131.735) [-1132.951] (-1130.951) (-1134.203) -- 0:00:59
Average standard deviation of split frequencies: 0.015214
105500 -- (-1131.094) (-1130.574) [-1130.948] (-1132.726) * (-1131.488) (-1130.099) [-1131.463] (-1131.966) -- 0:00:59
106000 -- (-1130.121) [-1134.165] (-1131.708) (-1130.244) * (-1133.162) [-1129.679] (-1130.301) (-1136.400) -- 0:00:59
106500 -- (-1130.162) [-1133.185] (-1133.239) (-1129.247) * (-1133.872) (-1133.533) (-1130.532) [-1137.685] -- 0:00:58
107000 -- [-1132.416] (-1131.336) (-1131.828) (-1130.790) * (-1129.936) [-1131.902] (-1131.078) (-1131.344) -- 0:00:58
107500 -- (-1132.474) (-1133.527) [-1135.117] (-1131.249) * [-1131.456] (-1130.835) (-1130.908) (-1130.317) -- 0:00:58
108000 -- (-1130.933) (-1132.093) [-1130.434] (-1132.551) * (-1130.149) (-1130.526) [-1130.437] (-1131.773) -- 0:00:57
108500 -- (-1133.886) (-1131.872) (-1130.190) [-1131.263] * (-1129.383) (-1132.005) (-1133.935) [-1135.646] -- 0:00:57
109000 -- [-1133.517] (-1131.909) (-1131.851) (-1133.310) * [-1128.869] (-1131.953) (-1130.695) (-1134.092) -- 0:01:05
109500 -- (-1131.703) [-1132.430] (-1130.623) (-1131.871) * [-1129.873] (-1132.579) (-1131.734) (-1134.116) -- 0:01:05
110000 -- (-1130.193) (-1131.689) [-1130.480] (-1131.248) * (-1131.440) (-1130.255) (-1131.526) [-1130.360] -- 0:01:04
Average standard deviation of split frequencies: 0.014057
110500 -- (-1129.873) [-1132.186] (-1130.875) (-1134.513) * [-1130.360] (-1133.075) (-1130.879) (-1129.384) -- 0:01:04
111000 -- [-1130.430] (-1135.441) (-1136.092) (-1133.304) * (-1132.174) (-1133.615) (-1132.787) [-1131.381] -- 0:01:04
111500 -- (-1131.109) (-1140.942) [-1129.148] (-1131.486) * (-1128.262) (-1130.790) (-1129.488) [-1139.176] -- 0:01:03
112000 -- (-1132.511) [-1132.258] (-1129.770) (-1132.259) * (-1128.092) (-1138.461) [-1132.256] (-1132.481) -- 0:01:03
112500 -- (-1130.816) (-1136.107) [-1129.452] (-1131.202) * (-1130.319) (-1134.547) (-1132.526) [-1130.825] -- 0:01:03
113000 -- [-1130.040] (-1136.195) (-1130.765) (-1132.019) * (-1130.624) (-1130.043) [-1133.197] (-1133.304) -- 0:01:02
113500 -- (-1131.453) (-1134.139) [-1133.185] (-1131.839) * (-1129.855) (-1130.165) [-1132.075] (-1131.400) -- 0:01:02
114000 -- (-1130.153) (-1133.493) (-1132.208) [-1134.161] * [-1132.441] (-1136.138) (-1132.896) (-1132.448) -- 0:01:02
114500 -- (-1136.645) [-1131.272] (-1133.904) (-1135.609) * (-1132.903) (-1129.723) (-1133.296) [-1131.248] -- 0:01:01
115000 -- (-1137.551) (-1133.953) (-1136.386) [-1131.822] * [-1138.396] (-1131.488) (-1133.535) (-1131.300) -- 0:01:01
Average standard deviation of split frequencies: 0.016255
115500 -- (-1131.132) (-1131.613) (-1134.430) [-1132.745] * (-1134.586) (-1128.317) (-1133.225) [-1130.922] -- 0:01:01
116000 -- (-1130.585) (-1133.485) [-1132.510] (-1131.821) * (-1131.179) (-1132.941) (-1132.936) [-1129.874] -- 0:01:00
116500 -- (-1129.079) (-1131.087) (-1134.841) [-1133.687] * (-1131.160) (-1129.910) (-1132.687) [-1130.355] -- 0:01:00
117000 -- (-1130.663) (-1130.624) (-1131.005) [-1131.343] * (-1131.212) [-1131.707] (-1130.902) (-1130.911) -- 0:01:00
117500 -- (-1133.309) (-1137.989) [-1129.126] (-1131.303) * [-1130.568] (-1130.079) (-1130.798) (-1127.963) -- 0:01:00
118000 -- (-1130.732) (-1130.587) (-1131.792) [-1131.388] * (-1129.962) (-1132.357) (-1132.058) [-1129.739] -- 0:00:59
118500 -- [-1131.346] (-1130.489) (-1130.543) (-1133.300) * (-1130.350) (-1137.343) (-1132.956) [-1129.828] -- 0:00:59
119000 -- (-1132.841) [-1127.783] (-1132.142) (-1132.642) * [-1128.579] (-1131.693) (-1132.949) (-1130.530) -- 0:00:59
119500 -- (-1133.923) (-1131.087) [-1129.871] (-1130.276) * (-1133.562) (-1130.004) (-1130.984) [-1129.329] -- 0:00:58
120000 -- (-1132.140) (-1139.245) [-1130.064] (-1131.849) * (-1132.188) [-1129.265] (-1131.203) (-1131.872) -- 0:00:58
Average standard deviation of split frequencies: 0.017580
120500 -- [-1131.159] (-1134.807) (-1131.757) (-1132.511) * (-1133.436) (-1130.286) [-1132.937] (-1132.245) -- 0:00:58
121000 -- (-1130.115) (-1133.060) (-1130.544) [-1131.846] * [-1131.305] (-1129.841) (-1130.925) (-1132.192) -- 0:00:58
121500 -- (-1130.249) [-1130.389] (-1129.749) (-1130.212) * (-1131.705) (-1135.617) (-1133.175) [-1130.732] -- 0:00:57
122000 -- (-1132.941) (-1130.662) [-1133.425] (-1129.887) * (-1134.364) (-1129.289) [-1130.192] (-1130.830) -- 0:00:57
122500 -- (-1133.343) [-1131.573] (-1131.898) (-1134.152) * (-1133.871) (-1131.456) [-1129.459] (-1131.317) -- 0:00:57
123000 -- (-1131.688) (-1131.602) (-1132.007) [-1133.236] * (-1133.443) (-1131.694) [-1132.499] (-1130.792) -- 0:00:57
123500 -- (-1132.541) (-1131.772) (-1128.916) [-1129.456] * (-1132.689) (-1134.857) (-1132.085) [-1131.243] -- 0:00:56
124000 -- (-1131.695) (-1134.527) [-1129.567] (-1133.309) * (-1131.981) (-1132.477) (-1128.788) [-1130.290] -- 0:01:03
124500 -- [-1131.276] (-1133.612) (-1132.515) (-1130.062) * (-1135.763) (-1133.743) [-1131.041] (-1132.260) -- 0:01:03
125000 -- [-1130.485] (-1133.581) (-1130.258) (-1128.960) * (-1135.009) (-1133.108) [-1130.717] (-1132.952) -- 0:01:03
Average standard deviation of split frequencies: 0.017919
125500 -- (-1130.605) (-1132.332) (-1133.793) [-1129.853] * (-1131.625) [-1133.659] (-1130.435) (-1131.176) -- 0:01:02
126000 -- (-1130.598) (-1133.362) (-1134.456) [-1131.026] * (-1132.369) (-1132.059) (-1131.364) [-1129.828] -- 0:01:02
126500 -- (-1128.959) [-1130.181] (-1132.988) (-1130.882) * (-1131.487) (-1134.325) [-1130.711] (-1129.387) -- 0:01:02
127000 -- (-1129.488) (-1131.646) [-1129.677] (-1131.994) * (-1132.137) (-1132.929) [-1130.229] (-1131.360) -- 0:01:01
127500 -- [-1129.565] (-1130.433) (-1130.706) (-1132.861) * (-1131.367) [-1131.382] (-1130.923) (-1131.560) -- 0:01:01
128000 -- (-1131.933) (-1130.327) (-1131.049) [-1134.426] * (-1131.030) (-1131.003) (-1129.076) [-1129.034] -- 0:01:01
128500 -- (-1131.055) (-1132.247) (-1134.808) [-1132.997] * (-1132.006) (-1131.160) (-1138.275) [-1129.542] -- 0:01:01
129000 -- (-1132.665) (-1133.665) (-1129.183) [-1133.695] * (-1131.477) (-1132.080) [-1135.502] (-1130.283) -- 0:01:00
129500 -- (-1130.468) (-1132.142) [-1130.907] (-1130.468) * [-1135.341] (-1132.314) (-1130.411) (-1129.309) -- 0:01:00
130000 -- (-1130.521) (-1138.890) (-1129.992) [-1132.696] * (-1130.795) (-1131.618) (-1131.462) [-1129.745] -- 0:01:00
Average standard deviation of split frequencies: 0.013228
130500 -- (-1131.221) (-1132.166) [-1134.007] (-1131.130) * (-1133.228) [-1130.777] (-1132.363) (-1131.799) -- 0:00:59
131000 -- (-1133.526) (-1132.415) [-1130.964] (-1129.755) * (-1131.996) [-1132.972] (-1132.404) (-1130.697) -- 0:00:59
131500 -- [-1129.356] (-1132.552) (-1132.179) (-1134.559) * (-1132.786) [-1133.780] (-1131.793) (-1132.285) -- 0:00:59
132000 -- (-1131.148) (-1131.591) [-1130.415] (-1132.343) * (-1131.078) (-1132.391) (-1132.590) [-1134.065] -- 0:00:59
132500 -- (-1132.295) (-1131.544) [-1131.663] (-1134.746) * (-1130.177) (-1132.513) (-1132.703) [-1128.470] -- 0:00:58
133000 -- (-1137.604) (-1134.554) (-1132.256) [-1135.808] * (-1130.469) (-1136.879) [-1130.403] (-1131.258) -- 0:00:58
133500 -- (-1131.491) [-1131.183] (-1130.362) (-1134.320) * [-1130.834] (-1134.088) (-1130.885) (-1130.433) -- 0:00:58
134000 -- [-1128.893] (-1134.068) (-1131.461) (-1131.019) * [-1129.557] (-1131.645) (-1128.707) (-1130.437) -- 0:00:58
134500 -- (-1130.012) (-1131.039) [-1132.270] (-1130.997) * (-1130.636) (-1133.927) [-1129.257] (-1128.734) -- 0:00:57
135000 -- (-1130.160) (-1133.170) (-1133.564) [-1132.118] * [-1128.904] (-1131.455) (-1130.888) (-1130.409) -- 0:00:57
Average standard deviation of split frequencies: 0.013672
135500 -- [-1131.416] (-1132.174) (-1130.137) (-1131.511) * [-1127.786] (-1130.151) (-1129.976) (-1131.237) -- 0:00:57
136000 -- (-1135.928) [-1130.598] (-1131.540) (-1132.631) * (-1131.523) (-1131.526) (-1133.937) [-1130.863] -- 0:00:57
136500 -- (-1132.784) (-1135.658) [-1132.105] (-1134.584) * (-1129.324) [-1130.608] (-1131.075) (-1131.441) -- 0:00:56
137000 -- (-1135.109) (-1135.856) [-1131.145] (-1133.157) * [-1130.021] (-1128.416) (-1130.430) (-1136.985) -- 0:00:56
137500 -- (-1133.023) [-1128.797] (-1131.647) (-1132.408) * (-1129.891) [-1133.207] (-1132.040) (-1131.636) -- 0:00:56
138000 -- (-1133.295) (-1133.407) [-1131.800] (-1138.807) * (-1130.049) [-1131.049] (-1131.219) (-1129.371) -- 0:00:56
138500 -- (-1130.055) (-1130.706) [-1131.995] (-1131.647) * (-1130.417) [-1134.409] (-1130.926) (-1131.378) -- 0:00:55
139000 -- (-1130.127) (-1132.901) (-1134.107) [-1131.527] * [-1130.866] (-1129.835) (-1131.964) (-1130.386) -- 0:01:01
139500 -- [-1129.825] (-1131.343) (-1131.057) (-1130.996) * (-1130.063) (-1128.737) [-1130.772] (-1133.526) -- 0:01:01
140000 -- (-1130.575) (-1132.030) [-1131.264] (-1132.835) * (-1131.268) (-1130.296) (-1133.527) [-1132.124] -- 0:01:01
Average standard deviation of split frequencies: 0.015080
140500 -- [-1135.855] (-1131.411) (-1131.287) (-1132.443) * [-1130.649] (-1130.117) (-1131.355) (-1136.840) -- 0:01:01
141000 -- (-1130.221) (-1130.957) (-1133.566) [-1131.606] * (-1131.631) [-1128.127] (-1130.922) (-1131.637) -- 0:01:00
141500 -- [-1129.031] (-1130.273) (-1130.016) (-1132.134) * [-1134.115] (-1129.817) (-1130.398) (-1131.129) -- 0:01:00
142000 -- (-1134.940) (-1131.905) [-1130.273] (-1130.216) * (-1132.378) (-1130.958) (-1134.686) [-1132.334] -- 0:01:00
142500 -- (-1129.700) [-1130.176] (-1130.223) (-1134.152) * [-1129.180] (-1131.012) (-1131.008) (-1131.231) -- 0:01:00
143000 -- (-1130.452) (-1130.274) [-1133.227] (-1137.066) * [-1131.895] (-1129.837) (-1130.965) (-1129.901) -- 0:00:59
143500 -- (-1132.683) (-1132.869) (-1131.216) [-1132.932] * (-1132.664) (-1128.724) [-1133.401] (-1129.880) -- 0:00:59
144000 -- (-1129.749) (-1137.613) [-1130.268] (-1130.731) * (-1132.182) (-1133.948) (-1131.233) [-1129.678] -- 0:00:59
144500 -- [-1129.843] (-1132.978) (-1133.094) (-1130.734) * [-1131.736] (-1137.373) (-1135.455) (-1130.456) -- 0:00:59
145000 -- (-1128.970) (-1132.212) (-1134.398) [-1132.664] * [-1129.743] (-1131.641) (-1131.661) (-1136.323) -- 0:00:58
Average standard deviation of split frequencies: 0.015175
145500 -- (-1135.154) (-1134.470) [-1130.382] (-1131.558) * (-1131.166) [-1130.848] (-1131.341) (-1129.674) -- 0:00:58
146000 -- (-1131.822) (-1134.442) [-1132.451] (-1134.849) * [-1130.362] (-1132.168) (-1131.640) (-1130.967) -- 0:00:58
146500 -- [-1131.565] (-1131.851) (-1130.858) (-1132.076) * [-1133.176] (-1131.462) (-1131.522) (-1131.596) -- 0:00:58
147000 -- (-1132.092) (-1129.378) (-1131.587) [-1132.351] * (-1129.763) (-1131.356) [-1131.193] (-1132.830) -- 0:00:58
147500 -- (-1132.328) (-1130.360) [-1130.004] (-1133.601) * (-1131.772) [-1133.089] (-1130.672) (-1135.852) -- 0:00:57
148000 -- (-1131.011) (-1133.702) [-1130.504] (-1131.009) * [-1131.733] (-1131.296) (-1133.777) (-1131.125) -- 0:00:57
148500 -- (-1132.317) (-1133.494) (-1128.431) [-1131.021] * (-1133.060) [-1130.654] (-1129.756) (-1131.244) -- 0:00:57
149000 -- [-1133.524] (-1130.374) (-1130.826) (-1130.748) * [-1130.235] (-1133.791) (-1131.313) (-1133.113) -- 0:00:57
149500 -- (-1130.656) [-1130.518] (-1128.304) (-1131.377) * [-1130.646] (-1132.942) (-1131.938) (-1131.284) -- 0:00:56
150000 -- (-1129.635) (-1130.771) [-1129.318] (-1130.308) * (-1130.640) (-1135.142) [-1131.207] (-1131.325) -- 0:00:56
Average standard deviation of split frequencies: 0.017904
150500 -- (-1130.952) [-1131.635] (-1132.818) (-1130.551) * (-1131.702) (-1131.222) [-1131.419] (-1131.593) -- 0:00:56
151000 -- [-1128.694] (-1136.694) (-1131.552) (-1130.611) * (-1129.607) [-1134.471] (-1132.301) (-1130.455) -- 0:00:56
151500 -- (-1131.215) (-1130.869) (-1130.330) [-1129.105] * (-1130.092) (-1138.565) (-1130.518) [-1129.694] -- 0:00:56
152000 -- [-1130.727] (-1135.294) (-1135.138) (-1130.946) * (-1136.245) (-1136.582) [-1131.778] (-1131.107) -- 0:00:55
152500 -- (-1133.465) (-1134.616) [-1135.950] (-1130.844) * (-1133.406) (-1138.167) (-1131.147) [-1132.086] -- 0:00:55
153000 -- (-1131.093) (-1138.147) (-1133.821) [-1135.707] * (-1136.130) (-1132.508) [-1128.800] (-1131.422) -- 0:00:55
153500 -- [-1131.077] (-1130.866) (-1132.755) (-1131.002) * (-1130.117) (-1131.945) [-1130.953] (-1130.866) -- 0:00:55
154000 -- (-1128.710) [-1131.224] (-1130.891) (-1130.001) * (-1129.538) (-1131.043) [-1131.581] (-1131.865) -- 0:01:00
154500 -- (-1130.958) (-1130.460) (-1129.506) [-1130.547] * (-1132.149) (-1130.923) [-1129.942] (-1130.729) -- 0:01:00
155000 -- (-1135.169) (-1130.085) [-1131.937] (-1131.219) * (-1129.327) (-1131.610) [-1129.352] (-1130.529) -- 0:00:59
Average standard deviation of split frequencies: 0.015745
155500 -- (-1135.723) (-1130.229) (-1132.333) [-1132.063] * (-1137.360) [-1131.093] (-1131.320) (-1130.368) -- 0:00:59
156000 -- (-1131.632) (-1132.405) (-1135.341) [-1133.507] * (-1131.342) (-1134.157) [-1131.196] (-1131.913) -- 0:00:59
156500 -- [-1131.783] (-1133.650) (-1138.086) (-1132.853) * (-1133.916) (-1133.297) [-1132.455] (-1129.893) -- 0:00:59
157000 -- [-1131.859] (-1129.344) (-1135.447) (-1130.602) * (-1131.441) (-1134.255) [-1130.617] (-1131.024) -- 0:00:59
157500 -- (-1128.555) [-1130.523] (-1134.934) (-1130.596) * [-1131.117] (-1132.804) (-1132.062) (-1129.903) -- 0:00:58
158000 -- (-1130.668) (-1130.108) [-1131.601] (-1132.263) * (-1131.731) [-1132.968] (-1134.842) (-1130.114) -- 0:00:58
158500 -- (-1131.572) (-1130.664) (-1131.502) [-1130.970] * (-1132.894) (-1130.196) [-1135.789] (-1128.660) -- 0:00:58
159000 -- (-1132.347) (-1132.964) (-1131.459) [-1130.395] * (-1131.726) (-1128.921) (-1129.267) [-1128.056] -- 0:00:58
159500 -- (-1128.840) (-1133.918) (-1131.714) [-1129.971] * (-1132.132) [-1130.297] (-1130.087) (-1129.531) -- 0:00:57
160000 -- (-1131.072) (-1132.573) (-1129.818) [-1130.359] * (-1130.479) (-1130.177) [-1133.530] (-1130.126) -- 0:00:57
Average standard deviation of split frequencies: 0.017164
160500 -- (-1130.367) (-1128.366) (-1130.209) [-1131.264] * [-1130.140] (-1133.758) (-1131.522) (-1132.464) -- 0:00:57
161000 -- (-1130.542) (-1130.747) [-1131.413] (-1131.667) * (-1131.923) (-1131.379) [-1131.882] (-1131.511) -- 0:00:57
161500 -- (-1129.746) [-1130.100] (-1131.316) (-1128.069) * (-1133.249) [-1134.781] (-1131.227) (-1132.762) -- 0:00:57
162000 -- (-1129.914) [-1132.435] (-1132.822) (-1129.970) * [-1132.313] (-1130.232) (-1129.578) (-1136.128) -- 0:00:56
162500 -- [-1131.570] (-1132.711) (-1134.945) (-1132.227) * [-1132.406] (-1131.747) (-1134.719) (-1131.693) -- 0:00:56
163000 -- (-1131.098) (-1129.992) (-1134.148) [-1130.340] * (-1134.989) (-1130.281) (-1130.696) [-1130.461] -- 0:00:56
163500 -- (-1131.912) [-1128.690] (-1134.256) (-1131.253) * [-1135.569] (-1131.275) (-1129.101) (-1135.650) -- 0:00:56
164000 -- [-1128.481] (-1129.456) (-1131.609) (-1129.902) * (-1132.317) (-1134.298) (-1131.363) [-1129.466] -- 0:00:56
164500 -- (-1130.790) (-1131.311) (-1132.411) [-1131.731] * (-1131.042) (-1135.745) (-1135.167) [-1133.906] -- 0:00:55
165000 -- (-1131.957) (-1133.693) (-1132.876) [-1130.596] * (-1129.827) (-1136.006) [-1130.545] (-1131.191) -- 0:00:55
Average standard deviation of split frequencies: 0.015686
165500 -- (-1129.063) (-1129.491) (-1131.774) [-1131.184] * (-1130.962) (-1134.292) [-1131.458] (-1130.617) -- 0:00:55
166000 -- (-1130.957) (-1129.110) (-1130.824) [-1130.376] * (-1132.382) [-1133.807] (-1132.277) (-1130.861) -- 0:00:55
166500 -- (-1127.607) (-1134.569) (-1131.832) [-1131.803] * (-1131.064) (-1133.191) (-1130.781) [-1131.977] -- 0:00:55
167000 -- (-1130.599) (-1131.035) [-1130.288] (-1130.852) * (-1130.451) (-1131.786) [-1132.364] (-1132.413) -- 0:00:54
167500 -- (-1132.663) [-1129.408] (-1133.092) (-1131.725) * [-1130.406] (-1132.842) (-1131.311) (-1131.068) -- 0:00:54
168000 -- (-1132.030) (-1129.210) (-1131.921) [-1132.005] * (-1132.366) (-1133.945) (-1131.733) [-1134.756] -- 0:00:54
168500 -- (-1133.216) (-1133.230) [-1131.050] (-1133.365) * (-1131.077) (-1132.559) (-1133.325) [-1132.189] -- 0:00:54
169000 -- (-1131.289) [-1131.218] (-1135.412) (-1132.078) * (-1130.038) (-1137.592) [-1136.317] (-1131.458) -- 0:00:59
169500 -- [-1131.550] (-1132.902) (-1132.817) (-1132.270) * (-1132.098) (-1133.834) (-1133.586) [-1129.905] -- 0:00:58
170000 -- (-1133.417) (-1132.744) (-1132.813) [-1136.649] * (-1133.401) [-1131.329] (-1132.609) (-1130.989) -- 0:00:58
Average standard deviation of split frequencies: 0.014468
170500 -- (-1138.798) [-1132.374] (-1134.158) (-1135.581) * (-1133.884) (-1131.810) (-1134.031) [-1130.290] -- 0:00:58
171000 -- (-1137.579) (-1128.933) [-1132.330] (-1132.557) * (-1131.633) (-1130.504) [-1134.279] (-1136.110) -- 0:00:58
171500 -- (-1134.261) [-1130.540] (-1131.645) (-1131.209) * (-1130.466) [-1130.696] (-1135.033) (-1134.035) -- 0:00:57
172000 -- (-1136.423) (-1130.244) (-1130.986) [-1134.706] * (-1129.941) [-1133.990] (-1129.547) (-1133.069) -- 0:00:57
172500 -- [-1132.491] (-1131.573) (-1132.248) (-1129.326) * (-1131.972) (-1134.704) [-1130.887] (-1130.713) -- 0:00:57
173000 -- (-1137.648) (-1130.400) (-1131.736) [-1128.461] * (-1130.911) (-1132.717) (-1131.023) [-1131.546] -- 0:00:57
173500 -- (-1132.142) (-1131.685) (-1133.870) [-1130.747] * [-1131.583] (-1131.212) (-1128.270) (-1130.761) -- 0:00:57
174000 -- [-1134.583] (-1129.174) (-1131.984) (-1132.153) * (-1131.985) (-1132.174) [-1129.861] (-1130.334) -- 0:00:56
174500 -- [-1130.026] (-1131.319) (-1131.024) (-1129.659) * (-1131.700) (-1131.401) (-1131.350) [-1132.450] -- 0:00:56
175000 -- (-1130.595) (-1130.809) (-1130.152) [-1128.305] * (-1133.535) (-1130.788) (-1132.730) [-1130.539] -- 0:00:56
Average standard deviation of split frequencies: 0.013392
175500 -- [-1132.275] (-1130.314) (-1131.414) (-1130.699) * (-1133.116) (-1130.206) (-1132.699) [-1131.374] -- 0:00:56
176000 -- (-1132.287) (-1129.640) (-1131.138) [-1130.495] * (-1134.229) (-1133.643) (-1131.381) [-1131.054] -- 0:00:56
176500 -- (-1134.077) [-1132.471] (-1133.477) (-1133.772) * (-1133.734) (-1129.439) [-1130.562] (-1132.864) -- 0:00:55
177000 -- (-1130.491) (-1131.866) [-1130.736] (-1129.634) * (-1131.085) [-1129.081] (-1134.660) (-1135.234) -- 0:00:55
177500 -- (-1130.977) (-1131.850) (-1138.505) [-1129.238] * (-1131.887) (-1129.378) [-1131.704] (-1131.820) -- 0:00:55
178000 -- (-1131.040) (-1134.793) [-1131.787] (-1129.770) * (-1131.493) (-1130.351) [-1133.432] (-1130.528) -- 0:00:55
178500 -- (-1131.089) (-1136.297) [-1129.405] (-1134.868) * (-1131.246) (-1133.389) (-1133.257) [-1130.681] -- 0:00:55
179000 -- [-1131.355] (-1130.570) (-1129.126) (-1128.582) * (-1132.040) [-1131.869] (-1131.133) (-1133.755) -- 0:00:55
179500 -- (-1132.146) (-1129.742) (-1132.194) [-1130.611] * (-1134.554) [-1129.819] (-1132.191) (-1130.624) -- 0:00:54
180000 -- (-1132.034) [-1131.128] (-1130.635) (-1130.201) * (-1132.838) (-1129.426) [-1129.097] (-1132.992) -- 0:00:54
Average standard deviation of split frequencies: 0.011673
180500 -- [-1134.105] (-1133.992) (-1133.373) (-1129.162) * (-1131.002) (-1136.285) [-1133.255] (-1134.077) -- 0:00:54
181000 -- [-1130.207] (-1137.575) (-1136.614) (-1136.722) * (-1130.438) [-1130.888] (-1131.164) (-1131.835) -- 0:00:54
181500 -- [-1130.716] (-1136.825) (-1131.363) (-1130.824) * (-1134.942) (-1131.528) (-1130.602) [-1131.658] -- 0:00:54
182000 -- (-1131.893) (-1130.784) (-1133.674) [-1131.094] * (-1134.905) [-1128.574] (-1130.273) (-1131.605) -- 0:00:53
182500 -- (-1133.257) (-1129.589) (-1128.842) [-1132.324] * [-1129.664] (-1133.393) (-1129.938) (-1130.630) -- 0:00:53
183000 -- [-1130.076] (-1134.431) (-1131.257) (-1130.273) * (-1132.647) [-1131.098] (-1130.665) (-1132.557) -- 0:00:53
183500 -- [-1131.831] (-1130.477) (-1128.996) (-1132.443) * (-1131.731) (-1130.373) (-1129.868) [-1130.767] -- 0:00:53
184000 -- (-1132.347) (-1128.509) [-1130.936] (-1129.357) * (-1132.376) [-1132.242] (-1132.311) (-1132.483) -- 0:00:53
184500 -- (-1129.240) (-1131.214) (-1132.971) [-1132.355] * (-1135.425) [-1129.044] (-1132.677) (-1134.012) -- 0:00:57
185000 -- (-1134.045) (-1129.115) [-1131.261] (-1133.488) * (-1128.975) (-1130.308) [-1130.641] (-1134.301) -- 0:00:57
Average standard deviation of split frequencies: 0.010805
185500 -- (-1132.000) (-1131.000) (-1132.372) [-1133.639] * (-1129.699) (-1131.830) [-1133.352] (-1131.459) -- 0:00:57
186000 -- (-1129.896) (-1131.582) (-1130.763) [-1131.995] * (-1130.432) (-1130.339) (-1131.487) [-1131.527] -- 0:00:56
186500 -- (-1131.998) (-1132.489) [-1131.299] (-1130.587) * [-1130.795] (-1130.698) (-1133.813) (-1132.384) -- 0:00:56
187000 -- (-1131.588) [-1131.372] (-1135.920) (-1128.543) * (-1138.012) (-1130.705) [-1130.960] (-1130.068) -- 0:00:56
187500 -- (-1131.901) (-1133.707) (-1136.194) [-1130.156] * (-1133.360) [-1130.546] (-1135.639) (-1133.557) -- 0:00:56
188000 -- (-1131.086) [-1131.153] (-1134.971) (-1129.047) * (-1128.230) (-1129.437) [-1130.856] (-1130.770) -- 0:00:56
188500 -- (-1131.332) [-1130.702] (-1130.283) (-1130.417) * (-1130.038) (-1131.318) [-1129.993] (-1131.188) -- 0:00:55
189000 -- (-1130.044) (-1132.254) (-1128.793) [-1133.347] * (-1132.652) (-1128.855) (-1128.857) [-1129.611] -- 0:00:55
189500 -- (-1136.263) (-1132.118) [-1129.444] (-1129.796) * (-1131.927) (-1132.517) (-1129.852) [-1131.057] -- 0:00:55
190000 -- (-1131.113) (-1132.561) (-1132.028) [-1129.408] * (-1130.179) (-1137.358) (-1130.774) [-1130.686] -- 0:00:55
Average standard deviation of split frequencies: 0.011451
190500 -- [-1131.080] (-1130.673) (-1130.485) (-1131.414) * (-1134.986) (-1133.885) [-1128.494] (-1129.379) -- 0:00:55
191000 -- (-1130.849) (-1130.863) (-1129.955) [-1129.285] * (-1131.749) (-1131.325) [-1129.949] (-1131.808) -- 0:00:55
191500 -- (-1136.190) [-1130.294] (-1131.883) (-1134.435) * [-1130.699] (-1133.221) (-1131.804) (-1133.550) -- 0:00:54
192000 -- [-1131.419] (-1129.315) (-1130.936) (-1132.293) * (-1127.311) (-1132.922) [-1130.790] (-1130.069) -- 0:00:54
192500 -- [-1130.292] (-1130.201) (-1129.977) (-1131.321) * (-1131.529) [-1128.527] (-1133.737) (-1130.798) -- 0:00:54
193000 -- (-1133.578) (-1131.517) (-1128.267) [-1131.631] * [-1129.988] (-1141.932) (-1130.553) (-1128.677) -- 0:00:54
193500 -- [-1132.013] (-1135.113) (-1132.183) (-1130.525) * [-1131.791] (-1131.750) (-1129.881) (-1130.657) -- 0:00:54
194000 -- [-1134.499] (-1130.304) (-1131.826) (-1132.801) * (-1129.542) (-1132.211) (-1130.758) [-1131.017] -- 0:00:54
194500 -- [-1134.791] (-1130.616) (-1131.766) (-1129.472) * (-1130.872) [-1128.295] (-1130.621) (-1130.117) -- 0:00:53
195000 -- (-1130.511) (-1130.939) [-1129.158] (-1133.462) * [-1133.487] (-1130.548) (-1133.939) (-1130.954) -- 0:00:53
Average standard deviation of split frequencies: 0.012279
195500 -- (-1130.268) (-1131.968) (-1128.750) [-1130.408] * [-1133.598] (-1129.370) (-1133.228) (-1129.673) -- 0:00:53
196000 -- [-1131.724] (-1128.823) (-1129.636) (-1131.491) * (-1131.336) (-1130.039) [-1130.335] (-1132.115) -- 0:00:53
196500 -- (-1130.769) (-1130.485) (-1132.050) [-1133.982] * (-1128.619) (-1129.711) (-1132.207) [-1130.594] -- 0:00:53
197000 -- (-1134.070) (-1131.966) [-1128.383] (-1131.718) * (-1129.544) [-1130.168] (-1139.022) (-1130.988) -- 0:00:52
197500 -- (-1130.199) (-1132.518) [-1130.738] (-1130.155) * (-1133.457) [-1130.553] (-1138.122) (-1130.217) -- 0:00:52
198000 -- (-1131.569) (-1130.909) [-1131.959] (-1131.949) * (-1134.586) [-1132.239] (-1133.341) (-1128.784) -- 0:00:52
198500 -- [-1131.540] (-1132.191) (-1131.574) (-1131.635) * (-1134.609) (-1130.727) (-1130.773) [-1133.733] -- 0:00:52
199000 -- (-1130.389) [-1130.381] (-1131.326) (-1130.206) * (-1132.313) [-1131.338] (-1134.870) (-1133.397) -- 0:00:52
199500 -- (-1135.411) [-1132.058] (-1129.890) (-1137.557) * (-1131.339) [-1129.684] (-1131.214) (-1132.027) -- 0:00:56
200000 -- (-1130.157) (-1136.266) (-1130.806) [-1129.737] * [-1129.069] (-1131.267) (-1133.831) (-1132.599) -- 0:00:55
Average standard deviation of split frequencies: 0.012529
200500 -- (-1135.119) [-1132.729] (-1129.849) (-1129.827) * [-1129.461] (-1130.280) (-1130.333) (-1135.637) -- 0:00:55
201000 -- [-1131.961] (-1130.558) (-1133.232) (-1131.045) * (-1133.420) [-1134.275] (-1130.596) (-1132.620) -- 0:00:55
201500 -- (-1134.810) [-1129.917] (-1134.815) (-1131.134) * (-1131.360) [-1131.014] (-1133.257) (-1131.053) -- 0:00:55
202000 -- (-1131.194) (-1129.800) [-1133.730] (-1131.366) * (-1133.709) (-1130.685) [-1133.868] (-1129.476) -- 0:00:55
202500 -- (-1131.738) (-1131.024) (-1131.392) [-1133.138] * [-1132.183] (-1135.687) (-1132.685) (-1131.668) -- 0:00:55
203000 -- (-1130.493) [-1132.203] (-1130.348) (-1132.072) * (-1135.403) (-1132.211) (-1134.865) [-1130.340] -- 0:00:54
203500 -- (-1129.805) (-1132.492) [-1129.674] (-1132.204) * [-1136.948] (-1133.135) (-1136.790) (-1133.296) -- 0:00:54
204000 -- (-1133.393) [-1131.389] (-1129.697) (-1133.301) * [-1130.147] (-1135.131) (-1131.225) (-1131.148) -- 0:00:54
204500 -- (-1135.557) (-1130.273) [-1133.141] (-1130.482) * (-1129.834) (-1131.934) (-1130.252) [-1130.945] -- 0:00:54
205000 -- (-1130.437) (-1130.430) [-1132.191] (-1133.210) * [-1132.030] (-1132.376) (-1132.756) (-1131.190) -- 0:00:54
Average standard deviation of split frequencies: 0.011201
205500 -- (-1132.639) (-1129.883) (-1131.182) [-1133.181] * (-1131.644) (-1132.109) [-1129.351] (-1133.030) -- 0:00:54
206000 -- (-1133.550) [-1131.143] (-1132.442) (-1134.261) * [-1131.354] (-1130.487) (-1132.873) (-1133.909) -- 0:00:53
206500 -- (-1135.310) (-1130.592) [-1132.239] (-1134.238) * (-1132.080) (-1130.653) [-1130.822] (-1135.976) -- 0:00:53
207000 -- (-1138.541) [-1131.496] (-1131.620) (-1137.296) * [-1130.814] (-1133.348) (-1130.776) (-1134.409) -- 0:00:53
207500 -- [-1131.112] (-1132.830) (-1131.588) (-1132.152) * (-1135.060) (-1132.318) (-1132.365) [-1130.662] -- 0:00:53
208000 -- (-1134.767) (-1129.720) [-1132.404] (-1133.504) * [-1132.519] (-1130.191) (-1131.645) (-1132.824) -- 0:00:53
208500 -- (-1130.576) (-1130.056) [-1131.551] (-1132.152) * (-1129.535) [-1128.772] (-1132.191) (-1132.424) -- 0:00:53
209000 -- [-1130.402] (-1129.746) (-1131.260) (-1131.704) * (-1128.667) (-1131.564) (-1131.854) [-1133.288] -- 0:00:52
209500 -- [-1129.292] (-1130.216) (-1130.896) (-1130.454) * (-1129.052) (-1134.401) (-1131.323) [-1130.947] -- 0:00:52
210000 -- (-1130.229) (-1130.411) [-1133.899] (-1130.881) * [-1130.818] (-1133.090) (-1130.781) (-1131.859) -- 0:00:52
Average standard deviation of split frequencies: 0.010691
210500 -- (-1132.553) (-1132.040) (-1130.986) [-1132.541] * [-1130.092] (-1132.040) (-1128.423) (-1132.691) -- 0:00:52
211000 -- [-1129.632] (-1132.667) (-1130.803) (-1130.854) * (-1129.907) [-1132.362] (-1133.893) (-1131.314) -- 0:00:52
211500 -- [-1128.263] (-1131.512) (-1131.721) (-1133.259) * (-1134.563) (-1132.964) [-1133.382] (-1131.869) -- 0:00:52
212000 -- (-1131.220) [-1131.281] (-1131.383) (-1129.788) * (-1130.280) (-1131.143) [-1130.402] (-1133.548) -- 0:00:52
212500 -- (-1130.325) [-1130.158] (-1133.516) (-1132.239) * [-1131.859] (-1133.598) (-1131.196) (-1129.215) -- 0:00:51
213000 -- (-1132.340) (-1132.142) [-1130.679] (-1130.789) * (-1131.475) (-1134.347) (-1134.155) [-1127.924] -- 0:00:51
213500 -- [-1130.007] (-1129.421) (-1132.094) (-1133.467) * [-1132.479] (-1132.910) (-1132.510) (-1131.565) -- 0:00:51
214000 -- (-1131.657) [-1130.965] (-1131.906) (-1129.130) * (-1130.736) (-1134.400) (-1130.398) [-1131.646] -- 0:00:51
214500 -- [-1128.788] (-1130.953) (-1135.473) (-1130.904) * (-1130.431) (-1130.783) (-1130.662) [-1130.393] -- 0:00:54
215000 -- (-1130.429) (-1129.846) (-1133.191) [-1131.281] * (-1127.942) (-1131.484) (-1130.051) [-1130.343] -- 0:00:54
Average standard deviation of split frequencies: 0.011033
215500 -- (-1129.145) [-1132.139] (-1130.612) (-1132.317) * (-1128.942) (-1130.930) [-1130.664] (-1130.591) -- 0:00:54
216000 -- [-1129.259] (-1132.926) (-1132.981) (-1132.877) * (-1129.788) [-1131.280] (-1134.010) (-1130.305) -- 0:00:54
216500 -- (-1132.090) (-1129.465) (-1130.840) [-1133.413] * (-1129.854) (-1130.961) (-1132.837) [-1130.202] -- 0:00:54
217000 -- (-1133.839) (-1131.160) [-1132.648] (-1132.866) * (-1131.546) (-1129.979) (-1133.568) [-1130.965] -- 0:00:54
217500 -- (-1133.374) (-1129.329) (-1134.169) [-1131.524] * (-1130.307) (-1134.340) (-1130.097) [-1130.497] -- 0:00:53
218000 -- (-1132.860) (-1134.433) (-1130.858) [-1133.627] * [-1132.153] (-1133.734) (-1131.834) (-1129.873) -- 0:00:53
218500 -- (-1131.501) [-1134.991] (-1130.605) (-1131.132) * [-1133.594] (-1131.225) (-1129.621) (-1131.288) -- 0:00:53
219000 -- (-1132.807) [-1134.740] (-1131.890) (-1133.520) * [-1130.409] (-1130.196) (-1134.314) (-1131.883) -- 0:00:53
219500 -- (-1129.583) [-1129.346] (-1133.825) (-1135.298) * (-1130.117) (-1130.558) [-1130.627] (-1131.293) -- 0:00:53
220000 -- (-1129.204) (-1129.757) (-1132.128) [-1129.918] * [-1131.245] (-1130.373) (-1133.274) (-1131.734) -- 0:00:53
Average standard deviation of split frequencies: 0.011393
220500 -- [-1128.679] (-1130.997) (-1130.206) (-1132.281) * (-1131.109) (-1132.737) [-1130.261] (-1131.265) -- 0:00:53
221000 -- (-1131.062) (-1132.189) (-1131.971) [-1131.988] * (-1130.838) (-1132.904) (-1132.528) [-1129.872] -- 0:00:52
221500 -- (-1130.173) [-1128.986] (-1131.391) (-1132.461) * (-1132.585) (-1131.466) [-1130.730] (-1131.295) -- 0:00:52
222000 -- (-1129.686) (-1132.572) (-1133.275) [-1129.914] * (-1130.656) (-1130.932) [-1131.204] (-1135.102) -- 0:00:52
222500 -- [-1129.958] (-1131.575) (-1134.907) (-1130.052) * [-1132.132] (-1133.316) (-1128.929) (-1132.019) -- 0:00:52
223000 -- [-1131.537] (-1133.693) (-1130.729) (-1131.396) * [-1129.847] (-1132.513) (-1129.372) (-1133.187) -- 0:00:52
223500 -- (-1132.597) [-1130.164] (-1134.690) (-1130.891) * [-1130.304] (-1131.763) (-1127.649) (-1131.598) -- 0:00:52
224000 -- [-1129.032] (-1130.138) (-1130.328) (-1134.054) * (-1132.259) (-1131.301) [-1128.773] (-1135.230) -- 0:00:51
224500 -- (-1134.544) (-1129.449) [-1132.894] (-1132.929) * (-1133.111) (-1131.329) [-1131.346] (-1136.983) -- 0:00:51
225000 -- (-1129.981) [-1131.650] (-1131.010) (-1132.789) * (-1133.308) (-1132.259) [-1132.338] (-1132.785) -- 0:00:51
Average standard deviation of split frequencies: 0.014303
225500 -- (-1135.993) (-1133.968) (-1130.207) [-1131.540] * (-1133.452) (-1133.816) (-1128.948) [-1132.134] -- 0:00:51
226000 -- (-1134.411) [-1129.760] (-1133.902) (-1131.623) * (-1130.661) (-1131.813) [-1131.162] (-1130.720) -- 0:00:51
226500 -- (-1130.465) [-1130.326] (-1134.688) (-1135.774) * (-1131.232) (-1131.397) [-1129.968] (-1130.211) -- 0:00:51
227000 -- (-1136.362) [-1132.433] (-1131.439) (-1135.166) * (-1130.473) [-1131.753] (-1129.332) (-1130.997) -- 0:00:51
227500 -- (-1134.823) (-1132.412) [-1133.035] (-1132.043) * (-1134.745) (-1131.726) [-1129.214] (-1129.347) -- 0:00:50
228000 -- (-1131.927) (-1131.049) (-1130.850) [-1129.871] * [-1130.620] (-1130.594) (-1130.080) (-1133.285) -- 0:00:50
228500 -- (-1130.294) (-1130.283) (-1130.555) [-1131.487] * (-1130.187) [-1131.934] (-1131.645) (-1136.394) -- 0:00:50
229000 -- (-1129.525) (-1130.296) [-1130.025] (-1133.322) * (-1128.377) (-1129.994) [-1129.906] (-1134.585) -- 0:00:50
229500 -- (-1130.846) [-1129.828] (-1132.475) (-1131.987) * (-1128.860) [-1132.260] (-1129.753) (-1133.573) -- 0:00:53
230000 -- (-1129.744) (-1132.154) (-1132.189) [-1129.302] * [-1128.570] (-1132.267) (-1129.630) (-1132.138) -- 0:00:53
Average standard deviation of split frequencies: 0.013445
230500 -- (-1132.244) [-1132.679] (-1130.588) (-1131.473) * [-1131.269] (-1135.259) (-1130.437) (-1132.465) -- 0:00:53
231000 -- (-1131.697) (-1130.537) (-1130.998) [-1132.885] * [-1134.029] (-1131.342) (-1133.235) (-1132.406) -- 0:00:53
231500 -- (-1129.993) (-1133.131) (-1133.433) [-1133.388] * (-1133.738) (-1133.559) (-1133.297) [-1130.258] -- 0:00:53
232000 -- (-1132.317) (-1134.302) (-1130.689) [-1130.085] * (-1134.425) (-1135.400) (-1132.196) [-1132.570] -- 0:00:52
232500 -- [-1129.507] (-1132.790) (-1132.756) (-1130.411) * (-1130.711) (-1132.690) [-1132.397] (-1132.487) -- 0:00:52
233000 -- (-1130.347) (-1132.664) (-1133.483) [-1128.895] * [-1131.431] (-1133.141) (-1132.218) (-1130.576) -- 0:00:52
233500 -- (-1132.080) [-1132.886] (-1134.465) (-1134.543) * (-1131.887) (-1131.091) (-1131.351) [-1129.779] -- 0:00:52
234000 -- (-1137.843) (-1132.292) [-1130.329] (-1128.534) * (-1132.138) (-1133.676) (-1129.518) [-1133.035] -- 0:00:52
234500 -- [-1133.079] (-1133.704) (-1130.814) (-1129.542) * [-1133.879] (-1132.317) (-1130.653) (-1133.038) -- 0:00:52
235000 -- (-1130.685) [-1131.413] (-1129.865) (-1134.154) * (-1130.799) (-1134.174) [-1132.160] (-1133.513) -- 0:00:52
Average standard deviation of split frequencies: 0.011354
235500 -- (-1129.315) (-1131.326) [-1131.122] (-1130.190) * (-1128.871) (-1132.393) [-1134.560] (-1135.099) -- 0:00:51
236000 -- (-1130.761) (-1134.408) [-1130.150] (-1131.674) * (-1130.426) (-1135.686) (-1131.378) [-1133.383] -- 0:00:51
236500 -- (-1130.349) (-1134.144) [-1131.337] (-1129.988) * (-1129.302) [-1131.304] (-1132.868) (-1130.551) -- 0:00:51
237000 -- (-1134.329) (-1132.328) [-1129.804] (-1128.910) * [-1131.291] (-1129.417) (-1133.538) (-1130.936) -- 0:00:51
237500 -- (-1133.428) (-1132.774) (-1132.206) [-1130.958] * [-1136.511] (-1130.652) (-1132.417) (-1134.981) -- 0:00:51
238000 -- [-1130.309] (-1130.970) (-1133.032) (-1130.750) * (-1133.271) (-1129.273) [-1132.321] (-1129.053) -- 0:00:51
238500 -- (-1133.913) (-1130.512) [-1129.770] (-1129.233) * (-1129.220) [-1131.399] (-1132.637) (-1132.583) -- 0:00:51
239000 -- (-1132.189) [-1130.273] (-1130.364) (-1131.425) * (-1127.930) (-1130.281) [-1131.432] (-1135.424) -- 0:00:50
239500 -- (-1132.026) (-1130.824) (-1131.628) [-1131.540] * (-1129.986) (-1131.740) (-1131.032) [-1129.976] -- 0:00:50
240000 -- (-1130.448) (-1131.983) (-1130.679) [-1130.650] * (-1130.682) [-1130.830] (-1129.177) (-1135.790) -- 0:00:50
Average standard deviation of split frequencies: 0.011868
240500 -- [-1132.295] (-1130.623) (-1130.232) (-1129.471) * (-1132.481) (-1130.760) [-1136.235] (-1132.143) -- 0:00:50
241000 -- (-1131.207) (-1134.100) [-1130.660] (-1132.316) * (-1132.485) [-1133.772] (-1133.796) (-1131.912) -- 0:00:50
241500 -- (-1132.095) (-1132.449) (-1129.783) [-1133.755] * (-1129.072) [-1132.107] (-1131.313) (-1131.730) -- 0:00:50
242000 -- (-1130.355) (-1132.403) (-1129.358) [-1132.124] * (-1129.659) [-1130.777] (-1130.991) (-1132.266) -- 0:00:50
242500 -- (-1133.353) (-1132.316) [-1133.980] (-1130.469) * (-1130.276) [-1133.349] (-1130.972) (-1131.333) -- 0:00:49
243000 -- (-1131.410) [-1131.578] (-1134.830) (-1128.617) * (-1131.452) [-1131.671] (-1133.605) (-1133.145) -- 0:00:49
243500 -- (-1130.720) [-1131.328] (-1133.539) (-1128.041) * (-1132.318) [-1130.794] (-1131.437) (-1133.905) -- 0:00:49
244000 -- (-1135.988) (-1131.824) (-1131.146) [-1131.273] * [-1131.343] (-1131.557) (-1131.340) (-1130.993) -- 0:00:49
244500 -- (-1130.963) [-1131.780] (-1130.124) (-1132.503) * [-1131.621] (-1130.563) (-1130.881) (-1130.495) -- 0:00:52
245000 -- (-1130.308) (-1131.808) [-1130.676] (-1135.904) * (-1132.626) [-1130.615] (-1132.508) (-1130.305) -- 0:00:52
Average standard deviation of split frequencies: 0.011836
245500 -- (-1130.813) [-1129.387] (-1132.519) (-1131.601) * [-1130.092] (-1134.559) (-1131.884) (-1130.131) -- 0:00:52
246000 -- (-1131.349) [-1131.789] (-1130.282) (-1131.146) * [-1129.271] (-1133.444) (-1131.738) (-1129.816) -- 0:00:52
246500 -- (-1131.437) [-1130.775] (-1131.326) (-1135.071) * (-1131.421) (-1131.854) (-1131.557) [-1128.868] -- 0:00:51
247000 -- (-1130.658) [-1130.207] (-1130.928) (-1129.697) * (-1131.244) [-1133.970] (-1131.365) (-1131.193) -- 0:00:51
247500 -- (-1133.547) [-1131.599] (-1130.666) (-1132.141) * (-1131.953) [-1133.013] (-1131.321) (-1133.918) -- 0:00:51
248000 -- (-1131.563) [-1130.320] (-1131.182) (-1130.172) * (-1130.597) [-1130.350] (-1135.075) (-1131.264) -- 0:00:51
248500 -- (-1128.607) [-1132.767] (-1131.731) (-1130.500) * [-1130.484] (-1134.024) (-1131.350) (-1131.168) -- 0:00:51
249000 -- (-1130.175) (-1133.146) [-1132.947] (-1129.037) * [-1130.792] (-1135.251) (-1130.318) (-1131.214) -- 0:00:51
249500 -- (-1133.038) (-1133.022) (-1131.121) [-1128.190] * (-1131.144) [-1132.244] (-1130.801) (-1132.911) -- 0:00:51
250000 -- (-1133.871) (-1136.320) (-1129.177) [-1128.615] * (-1128.393) (-1130.926) (-1132.531) [-1132.283] -- 0:00:51
Average standard deviation of split frequencies: 0.010399
250500 -- (-1130.308) (-1130.897) [-1130.208] (-1130.811) * [-1130.406] (-1133.014) (-1132.815) (-1131.089) -- 0:00:50
251000 -- [-1130.890] (-1130.298) (-1131.652) (-1135.202) * (-1129.377) (-1130.322) [-1132.575] (-1129.368) -- 0:00:50
251500 -- (-1131.988) [-1132.231] (-1132.759) (-1130.724) * (-1130.734) [-1134.839] (-1130.748) (-1134.682) -- 0:00:50
252000 -- (-1130.872) (-1134.285) [-1134.105] (-1136.350) * [-1129.675] (-1135.541) (-1129.781) (-1132.963) -- 0:00:50
252500 -- (-1132.242) [-1133.071] (-1130.407) (-1138.774) * [-1133.241] (-1133.015) (-1129.800) (-1134.114) -- 0:00:50
253000 -- [-1129.701] (-1134.690) (-1131.757) (-1133.636) * (-1130.808) [-1133.032] (-1131.100) (-1132.229) -- 0:00:50
253500 -- [-1130.844] (-1134.924) (-1133.190) (-1133.957) * [-1133.806] (-1133.625) (-1132.472) (-1132.110) -- 0:00:50
254000 -- (-1128.322) (-1129.266) (-1133.723) [-1130.459] * [-1135.123] (-1133.457) (-1131.174) (-1130.388) -- 0:00:49
254500 -- [-1129.338] (-1129.137) (-1130.992) (-1130.163) * (-1134.379) [-1132.993] (-1128.990) (-1131.810) -- 0:00:49
255000 -- (-1130.452) (-1134.822) (-1130.141) [-1130.518] * (-1133.348) (-1135.263) [-1129.896] (-1133.551) -- 0:00:49
Average standard deviation of split frequencies: 0.010724
255500 -- (-1129.452) (-1130.557) (-1131.314) [-1130.797] * (-1132.416) (-1131.149) [-1131.680] (-1130.595) -- 0:00:49
256000 -- [-1130.729] (-1130.773) (-1133.083) (-1130.962) * (-1130.898) (-1130.663) [-1130.917] (-1130.064) -- 0:00:49
256500 -- (-1131.592) (-1129.846) [-1136.578] (-1130.022) * (-1133.212) (-1130.799) [-1132.380] (-1130.791) -- 0:00:49
257000 -- [-1129.194] (-1135.262) (-1131.564) (-1133.632) * (-1134.750) (-1131.302) [-1129.421] (-1132.644) -- 0:00:49
257500 -- (-1131.935) [-1131.383] (-1131.420) (-1134.079) * (-1131.321) (-1131.338) [-1130.433] (-1130.725) -- 0:00:49
258000 -- (-1130.921) (-1131.949) [-1129.860] (-1130.841) * (-1133.130) [-1131.843] (-1131.399) (-1131.501) -- 0:00:48
258500 -- (-1129.386) (-1131.278) [-1130.778] (-1131.688) * (-1131.044) (-1131.423) (-1134.638) [-1130.601] -- 0:00:48
259000 -- [-1129.375] (-1130.371) (-1133.468) (-1132.215) * (-1131.126) (-1135.375) (-1134.819) [-1131.116] -- 0:00:48
259500 -- (-1139.093) (-1130.537) [-1132.318] (-1131.860) * (-1131.850) (-1135.072) (-1136.256) [-1129.028] -- 0:00:48
260000 -- (-1132.315) [-1132.629] (-1137.231) (-1131.202) * (-1131.566) [-1133.884] (-1136.945) (-1128.975) -- 0:00:51
Average standard deviation of split frequencies: 0.010638
260500 -- [-1131.176] (-1131.347) (-1138.253) (-1130.873) * (-1132.350) (-1132.593) (-1133.570) [-1129.866] -- 0:00:51
261000 -- (-1134.562) [-1130.710] (-1132.546) (-1131.007) * (-1129.921) [-1131.343] (-1131.270) (-1128.787) -- 0:00:50
261500 -- (-1138.358) [-1132.173] (-1133.229) (-1130.356) * [-1129.561] (-1129.736) (-1131.688) (-1131.067) -- 0:00:50
262000 -- (-1132.840) (-1132.402) [-1129.202] (-1131.560) * (-1130.301) (-1133.028) [-1132.324] (-1131.946) -- 0:00:50
262500 -- [-1131.901] (-1129.978) (-1133.415) (-1133.251) * (-1128.298) (-1129.630) [-1131.036] (-1133.844) -- 0:00:50
263000 -- (-1129.456) (-1136.615) (-1132.241) [-1132.507] * (-1128.372) [-1131.641] (-1133.548) (-1132.000) -- 0:00:50
263500 -- (-1130.524) (-1135.273) (-1131.484) [-1132.291] * (-1128.917) [-1130.913] (-1132.689) (-1134.885) -- 0:00:50
264000 -- [-1132.218] (-1132.663) (-1135.771) (-1134.349) * [-1133.943] (-1131.553) (-1130.549) (-1135.587) -- 0:00:50
264500 -- (-1132.449) [-1133.532] (-1133.686) (-1134.622) * [-1130.729] (-1130.402) (-1130.651) (-1131.021) -- 0:00:50
265000 -- (-1131.287) (-1131.068) [-1133.194] (-1134.233) * [-1129.942] (-1131.524) (-1130.660) (-1135.627) -- 0:00:49
Average standard deviation of split frequencies: 0.010946
265500 -- (-1131.881) (-1133.417) (-1135.208) [-1133.827] * (-1131.043) (-1130.805) [-1132.734] (-1130.958) -- 0:00:49
266000 -- (-1129.510) [-1131.671] (-1133.650) (-1132.341) * (-1134.507) [-1131.248] (-1133.473) (-1130.371) -- 0:00:49
266500 -- [-1129.890] (-1130.737) (-1132.573) (-1132.149) * [-1131.115] (-1130.395) (-1133.211) (-1130.485) -- 0:00:49
267000 -- (-1133.186) [-1131.193] (-1129.713) (-1131.521) * (-1132.887) (-1131.239) (-1131.887) [-1129.064] -- 0:00:49
267500 -- (-1133.349) (-1132.196) [-1130.047] (-1134.007) * (-1134.053) [-1130.631] (-1131.306) (-1130.698) -- 0:00:49
268000 -- [-1132.287] (-1130.779) (-1130.827) (-1129.286) * (-1135.893) (-1131.746) (-1132.934) [-1132.602] -- 0:00:49
268500 -- (-1131.439) (-1133.267) (-1131.231) [-1128.581] * (-1132.167) (-1128.648) [-1130.420] (-1131.894) -- 0:00:49
269000 -- (-1131.245) (-1133.306) [-1130.504] (-1130.759) * (-1137.366) [-1131.699] (-1132.408) (-1134.838) -- 0:00:48
269500 -- (-1131.128) [-1132.071] (-1137.515) (-1131.488) * [-1132.803] (-1131.355) (-1130.497) (-1132.319) -- 0:00:48
270000 -- (-1132.822) (-1136.810) (-1137.496) [-1130.096] * (-1131.631) (-1130.601) [-1132.819] (-1132.087) -- 0:00:48
Average standard deviation of split frequencies: 0.010740
270500 -- [-1133.407] (-1128.663) (-1132.331) (-1133.431) * (-1131.386) [-1131.816] (-1133.195) (-1130.028) -- 0:00:48
271000 -- (-1130.762) (-1131.946) (-1135.707) [-1132.163] * [-1130.419] (-1132.975) (-1134.226) (-1128.908) -- 0:00:48
271500 -- (-1131.549) (-1134.732) (-1130.906) [-1132.893] * (-1130.809) (-1132.611) [-1134.551] (-1130.831) -- 0:00:48
272000 -- (-1130.196) (-1133.515) (-1132.819) [-1133.668] * [-1131.415] (-1133.182) (-1131.444) (-1130.666) -- 0:00:48
272500 -- (-1130.996) [-1130.942] (-1130.026) (-1131.886) * (-1130.687) (-1133.176) [-1132.660] (-1133.908) -- 0:00:48
273000 -- (-1133.946) (-1131.612) [-1131.457] (-1136.945) * [-1134.742] (-1131.427) (-1133.759) (-1128.743) -- 0:00:47
273500 -- (-1133.689) [-1133.395] (-1130.369) (-1131.694) * (-1130.051) (-1130.769) [-1132.810] (-1129.853) -- 0:00:47
274000 -- [-1131.018] (-1134.735) (-1133.593) (-1129.229) * (-1129.628) (-1131.724) (-1132.887) [-1131.029] -- 0:00:47
274500 -- (-1131.642) (-1131.502) (-1132.559) [-1129.162] * (-1133.558) [-1131.050] (-1135.827) (-1132.590) -- 0:00:47
275000 -- (-1134.469) (-1131.852) (-1135.577) [-1131.998] * [-1132.331] (-1128.920) (-1131.211) (-1130.844) -- 0:00:50
Average standard deviation of split frequencies: 0.011102
275500 -- (-1130.450) (-1136.513) (-1131.214) [-1131.301] * (-1131.815) (-1131.772) [-1132.634] (-1131.738) -- 0:00:49
276000 -- [-1132.635] (-1133.334) (-1141.148) (-1130.086) * (-1131.435) (-1130.218) [-1130.113] (-1132.303) -- 0:00:49
276500 -- (-1133.760) [-1130.790] (-1133.440) (-1130.842) * (-1132.396) [-1130.349] (-1131.379) (-1134.403) -- 0:00:49
277000 -- (-1130.959) [-1130.871] (-1128.792) (-1133.417) * (-1131.650) (-1134.465) (-1134.938) [-1136.034] -- 0:00:49
277500 -- [-1132.748] (-1130.500) (-1130.821) (-1132.369) * (-1131.261) (-1134.856) (-1130.466) [-1129.781] -- 0:00:49
278000 -- (-1131.323) (-1133.581) [-1129.882] (-1129.956) * (-1133.295) [-1130.295] (-1133.389) (-1128.893) -- 0:00:49
278500 -- (-1130.831) (-1132.863) [-1129.155] (-1130.152) * (-1133.030) (-1131.039) [-1130.690] (-1131.105) -- 0:00:49
279000 -- (-1137.309) (-1132.269) (-1131.424) [-1129.428] * [-1129.612] (-1129.668) (-1130.352) (-1131.099) -- 0:00:49
279500 -- (-1134.960) [-1130.785] (-1132.115) (-1131.252) * [-1130.542] (-1130.926) (-1130.207) (-1131.553) -- 0:00:48
280000 -- (-1133.499) (-1131.870) [-1129.924] (-1131.207) * (-1130.831) (-1135.625) [-1132.364] (-1130.500) -- 0:00:48
Average standard deviation of split frequencies: 0.011477
280500 -- (-1131.513) [-1131.021] (-1130.769) (-1134.340) * [-1129.914] (-1130.569) (-1138.661) (-1128.280) -- 0:00:48
281000 -- (-1132.001) (-1131.633) (-1132.092) [-1133.544] * (-1130.422) [-1133.011] (-1134.155) (-1133.005) -- 0:00:48
281500 -- [-1129.370] (-1129.719) (-1131.121) (-1134.798) * [-1130.182] (-1131.623) (-1136.019) (-1131.036) -- 0:00:48
282000 -- [-1130.879] (-1132.372) (-1131.155) (-1132.767) * (-1130.581) (-1132.950) [-1132.742] (-1131.596) -- 0:00:48
282500 -- (-1135.673) [-1130.739] (-1135.166) (-1137.648) * [-1130.911] (-1133.390) (-1130.021) (-1132.194) -- 0:00:48
283000 -- (-1133.511) (-1130.066) (-1131.709) [-1132.534] * (-1133.312) (-1131.228) (-1130.671) [-1129.737] -- 0:00:48
283500 -- [-1130.748] (-1130.254) (-1129.157) (-1131.916) * (-1132.259) (-1131.753) [-1129.333] (-1131.695) -- 0:00:48
284000 -- (-1130.805) [-1129.300] (-1134.614) (-1130.628) * (-1131.269) (-1130.183) (-1129.966) [-1132.870] -- 0:00:47
284500 -- (-1136.350) (-1131.787) [-1130.266] (-1130.208) * (-1130.692) (-1133.102) [-1131.751] (-1131.520) -- 0:00:47
285000 -- [-1133.933] (-1134.420) (-1133.763) (-1131.880) * (-1132.661) (-1132.482) (-1130.812) [-1132.419] -- 0:00:47
Average standard deviation of split frequencies: 0.011904
285500 -- (-1134.267) (-1132.444) [-1134.176] (-1133.293) * (-1132.493) (-1132.361) (-1130.634) [-1132.134] -- 0:00:47
286000 -- (-1132.807) (-1131.433) [-1130.559] (-1129.372) * [-1132.311] (-1132.353) (-1129.157) (-1133.826) -- 0:00:47
286500 -- (-1129.678) [-1130.770] (-1132.825) (-1131.976) * (-1132.782) (-1130.087) (-1130.604) [-1129.503] -- 0:00:47
287000 -- [-1134.964] (-1130.951) (-1133.756) (-1130.531) * (-1132.860) (-1130.526) (-1131.407) [-1129.482] -- 0:00:47
287500 -- [-1130.429] (-1130.044) (-1132.281) (-1134.215) * (-1132.940) [-1128.998] (-1129.620) (-1131.597) -- 0:00:47
288000 -- (-1129.573) (-1132.577) (-1132.245) [-1132.296] * [-1131.331] (-1130.645) (-1131.296) (-1129.359) -- 0:00:46
288500 -- (-1126.736) (-1130.383) (-1132.789) [-1130.170] * [-1130.715] (-1133.644) (-1129.543) (-1131.096) -- 0:00:46
289000 -- (-1130.623) [-1133.207] (-1127.355) (-1129.945) * (-1133.075) (-1132.460) [-1131.121] (-1130.025) -- 0:00:46
289500 -- [-1129.430] (-1132.466) (-1131.275) (-1129.855) * (-1133.571) [-1130.031] (-1132.751) (-1130.409) -- 0:00:46
290000 -- (-1133.222) (-1129.828) [-1132.313] (-1129.314) * [-1130.392] (-1128.335) (-1133.055) (-1132.599) -- 0:00:46
Average standard deviation of split frequencies: 0.012164
290500 -- [-1132.637] (-1131.556) (-1132.751) (-1130.183) * (-1130.886) [-1133.009] (-1133.650) (-1132.610) -- 0:00:48
291000 -- [-1128.117] (-1133.316) (-1132.672) (-1130.807) * [-1128.763] (-1131.375) (-1133.961) (-1132.125) -- 0:00:48
291500 -- (-1128.604) (-1136.668) [-1131.409] (-1132.423) * (-1131.274) (-1133.339) [-1132.947] (-1130.879) -- 0:00:48
292000 -- (-1130.961) (-1131.461) (-1130.287) [-1130.507] * (-1131.942) (-1133.876) [-1130.985] (-1133.669) -- 0:00:48
292500 -- (-1131.603) (-1130.679) [-1128.048] (-1130.147) * (-1133.331) (-1133.755) (-1130.656) [-1129.507] -- 0:00:48
293000 -- (-1131.830) (-1130.909) (-1130.498) [-1129.589] * (-1132.403) (-1133.803) (-1132.985) [-1133.929] -- 0:00:48
293500 -- (-1131.789) [-1129.741] (-1133.158) (-1131.686) * (-1131.116) (-1131.562) (-1132.936) [-1132.190] -- 0:00:48
294000 -- (-1131.101) (-1132.278) (-1134.574) [-1132.421] * (-1132.231) [-1131.454] (-1134.081) (-1131.416) -- 0:00:48
294500 -- (-1131.552) (-1129.864) (-1133.430) [-1131.759] * (-1130.296) [-1135.122] (-1141.767) (-1132.868) -- 0:00:47
295000 -- [-1130.006] (-1132.670) (-1131.603) (-1133.213) * (-1131.183) (-1136.944) (-1133.026) [-1130.275] -- 0:00:47
Average standard deviation of split frequencies: 0.011767
295500 -- (-1130.195) (-1129.946) [-1132.766] (-1132.576) * (-1133.503) (-1130.808) [-1131.961] (-1131.971) -- 0:00:47
296000 -- (-1132.904) (-1131.088) [-1132.894] (-1132.671) * (-1133.108) (-1133.706) (-1132.211) [-1130.302] -- 0:00:47
296500 -- (-1134.249) [-1129.332] (-1132.864) (-1131.291) * (-1131.035) [-1131.488] (-1132.229) (-1130.696) -- 0:00:47
297000 -- (-1130.878) (-1133.697) (-1131.825) [-1130.883] * (-1129.522) [-1131.609] (-1133.016) (-1132.403) -- 0:00:47
297500 -- (-1131.182) (-1129.771) (-1132.301) [-1133.435] * (-1130.847) (-1135.727) [-1132.013] (-1130.319) -- 0:00:47
298000 -- (-1131.537) [-1129.186] (-1133.145) (-1131.307) * [-1131.586] (-1131.538) (-1131.631) (-1129.121) -- 0:00:47
298500 -- [-1130.165] (-1134.284) (-1132.760) (-1131.282) * (-1131.857) (-1130.913) (-1133.740) [-1131.851] -- 0:00:47
299000 -- [-1132.215] (-1132.434) (-1130.775) (-1132.359) * (-1130.736) (-1133.564) (-1132.822) [-1132.307] -- 0:00:46
299500 -- (-1133.210) [-1129.764] (-1130.494) (-1131.294) * (-1134.822) (-1132.283) (-1132.368) [-1130.926] -- 0:00:46
300000 -- (-1128.562) (-1131.190) [-1131.573] (-1132.509) * (-1134.007) [-1131.812] (-1133.043) (-1129.588) -- 0:00:46
Average standard deviation of split frequencies: 0.011846
300500 -- (-1129.394) (-1137.230) [-1130.706] (-1132.161) * (-1131.757) (-1129.874) [-1130.715] (-1133.274) -- 0:00:46
301000 -- [-1128.582] (-1137.063) (-1131.711) (-1130.489) * (-1131.721) [-1130.456] (-1132.858) (-1133.106) -- 0:00:46
301500 -- [-1130.139] (-1135.481) (-1132.772) (-1130.348) * [-1131.086] (-1131.127) (-1133.112) (-1132.099) -- 0:00:46
302000 -- (-1129.820) (-1136.366) (-1132.557) [-1128.889] * (-1131.963) [-1130.135] (-1135.413) (-1132.304) -- 0:00:46
302500 -- (-1130.868) [-1135.313] (-1132.077) (-1129.275) * (-1130.679) (-1132.799) (-1134.675) [-1133.494] -- 0:00:46
303000 -- (-1133.335) [-1131.272] (-1132.235) (-1131.712) * (-1140.051) (-1130.607) (-1133.063) [-1130.633] -- 0:00:46
303500 -- (-1131.254) (-1136.627) (-1131.911) [-1131.285] * [-1133.873] (-1130.223) (-1136.320) (-1133.662) -- 0:00:45
304000 -- (-1130.627) (-1136.166) [-1132.025] (-1130.358) * (-1134.103) [-1132.236] (-1136.488) (-1133.375) -- 0:00:45
304500 -- (-1131.322) (-1130.051) (-1132.330) [-1129.816] * [-1131.853] (-1131.265) (-1133.050) (-1130.476) -- 0:00:45
305000 -- [-1130.412] (-1128.476) (-1132.353) (-1129.301) * (-1131.483) [-1132.239] (-1137.047) (-1133.802) -- 0:00:45
Average standard deviation of split frequencies: 0.011725
305500 -- (-1135.067) [-1130.148] (-1132.185) (-1133.036) * [-1131.528] (-1130.326) (-1132.081) (-1134.572) -- 0:00:47
306000 -- (-1137.147) [-1127.751] (-1131.702) (-1130.475) * [-1131.079] (-1130.381) (-1129.664) (-1136.085) -- 0:00:47
306500 -- (-1131.818) [-1128.698] (-1133.892) (-1128.884) * [-1130.737] (-1131.630) (-1128.839) (-1132.508) -- 0:00:47
307000 -- (-1131.872) (-1131.119) [-1134.480] (-1130.373) * [-1133.889] (-1132.704) (-1127.751) (-1130.372) -- 0:00:47
307500 -- (-1136.487) [-1130.793] (-1133.306) (-1133.544) * (-1130.924) (-1131.945) (-1131.040) [-1131.902] -- 0:00:47
308000 -- [-1131.223] (-1129.731) (-1131.825) (-1131.202) * [-1132.101] (-1131.582) (-1130.097) (-1131.641) -- 0:00:47
308500 -- (-1132.436) [-1129.921] (-1131.763) (-1132.131) * (-1135.061) [-1130.169] (-1132.051) (-1131.425) -- 0:00:47
309000 -- (-1131.462) (-1130.801) (-1132.544) [-1129.748] * (-1131.413) (-1134.772) (-1140.273) [-1131.944] -- 0:00:46
309500 -- (-1129.363) (-1129.838) [-1133.429] (-1133.638) * (-1131.239) (-1129.564) (-1135.032) [-1130.930] -- 0:00:46
310000 -- (-1130.871) (-1129.958) [-1131.123] (-1132.789) * (-1129.472) [-1129.928] (-1135.869) (-1130.445) -- 0:00:46
Average standard deviation of split frequencies: 0.010622
310500 -- [-1127.995] (-1130.335) (-1133.242) (-1130.263) * (-1136.021) [-1130.636] (-1127.901) (-1130.551) -- 0:00:46
311000 -- [-1129.306] (-1133.587) (-1132.569) (-1131.235) * (-1130.494) (-1130.853) [-1131.578] (-1131.483) -- 0:00:46
311500 -- (-1131.891) (-1133.631) [-1134.054] (-1131.804) * (-1133.399) (-1130.196) [-1131.595] (-1132.538) -- 0:00:46
312000 -- [-1130.380] (-1131.372) (-1131.736) (-1132.155) * (-1130.729) (-1129.343) [-1132.034] (-1132.638) -- 0:00:46
312500 -- [-1129.884] (-1130.007) (-1132.963) (-1131.656) * [-1131.999] (-1131.686) (-1129.905) (-1130.895) -- 0:00:46
313000 -- (-1129.559) [-1129.209] (-1132.305) (-1130.394) * (-1131.813) (-1135.257) (-1130.671) [-1134.617] -- 0:00:46
313500 -- [-1129.362] (-1132.996) (-1130.966) (-1131.671) * (-1132.023) [-1130.522] (-1132.468) (-1133.930) -- 0:00:45
314000 -- [-1129.115] (-1130.854) (-1128.954) (-1133.960) * (-1130.815) [-1130.600] (-1130.967) (-1130.581) -- 0:00:45
314500 -- (-1128.310) (-1133.231) (-1138.691) [-1133.246] * (-1134.585) (-1131.954) [-1136.920] (-1132.858) -- 0:00:45
315000 -- (-1129.242) (-1133.064) (-1132.901) [-1130.439] * (-1132.931) (-1133.863) (-1132.388) [-1131.422] -- 0:00:45
Average standard deviation of split frequencies: 0.010179
315500 -- [-1133.419] (-1132.699) (-1129.656) (-1132.546) * (-1130.605) (-1134.933) (-1129.103) [-1131.297] -- 0:00:45
316000 -- (-1128.510) [-1129.494] (-1131.116) (-1131.896) * (-1131.045) (-1129.508) (-1132.798) [-1132.123] -- 0:00:45
316500 -- [-1131.167] (-1134.172) (-1132.147) (-1131.568) * (-1131.349) (-1131.336) [-1132.024] (-1136.016) -- 0:00:45
317000 -- (-1129.974) (-1132.831) (-1131.241) [-1132.547] * (-1128.906) [-1129.546] (-1131.566) (-1133.877) -- 0:00:45
317500 -- (-1131.037) (-1130.134) (-1137.940) [-1137.224] * [-1129.375] (-1129.202) (-1134.612) (-1131.078) -- 0:00:45
318000 -- (-1132.316) (-1129.712) [-1129.389] (-1133.219) * (-1133.172) (-1129.478) [-1133.435] (-1130.731) -- 0:00:45
318500 -- (-1131.799) (-1129.946) (-1129.392) [-1129.780] * (-1135.608) [-1129.320] (-1136.606) (-1132.629) -- 0:00:44
319000 -- (-1131.988) (-1130.955) [-1130.310] (-1132.236) * (-1131.781) [-1129.904] (-1133.280) (-1133.261) -- 0:00:44
319500 -- (-1130.604) (-1130.507) (-1130.021) [-1135.488] * (-1130.310) (-1131.376) (-1129.991) [-1129.880] -- 0:00:44
320000 -- (-1130.258) (-1129.862) [-1130.953] (-1135.340) * (-1131.164) (-1130.665) [-1130.592] (-1133.320) -- 0:00:44
Average standard deviation of split frequencies: 0.010934
320500 -- (-1132.232) (-1129.922) [-1130.003] (-1135.814) * (-1132.639) (-1130.170) (-1131.563) [-1132.382] -- 0:00:46
321000 -- (-1133.681) (-1130.391) (-1129.906) [-1131.828] * [-1131.789] (-1131.627) (-1132.458) (-1129.510) -- 0:00:46
321500 -- [-1132.293] (-1131.469) (-1140.564) (-1133.803) * (-1131.842) [-1131.736] (-1134.209) (-1130.707) -- 0:00:46
322000 -- (-1129.204) (-1129.316) (-1132.502) [-1132.011] * [-1129.994] (-1132.139) (-1134.892) (-1131.866) -- 0:00:46
322500 -- (-1132.588) (-1127.892) [-1128.898] (-1130.809) * (-1133.324) (-1129.396) (-1132.886) [-1130.379] -- 0:00:46
323000 -- (-1130.981) (-1132.496) [-1131.143] (-1137.348) * (-1130.920) [-1128.741] (-1132.299) (-1131.333) -- 0:00:46
323500 -- [-1129.098] (-1129.298) (-1131.301) (-1129.423) * (-1130.527) [-1129.206] (-1133.271) (-1128.650) -- 0:00:46
324000 -- (-1133.773) (-1130.191) [-1132.575] (-1129.581) * (-1133.783) [-1129.805] (-1133.367) (-1130.253) -- 0:00:45
324500 -- (-1129.601) [-1132.881] (-1133.107) (-1131.406) * (-1133.427) (-1130.825) (-1131.020) [-1131.753] -- 0:00:45
325000 -- (-1135.524) [-1129.118] (-1132.655) (-1131.623) * [-1133.101] (-1129.266) (-1132.279) (-1130.678) -- 0:00:45
Average standard deviation of split frequencies: 0.011653
325500 -- (-1130.629) [-1129.722] (-1132.172) (-1131.719) * (-1131.950) (-1130.704) (-1133.007) [-1130.635] -- 0:00:45
326000 -- (-1131.933) (-1133.758) [-1130.181] (-1131.714) * [-1130.336] (-1131.983) (-1132.430) (-1129.853) -- 0:00:45
326500 -- (-1134.978) (-1131.251) [-1130.562] (-1131.875) * (-1131.988) (-1129.183) (-1134.106) [-1130.869] -- 0:00:45
327000 -- (-1131.634) [-1130.959] (-1130.532) (-1140.360) * (-1131.977) (-1134.208) (-1132.269) [-1130.427] -- 0:00:45
327500 -- (-1132.980) [-1132.167] (-1135.077) (-1136.932) * (-1131.691) (-1134.938) (-1130.354) [-1133.768] -- 0:00:45
328000 -- (-1131.821) [-1130.907] (-1134.334) (-1131.972) * (-1131.748) (-1134.254) (-1130.710) [-1128.247] -- 0:00:45
328500 -- [-1131.369] (-1132.118) (-1133.591) (-1131.961) * (-1134.700) [-1129.914] (-1137.152) (-1133.015) -- 0:00:44
329000 -- (-1130.783) (-1131.569) [-1131.519] (-1134.002) * [-1136.146] (-1131.456) (-1128.781) (-1130.552) -- 0:00:44
329500 -- (-1131.726) [-1129.319] (-1132.218) (-1131.452) * (-1134.541) (-1132.021) (-1130.715) [-1131.699] -- 0:00:44
330000 -- (-1129.386) (-1131.162) [-1136.165] (-1131.244) * (-1132.686) [-1133.583] (-1130.789) (-1129.631) -- 0:00:44
Average standard deviation of split frequencies: 0.010482
330500 -- (-1131.103) (-1130.392) (-1131.165) [-1133.818] * (-1131.094) [-1133.905] (-1130.293) (-1130.124) -- 0:00:44
331000 -- (-1135.707) (-1130.003) (-1135.131) [-1130.750] * (-1131.380) (-1132.506) [-1129.787] (-1130.949) -- 0:00:44
331500 -- (-1135.654) (-1130.727) [-1135.670] (-1131.498) * (-1133.200) (-1131.720) (-1131.177) [-1129.865] -- 0:00:44
332000 -- [-1134.419] (-1131.568) (-1133.911) (-1131.879) * (-1132.565) (-1132.363) [-1132.134] (-1130.706) -- 0:00:44
332500 -- (-1135.077) [-1132.441] (-1135.476) (-1132.164) * (-1130.842) [-1132.023] (-1130.814) (-1130.900) -- 0:00:44
333000 -- (-1133.062) (-1130.922) [-1132.211] (-1132.625) * (-1132.237) (-1128.386) (-1130.625) [-1131.006] -- 0:00:44
333500 -- (-1131.476) (-1131.438) [-1131.982] (-1131.955) * (-1135.129) (-1132.278) [-1130.262] (-1133.560) -- 0:00:43
334000 -- (-1132.184) [-1132.244] (-1131.770) (-1132.420) * (-1131.881) (-1132.794) (-1130.784) [-1131.265] -- 0:00:43
334500 -- (-1135.152) (-1132.216) [-1133.517] (-1131.170) * (-1131.044) [-1131.699] (-1133.235) (-1133.504) -- 0:00:43
335000 -- (-1131.595) (-1133.850) [-1127.772] (-1131.102) * (-1129.984) [-1131.096] (-1134.446) (-1131.096) -- 0:00:43
Average standard deviation of split frequencies: 0.009903
335500 -- (-1130.084) (-1133.821) (-1128.653) [-1129.678] * (-1130.568) [-1128.647] (-1131.237) (-1134.099) -- 0:00:43
336000 -- (-1131.452) (-1132.561) (-1129.876) [-1129.138] * (-1132.252) (-1131.174) (-1130.625) [-1132.053] -- 0:00:45
336500 -- (-1130.842) (-1130.590) (-1131.194) [-1132.268] * (-1130.574) [-1134.632] (-1131.026) (-1129.290) -- 0:00:45
337000 -- (-1132.045) (-1130.241) [-1131.575] (-1134.323) * (-1132.070) [-1131.403] (-1129.530) (-1129.401) -- 0:00:45
337500 -- (-1133.205) [-1128.693] (-1129.585) (-1132.626) * (-1131.246) [-1131.274] (-1131.411) (-1132.516) -- 0:00:45
338000 -- [-1130.764] (-1131.424) (-1132.333) (-1129.711) * [-1131.892] (-1130.740) (-1136.460) (-1129.991) -- 0:00:45
338500 -- [-1128.191] (-1132.122) (-1133.243) (-1129.500) * (-1130.498) (-1130.681) (-1131.092) [-1130.293] -- 0:00:44
339000 -- (-1130.643) [-1130.254] (-1128.137) (-1131.289) * [-1130.450] (-1130.548) (-1130.663) (-1128.075) -- 0:00:44
339500 -- (-1130.007) (-1130.097) [-1128.485] (-1130.926) * [-1131.891] (-1133.378) (-1131.408) (-1129.193) -- 0:00:44
340000 -- (-1133.976) [-1128.537] (-1132.167) (-1134.532) * (-1129.929) (-1132.925) (-1134.528) [-1128.323] -- 0:00:44
Average standard deviation of split frequencies: 0.010032
340500 -- (-1128.044) (-1131.007) [-1129.834] (-1140.551) * [-1130.629] (-1130.853) (-1135.703) (-1129.822) -- 0:00:44
341000 -- (-1129.527) (-1132.906) [-1131.174] (-1129.680) * [-1130.372] (-1131.963) (-1137.247) (-1130.086) -- 0:00:44
341500 -- [-1129.766] (-1134.939) (-1129.952) (-1133.075) * (-1130.800) (-1131.537) (-1133.445) [-1135.865] -- 0:00:44
342000 -- [-1130.920] (-1134.956) (-1132.603) (-1130.727) * (-1130.707) [-1132.681] (-1133.001) (-1132.172) -- 0:00:44
342500 -- [-1129.077] (-1130.861) (-1130.647) (-1131.386) * (-1134.561) (-1131.157) [-1129.597] (-1130.839) -- 0:00:44
343000 -- (-1130.921) [-1130.402] (-1130.500) (-1133.215) * (-1131.754) (-1132.267) (-1131.977) [-1129.791] -- 0:00:44
343500 -- [-1128.404] (-1132.241) (-1133.127) (-1132.330) * (-1133.190) (-1133.227) (-1129.977) [-1132.547] -- 0:00:43
344000 -- (-1132.015) [-1131.601] (-1131.604) (-1131.806) * (-1131.094) [-1131.665] (-1131.681) (-1131.699) -- 0:00:43
344500 -- (-1136.107) (-1129.734) [-1129.805] (-1132.870) * [-1133.684] (-1129.925) (-1128.160) (-1131.287) -- 0:00:43
345000 -- (-1135.653) (-1132.690) [-1131.383] (-1133.355) * [-1131.735] (-1130.719) (-1130.972) (-1130.583) -- 0:00:43
Average standard deviation of split frequencies: 0.009613
345500 -- (-1135.891) (-1130.030) (-1131.939) [-1133.428] * (-1136.472) [-1130.893] (-1132.227) (-1131.528) -- 0:00:43
346000 -- (-1134.412) (-1129.640) (-1130.813) [-1130.670] * (-1135.058) [-1132.112] (-1133.177) (-1128.646) -- 0:00:43
346500 -- [-1131.647] (-1129.698) (-1132.015) (-1131.457) * (-1133.009) (-1131.760) (-1135.552) [-1131.494] -- 0:00:43
347000 -- [-1134.281] (-1133.202) (-1130.254) (-1131.395) * [-1132.529] (-1131.014) (-1131.316) (-1131.195) -- 0:00:43
347500 -- (-1133.386) [-1129.158] (-1130.594) (-1130.561) * (-1134.027) (-1130.744) (-1132.715) [-1129.152] -- 0:00:43
348000 -- (-1135.406) [-1129.218] (-1130.537) (-1132.973) * (-1134.944) [-1130.688] (-1134.080) (-1130.084) -- 0:00:43
348500 -- (-1132.227) (-1135.481) (-1131.364) [-1132.468] * (-1132.992) (-1130.183) (-1131.431) [-1129.617] -- 0:00:42
349000 -- (-1134.821) (-1132.036) [-1130.181] (-1131.878) * [-1135.169] (-1134.989) (-1131.918) (-1131.926) -- 0:00:42
349500 -- (-1131.566) (-1130.248) (-1130.598) [-1129.742] * (-1135.213) [-1132.551] (-1132.185) (-1130.407) -- 0:00:42
350000 -- (-1131.461) [-1132.483] (-1132.980) (-1130.969) * (-1136.427) (-1131.226) (-1131.617) [-1128.920] -- 0:00:42
Average standard deviation of split frequencies: 0.010530
350500 -- (-1131.569) (-1132.126) [-1133.689] (-1132.570) * (-1136.435) [-1129.594] (-1130.746) (-1132.007) -- 0:00:42
351000 -- (-1136.780) (-1131.557) [-1133.026] (-1131.060) * (-1132.342) (-1131.607) (-1130.377) [-1130.133] -- 0:00:44
351500 -- (-1136.180) (-1130.693) [-1129.242] (-1130.991) * (-1132.579) (-1130.465) (-1131.118) [-1129.811] -- 0:00:44
352000 -- [-1132.204] (-1132.010) (-1131.239) (-1133.625) * (-1130.945) (-1130.650) [-1131.827] (-1131.292) -- 0:00:44
352500 -- (-1132.682) [-1130.202] (-1131.053) (-1130.971) * (-1131.962) [-1130.862] (-1133.171) (-1129.930) -- 0:00:44
353000 -- [-1131.991] (-1129.096) (-1131.156) (-1131.569) * (-1131.154) (-1131.060) (-1132.280) [-1129.412] -- 0:00:43
353500 -- (-1129.775) [-1127.001] (-1133.071) (-1131.561) * (-1130.694) (-1137.769) [-1135.454] (-1131.107) -- 0:00:43
354000 -- [-1132.087] (-1129.636) (-1134.866) (-1131.821) * [-1131.223] (-1133.291) (-1131.528) (-1130.252) -- 0:00:43
354500 -- (-1129.998) [-1129.478] (-1136.281) (-1131.037) * (-1130.870) (-1133.521) (-1135.269) [-1133.346] -- 0:00:43
355000 -- (-1132.984) (-1130.657) [-1132.639] (-1132.542) * (-1130.999) [-1134.963] (-1133.768) (-1130.874) -- 0:00:43
Average standard deviation of split frequencies: 0.010814
355500 -- (-1136.300) (-1129.621) [-1129.260] (-1136.351) * [-1131.804] (-1130.255) (-1131.859) (-1132.562) -- 0:00:43
356000 -- [-1131.842] (-1129.782) (-1133.076) (-1134.008) * (-1135.017) [-1128.550] (-1134.254) (-1131.956) -- 0:00:43
356500 -- (-1134.177) [-1132.061] (-1132.062) (-1133.382) * (-1133.930) (-1130.230) [-1132.340] (-1129.941) -- 0:00:43
357000 -- (-1128.792) (-1137.011) (-1133.013) [-1130.951] * (-1132.581) (-1131.256) (-1132.318) [-1128.643] -- 0:00:43
357500 -- [-1130.115] (-1133.903) (-1131.707) (-1130.991) * (-1134.077) (-1129.831) (-1132.629) [-1131.153] -- 0:00:43
358000 -- [-1134.015] (-1129.264) (-1129.633) (-1129.973) * (-1137.577) (-1129.098) (-1136.877) [-1128.321] -- 0:00:43
358500 -- (-1129.383) (-1130.333) (-1129.056) [-1130.267] * (-1133.227) (-1130.504) [-1132.304] (-1131.842) -- 0:00:42
359000 -- (-1130.836) [-1130.050] (-1130.706) (-1131.759) * (-1133.103) [-1129.392] (-1130.884) (-1132.337) -- 0:00:42
359500 -- [-1130.579] (-1132.996) (-1131.429) (-1130.176) * (-1134.344) (-1130.003) (-1134.888) [-1131.700] -- 0:00:42
360000 -- (-1130.996) (-1132.075) [-1129.743] (-1130.537) * (-1131.372) [-1129.038] (-1133.137) (-1130.154) -- 0:00:42
Average standard deviation of split frequencies: 0.011066
360500 -- [-1130.423] (-1132.823) (-1132.465) (-1132.558) * (-1132.940) (-1129.421) [-1131.124] (-1128.779) -- 0:00:42
361000 -- (-1128.498) (-1131.847) [-1132.424] (-1132.307) * (-1132.618) (-1129.274) [-1132.952] (-1132.099) -- 0:00:42
361500 -- (-1129.688) (-1129.110) [-1133.716] (-1134.281) * (-1131.870) (-1136.568) (-1132.406) [-1133.374] -- 0:00:42
362000 -- [-1129.232] (-1131.845) (-1130.556) (-1132.712) * [-1130.747] (-1132.337) (-1131.505) (-1131.517) -- 0:00:42
362500 -- [-1130.658] (-1131.871) (-1132.560) (-1133.049) * (-1130.514) (-1129.525) (-1137.475) [-1129.570] -- 0:00:42
363000 -- (-1132.921) [-1130.556] (-1133.143) (-1131.701) * (-1131.284) [-1130.327] (-1130.681) (-1131.962) -- 0:00:42
363500 -- (-1131.859) (-1130.251) (-1131.943) [-1130.998] * (-1134.540) (-1131.487) [-1130.859] (-1130.538) -- 0:00:42
364000 -- [-1129.831] (-1130.673) (-1130.941) (-1132.403) * (-1130.392) [-1130.479] (-1131.262) (-1132.186) -- 0:00:41
364500 -- (-1135.211) (-1133.061) (-1130.914) [-1132.272] * [-1130.956] (-1131.010) (-1130.773) (-1131.514) -- 0:00:41
365000 -- (-1132.689) [-1130.869] (-1131.193) (-1134.090) * (-1133.305) [-1133.034] (-1131.863) (-1131.281) -- 0:00:41
Average standard deviation of split frequencies: 0.011753
365500 -- (-1131.917) [-1134.846] (-1131.017) (-1132.854) * (-1131.216) (-1133.481) [-1130.789] (-1130.216) -- 0:00:41
366000 -- (-1130.444) (-1131.310) (-1130.703) [-1129.993] * [-1131.532] (-1134.636) (-1132.514) (-1133.597) -- 0:00:43
366500 -- (-1130.165) (-1132.207) [-1131.055] (-1133.815) * (-1130.828) (-1137.287) (-1131.686) [-1130.444] -- 0:00:43
367000 -- (-1133.659) (-1130.715) (-1132.390) [-1136.048] * [-1134.823] (-1131.722) (-1133.334) (-1131.246) -- 0:00:43
367500 -- (-1129.882) (-1131.888) [-1130.176] (-1130.753) * (-1129.621) (-1130.941) [-1131.500] (-1131.026) -- 0:00:43
368000 -- (-1130.175) [-1129.172] (-1135.745) (-1130.730) * (-1133.129) (-1133.576) (-1131.515) [-1129.739] -- 0:00:42
368500 -- (-1132.656) (-1131.198) [-1131.448] (-1130.810) * (-1131.490) [-1131.605] (-1133.619) (-1130.263) -- 0:00:42
369000 -- (-1130.382) [-1133.684] (-1132.870) (-1130.027) * (-1130.551) (-1134.238) [-1138.137] (-1133.010) -- 0:00:42
369500 -- (-1131.052) (-1131.223) [-1133.909] (-1129.598) * (-1130.628) (-1132.109) [-1131.892] (-1130.484) -- 0:00:42
370000 -- (-1130.007) (-1132.673) [-1131.061] (-1130.900) * (-1132.911) [-1134.803] (-1130.944) (-1129.334) -- 0:00:42
Average standard deviation of split frequencies: 0.012419
370500 -- (-1130.073) [-1132.865] (-1130.696) (-1132.868) * (-1131.980) (-1133.130) [-1132.405] (-1132.087) -- 0:00:42
371000 -- [-1133.454] (-1135.846) (-1134.202) (-1135.566) * (-1138.550) [-1130.311] (-1132.567) (-1134.724) -- 0:00:42
371500 -- [-1130.131] (-1129.504) (-1132.198) (-1134.874) * (-1132.831) (-1130.431) (-1133.163) [-1129.742] -- 0:00:42
372000 -- (-1132.284) (-1131.862) [-1132.235] (-1131.872) * (-1131.839) (-1131.125) [-1130.297] (-1134.187) -- 0:00:42
372500 -- (-1135.584) (-1139.406) [-1134.490] (-1132.236) * (-1132.104) (-1132.968) (-1135.361) [-1129.726] -- 0:00:42
373000 -- (-1134.842) (-1131.289) [-1128.807] (-1128.106) * (-1130.851) (-1130.828) [-1128.468] (-1131.716) -- 0:00:42
373500 -- (-1130.450) [-1129.059] (-1128.620) (-1132.914) * (-1130.041) (-1130.775) (-1128.535) [-1130.406] -- 0:00:41
374000 -- (-1130.239) (-1132.531) (-1130.457) [-1128.949] * (-1133.449) (-1129.029) [-1128.684] (-1131.561) -- 0:00:41
374500 -- (-1131.854) (-1130.047) [-1130.028] (-1129.253) * (-1130.931) (-1132.381) (-1130.775) [-1131.988] -- 0:00:41
375000 -- (-1130.020) [-1132.320] (-1133.954) (-1132.881) * (-1132.062) (-1131.616) [-1130.501] (-1135.523) -- 0:00:41
Average standard deviation of split frequencies: 0.012146
375500 -- [-1129.772] (-1133.464) (-1132.388) (-1132.433) * (-1132.146) (-1129.487) [-1131.295] (-1138.410) -- 0:00:41
376000 -- (-1127.854) (-1133.582) (-1130.517) [-1130.077] * (-1132.580) (-1129.519) [-1132.764] (-1131.987) -- 0:00:41
376500 -- (-1131.431) (-1132.953) [-1131.282] (-1129.871) * [-1130.407] (-1130.697) (-1129.355) (-1134.296) -- 0:00:41
377000 -- (-1132.357) (-1131.269) [-1131.661] (-1132.257) * [-1132.039] (-1130.710) (-1133.694) (-1132.206) -- 0:00:41
377500 -- (-1130.852) (-1134.035) (-1130.665) [-1129.390] * [-1132.796] (-1130.280) (-1134.363) (-1130.125) -- 0:00:41
378000 -- [-1128.011] (-1130.364) (-1133.855) (-1134.696) * (-1131.526) [-1130.682] (-1133.633) (-1135.296) -- 0:00:41
378500 -- (-1130.127) (-1130.634) [-1131.488] (-1132.791) * (-1132.038) [-1130.657] (-1133.656) (-1131.137) -- 0:00:41
379000 -- (-1133.517) (-1128.662) (-1132.944) [-1132.793] * (-1132.247) [-1135.296] (-1132.305) (-1134.454) -- 0:00:40
379500 -- (-1129.985) (-1129.455) (-1131.355) [-1132.714] * (-1133.094) (-1129.354) (-1130.904) [-1135.353] -- 0:00:40
380000 -- (-1133.433) (-1130.152) [-1131.228] (-1131.889) * [-1131.095] (-1131.406) (-1130.954) (-1132.718) -- 0:00:40
Average standard deviation of split frequencies: 0.013209
380500 -- (-1132.885) [-1130.102] (-1134.613) (-1134.998) * (-1133.780) [-1127.939] (-1133.628) (-1128.676) -- 0:00:40
381000 -- [-1129.971] (-1135.799) (-1130.678) (-1132.410) * (-1131.201) [-1132.081] (-1133.227) (-1132.372) -- 0:00:42
381500 -- [-1130.995] (-1133.872) (-1131.503) (-1130.671) * [-1131.757] (-1128.408) (-1130.457) (-1130.165) -- 0:00:42
382000 -- [-1133.218] (-1133.151) (-1131.749) (-1135.672) * (-1133.449) (-1134.349) [-1131.332] (-1132.268) -- 0:00:42
382500 -- [-1133.068] (-1130.892) (-1132.092) (-1132.406) * [-1129.376] (-1132.536) (-1130.611) (-1130.406) -- 0:00:41
383000 -- (-1132.866) (-1129.055) (-1132.318) [-1130.500] * (-1130.136) [-1129.478] (-1131.027) (-1134.103) -- 0:00:41
383500 -- (-1129.917) [-1130.928] (-1133.688) (-1133.809) * (-1130.873) (-1129.380) (-1131.585) [-1131.455] -- 0:00:41
384000 -- [-1130.890] (-1129.771) (-1133.097) (-1132.833) * [-1132.080] (-1131.994) (-1131.143) (-1129.879) -- 0:00:41
384500 -- (-1128.048) [-1128.967] (-1130.475) (-1133.246) * (-1131.666) (-1132.228) [-1129.481] (-1132.177) -- 0:00:41
385000 -- [-1130.614] (-1131.693) (-1132.169) (-1129.637) * [-1130.687] (-1132.504) (-1130.888) (-1132.786) -- 0:00:41
Average standard deviation of split frequencies: 0.013271
385500 -- [-1130.471] (-1131.451) (-1135.220) (-1132.056) * (-1129.500) [-1137.420] (-1130.640) (-1130.275) -- 0:00:41
386000 -- (-1132.501) (-1135.758) [-1133.459] (-1133.058) * (-1131.420) (-1128.099) (-1129.395) [-1132.200] -- 0:00:41
386500 -- (-1132.435) (-1132.554) [-1131.591] (-1135.547) * (-1131.388) (-1131.020) [-1127.842] (-1131.979) -- 0:00:41
387000 -- (-1133.628) [-1128.432] (-1131.435) (-1135.624) * (-1133.850) (-1130.882) (-1129.865) [-1130.621] -- 0:00:41
387500 -- (-1130.659) (-1133.554) [-1130.196] (-1131.481) * (-1133.607) (-1134.244) [-1131.281] (-1129.914) -- 0:00:41
388000 -- (-1129.875) [-1132.350] (-1133.853) (-1129.531) * (-1132.160) (-1131.828) [-1134.273] (-1129.969) -- 0:00:41
388500 -- [-1130.644] (-1136.913) (-1141.093) (-1133.285) * [-1131.142] (-1128.654) (-1131.112) (-1132.472) -- 0:00:40
389000 -- (-1131.913) [-1131.060] (-1131.267) (-1130.865) * (-1132.444) [-1129.519] (-1132.263) (-1131.455) -- 0:00:40
389500 -- (-1130.842) (-1131.556) (-1131.076) [-1131.201] * (-1132.908) (-1132.626) (-1132.347) [-1132.458] -- 0:00:40
390000 -- (-1130.694) (-1138.499) (-1132.394) [-1130.864] * (-1132.629) (-1130.244) (-1130.782) [-1142.341] -- 0:00:40
Average standard deviation of split frequencies: 0.013434
390500 -- (-1132.390) [-1130.964] (-1130.899) (-1133.384) * (-1133.437) (-1131.653) [-1129.585] (-1134.757) -- 0:00:40
391000 -- (-1135.061) (-1130.405) (-1131.676) [-1130.580] * (-1131.462) (-1133.676) [-1131.222] (-1137.338) -- 0:00:40
391500 -- [-1131.358] (-1131.126) (-1131.545) (-1132.118) * (-1131.156) [-1129.391] (-1130.982) (-1131.273) -- 0:00:40
392000 -- (-1132.265) [-1131.741] (-1132.417) (-1136.071) * (-1131.055) (-1133.779) [-1130.030] (-1132.958) -- 0:00:40
392500 -- (-1131.751) (-1135.109) [-1132.963] (-1133.305) * (-1130.112) [-1131.714] (-1131.246) (-1133.014) -- 0:00:40
393000 -- (-1130.717) (-1131.709) [-1133.786] (-1131.481) * (-1132.207) [-1133.338] (-1131.424) (-1132.919) -- 0:00:40
393500 -- (-1132.009) (-1132.037) [-1130.124] (-1129.533) * (-1132.206) (-1133.053) (-1128.556) [-1128.103] -- 0:00:40
394000 -- (-1131.610) (-1133.081) (-1132.633) [-1131.642] * [-1130.064] (-1132.538) (-1128.678) (-1130.702) -- 0:00:39
394500 -- (-1131.322) [-1129.619] (-1130.426) (-1130.469) * [-1129.803] (-1134.202) (-1130.303) (-1129.774) -- 0:00:39
395000 -- (-1132.002) [-1129.731] (-1134.094) (-1132.773) * [-1129.010] (-1128.959) (-1128.507) (-1134.246) -- 0:00:39
Average standard deviation of split frequencies: 0.014206
395500 -- (-1131.080) [-1130.220] (-1132.330) (-1133.269) * (-1130.829) (-1134.852) [-1128.566] (-1134.997) -- 0:00:39
396000 -- [-1131.224] (-1129.641) (-1129.751) (-1134.441) * (-1131.788) [-1129.079] (-1130.752) (-1133.187) -- 0:00:39
396500 -- (-1132.194) [-1132.635] (-1129.113) (-1134.709) * [-1131.346] (-1130.421) (-1130.475) (-1137.690) -- 0:00:41
397000 -- (-1132.039) (-1131.258) [-1129.520] (-1132.474) * (-1130.734) (-1132.193) (-1130.971) [-1132.371] -- 0:00:41
397500 -- (-1131.332) (-1128.151) [-1127.846] (-1131.389) * (-1131.098) [-1131.668] (-1129.170) (-1130.385) -- 0:00:40
398000 -- (-1130.642) [-1130.940] (-1128.252) (-1131.296) * (-1131.060) (-1128.452) [-1129.131] (-1131.551) -- 0:00:40
398500 -- (-1130.974) (-1129.480) [-1128.508] (-1131.268) * (-1130.891) [-1127.387] (-1132.610) (-1132.690) -- 0:00:40
399000 -- (-1131.382) (-1131.704) [-1129.489] (-1130.381) * (-1133.159) [-1131.964] (-1130.547) (-1131.764) -- 0:00:40
399500 -- (-1131.318) (-1136.371) [-1128.739] (-1131.276) * (-1133.064) [-1130.571] (-1128.350) (-1133.889) -- 0:00:40
400000 -- (-1134.419) (-1130.958) [-1128.723] (-1133.924) * (-1131.134) [-1130.798] (-1131.870) (-1133.003) -- 0:00:40
Average standard deviation of split frequencies: 0.014275
400500 -- (-1134.186) (-1129.752) [-1130.973] (-1134.816) * (-1131.435) (-1133.874) [-1130.075] (-1131.486) -- 0:00:40
401000 -- (-1134.531) (-1129.338) (-1132.953) [-1129.840] * (-1132.366) (-1131.271) [-1129.714] (-1131.744) -- 0:00:40
401500 -- (-1133.767) [-1131.024] (-1135.509) (-1132.227) * (-1130.349) [-1129.085] (-1128.116) (-1132.521) -- 0:00:40
402000 -- [-1134.048] (-1132.938) (-1129.876) (-1136.544) * [-1130.350] (-1128.781) (-1130.904) (-1132.574) -- 0:00:40
402500 -- (-1130.601) [-1132.607] (-1130.236) (-1132.085) * (-1131.548) [-1130.462] (-1135.923) (-1132.037) -- 0:00:40
403000 -- [-1130.164] (-1131.221) (-1131.687) (-1131.002) * (-1133.054) (-1131.669) (-1129.853) [-1132.340] -- 0:00:39
403500 -- (-1132.300) [-1128.385] (-1130.527) (-1131.045) * (-1133.667) (-1136.924) [-1129.715] (-1130.136) -- 0:00:39
404000 -- (-1131.741) [-1131.432] (-1131.099) (-1133.226) * (-1129.869) (-1134.321) [-1129.299] (-1131.415) -- 0:00:39
404500 -- [-1133.030] (-1131.780) (-1129.100) (-1131.578) * [-1136.030] (-1131.869) (-1129.422) (-1130.781) -- 0:00:39
405000 -- [-1131.165] (-1132.119) (-1130.464) (-1131.676) * (-1135.854) (-1130.131) (-1135.065) [-1131.305] -- 0:00:39
Average standard deviation of split frequencies: 0.014785
405500 -- [-1132.778] (-1131.113) (-1130.866) (-1133.950) * (-1132.445) [-1133.551] (-1136.646) (-1130.344) -- 0:00:39
406000 -- (-1132.380) [-1130.782] (-1133.407) (-1133.596) * (-1129.354) (-1132.209) [-1129.761] (-1131.041) -- 0:00:39
406500 -- (-1134.395) (-1133.038) [-1130.603] (-1131.815) * (-1131.463) (-1131.796) [-1128.693] (-1131.079) -- 0:00:39
407000 -- (-1131.902) (-1131.172) (-1132.688) [-1133.925] * (-1129.897) (-1133.467) (-1130.529) [-1130.342] -- 0:00:39
407500 -- [-1131.643] (-1133.804) (-1132.360) (-1133.361) * (-1132.965) (-1130.760) [-1130.880] (-1131.011) -- 0:00:39
408000 -- (-1131.140) (-1133.150) (-1132.332) [-1129.608] * (-1133.657) (-1131.210) (-1131.775) [-1132.769] -- 0:00:39
408500 -- (-1129.472) [-1128.112] (-1132.454) (-1134.680) * [-1133.441] (-1130.570) (-1130.086) (-1130.831) -- 0:00:39
409000 -- (-1130.233) (-1133.209) [-1133.240] (-1129.727) * (-1130.767) (-1130.954) [-1132.779] (-1132.830) -- 0:00:39
409500 -- (-1128.549) (-1131.249) [-1134.841] (-1132.431) * (-1132.232) [-1133.073] (-1130.566) (-1134.216) -- 0:00:38
410000 -- [-1131.447] (-1130.156) (-1135.087) (-1131.429) * (-1133.243) (-1129.202) (-1131.261) [-1131.616] -- 0:00:38
Average standard deviation of split frequencies: 0.014464
410500 -- (-1130.288) (-1132.393) (-1131.541) [-1132.043] * (-1130.954) (-1132.295) [-1133.676] (-1132.520) -- 0:00:38
411000 -- (-1130.555) [-1131.788] (-1131.492) (-1134.684) * (-1132.888) (-1130.229) [-1131.360] (-1130.601) -- 0:00:38
411500 -- (-1134.571) (-1133.487) (-1130.738) [-1132.394] * (-1139.332) (-1130.820) (-1132.304) [-1130.673] -- 0:00:40
412000 -- [-1132.020] (-1133.217) (-1130.980) (-1131.997) * (-1130.245) (-1130.221) (-1138.225) [-1130.853] -- 0:00:39
412500 -- (-1131.299) [-1130.529] (-1129.772) (-1131.884) * (-1131.864) (-1128.632) [-1131.155] (-1133.992) -- 0:00:39
413000 -- (-1128.869) [-1130.257] (-1131.953) (-1132.652) * (-1134.130) (-1130.697) [-1131.865] (-1129.648) -- 0:00:39
413500 -- (-1131.628) (-1132.011) [-1131.161] (-1130.815) * (-1129.772) (-1129.000) [-1127.719] (-1133.327) -- 0:00:39
414000 -- (-1132.252) (-1132.324) [-1131.811] (-1133.244) * [-1128.189] (-1129.572) (-1128.640) (-1128.008) -- 0:00:39
414500 -- (-1133.539) (-1129.588) (-1130.715) [-1131.791] * (-1130.141) [-1128.488] (-1129.234) (-1130.550) -- 0:00:39
415000 -- (-1131.631) [-1130.204] (-1130.527) (-1130.331) * (-1130.667) (-1131.184) (-1127.945) [-1135.594] -- 0:00:39
Average standard deviation of split frequencies: 0.013674
415500 -- (-1131.704) (-1132.590) [-1131.250] (-1132.317) * [-1130.811] (-1132.089) (-1130.159) (-1135.868) -- 0:00:39
416000 -- (-1131.244) [-1129.000] (-1131.849) (-1131.011) * (-1130.769) [-1129.529] (-1138.643) (-1133.024) -- 0:00:39
416500 -- (-1132.093) (-1132.942) (-1131.067) [-1129.813] * (-1131.692) (-1132.857) [-1131.519] (-1131.953) -- 0:00:39
417000 -- (-1131.494) (-1132.643) (-1130.994) [-1131.523] * [-1131.389] (-1131.143) (-1133.525) (-1131.732) -- 0:00:39
417500 -- (-1128.715) (-1131.509) [-1132.167] (-1131.715) * (-1131.076) (-1131.200) (-1130.746) [-1132.173] -- 0:00:39
418000 -- (-1132.333) (-1132.271) [-1131.123] (-1130.483) * (-1131.838) (-1129.958) [-1129.831] (-1132.367) -- 0:00:38
418500 -- [-1130.526] (-1134.374) (-1130.786) (-1133.945) * (-1133.102) (-1130.203) [-1130.340] (-1128.946) -- 0:00:38
419000 -- [-1130.089] (-1131.357) (-1133.379) (-1130.746) * (-1134.271) (-1131.023) (-1128.002) [-1131.284] -- 0:00:38
419500 -- [-1132.982] (-1131.191) (-1132.792) (-1130.727) * (-1133.830) [-1130.385] (-1128.642) (-1129.244) -- 0:00:38
420000 -- (-1131.403) [-1130.382] (-1135.884) (-1128.963) * (-1130.213) (-1131.995) (-1138.316) [-1129.944] -- 0:00:38
Average standard deviation of split frequencies: 0.014045
420500 -- (-1129.124) [-1131.995] (-1134.209) (-1131.432) * (-1130.101) (-1132.760) (-1134.991) [-1131.435] -- 0:00:38
421000 -- (-1131.251) (-1130.770) [-1130.589] (-1133.032) * [-1131.632] (-1133.324) (-1131.215) (-1130.718) -- 0:00:38
421500 -- (-1135.529) (-1130.860) (-1132.710) [-1129.191] * (-1135.005) (-1130.915) (-1131.165) [-1130.456] -- 0:00:38
422000 -- (-1136.337) (-1131.668) (-1131.854) [-1130.220] * (-1132.341) [-1132.805] (-1129.419) (-1130.537) -- 0:00:38
422500 -- [-1132.224] (-1132.840) (-1134.935) (-1134.911) * (-1132.736) (-1131.543) (-1129.120) [-1133.120] -- 0:00:38
423000 -- [-1133.054] (-1131.598) (-1130.301) (-1131.820) * (-1136.453) (-1131.522) (-1130.695) [-1138.611] -- 0:00:38
423500 -- [-1130.672] (-1129.241) (-1129.960) (-1132.458) * [-1136.959] (-1136.481) (-1133.341) (-1132.932) -- 0:00:38
424000 -- (-1131.213) (-1132.971) [-1131.324] (-1132.244) * (-1133.891) (-1131.378) [-1134.756] (-1127.694) -- 0:00:38
424500 -- [-1132.615] (-1130.847) (-1130.676) (-1135.034) * [-1131.920] (-1132.050) (-1133.952) (-1127.907) -- 0:00:37
425000 -- (-1134.456) (-1131.922) (-1130.680) [-1129.874] * [-1128.595] (-1134.576) (-1130.713) (-1129.364) -- 0:00:37
Average standard deviation of split frequencies: 0.014040
425500 -- (-1131.245) (-1132.285) (-1132.218) [-1130.646] * (-1132.504) (-1133.448) (-1130.210) [-1133.014] -- 0:00:37
426000 -- [-1133.456] (-1129.929) (-1132.237) (-1133.427) * [-1132.051] (-1130.986) (-1130.735) (-1131.533) -- 0:00:37
426500 -- (-1130.801) [-1129.639] (-1131.525) (-1133.779) * (-1132.727) (-1130.896) (-1131.652) [-1130.638] -- 0:00:38
427000 -- [-1131.391] (-1133.685) (-1130.021) (-1131.502) * [-1128.526] (-1131.193) (-1130.347) (-1131.295) -- 0:00:38
427500 -- [-1130.637] (-1133.457) (-1132.785) (-1131.147) * (-1135.482) (-1132.467) (-1132.421) [-1131.191] -- 0:00:38
428000 -- (-1131.209) (-1131.749) [-1132.499] (-1130.512) * (-1133.194) [-1134.249] (-1132.885) (-1129.893) -- 0:00:38
428500 -- [-1131.004] (-1130.807) (-1131.989) (-1128.745) * (-1133.159) (-1131.542) [-1131.981] (-1130.634) -- 0:00:38
429000 -- (-1132.413) [-1129.890] (-1130.436) (-1134.736) * [-1132.465] (-1131.272) (-1131.166) (-1130.388) -- 0:00:38
429500 -- (-1130.666) [-1131.939] (-1131.597) (-1130.581) * (-1132.600) [-1131.579] (-1136.390) (-1129.986) -- 0:00:38
430000 -- (-1130.738) (-1128.976) (-1132.584) [-1133.012] * (-1129.950) (-1130.285) [-1131.222] (-1132.554) -- 0:00:38
Average standard deviation of split frequencies: 0.014522
430500 -- (-1131.288) (-1132.262) (-1128.982) [-1131.696] * (-1130.072) [-1133.064] (-1131.491) (-1133.290) -- 0:00:38
431000 -- (-1133.088) (-1129.870) (-1129.204) [-1134.323] * (-1131.052) (-1131.353) [-1131.192] (-1132.153) -- 0:00:38
431500 -- (-1130.670) [-1130.239] (-1130.949) (-1133.518) * (-1130.614) [-1130.094] (-1132.150) (-1133.142) -- 0:00:38
432000 -- (-1131.340) (-1130.741) (-1128.513) [-1130.312] * [-1132.503] (-1131.621) (-1133.922) (-1133.110) -- 0:00:38
432500 -- (-1129.648) (-1130.624) (-1132.804) [-1129.800] * (-1130.401) (-1131.462) [-1131.261] (-1130.451) -- 0:00:38
433000 -- (-1130.672) (-1130.851) [-1131.075] (-1129.730) * (-1135.448) [-1128.995] (-1132.155) (-1130.045) -- 0:00:37
433500 -- (-1131.068) (-1130.823) (-1131.888) [-1129.009] * [-1133.266] (-1140.560) (-1131.944) (-1130.757) -- 0:00:37
434000 -- [-1134.951] (-1134.686) (-1134.318) (-1131.807) * (-1134.227) [-1132.386] (-1131.152) (-1129.374) -- 0:00:37
434500 -- [-1132.559] (-1134.057) (-1132.616) (-1135.995) * (-1130.941) (-1129.863) [-1133.639] (-1131.471) -- 0:00:37
435000 -- (-1130.855) (-1134.957) [-1132.461] (-1132.773) * (-1131.623) [-1131.561] (-1131.629) (-1133.292) -- 0:00:37
Average standard deviation of split frequencies: 0.013801
435500 -- (-1132.035) (-1130.151) [-1129.945] (-1131.804) * (-1130.688) (-1129.879) [-1130.629] (-1133.336) -- 0:00:37
436000 -- (-1136.021) (-1131.728) (-1131.950) [-1132.392] * (-1129.331) (-1131.851) [-1131.445] (-1131.211) -- 0:00:37
436500 -- [-1130.142] (-1131.549) (-1130.328) (-1132.888) * (-1129.327) (-1136.077) (-1135.361) [-1130.618] -- 0:00:37
437000 -- (-1133.003) (-1133.918) (-1134.581) [-1131.212] * [-1128.426] (-1130.509) (-1133.054) (-1136.357) -- 0:00:37
437500 -- [-1132.608] (-1133.196) (-1131.907) (-1135.557) * (-1130.327) [-1131.698] (-1129.806) (-1133.482) -- 0:00:37
438000 -- (-1128.460) (-1135.791) [-1129.980] (-1134.161) * (-1131.286) (-1129.382) (-1131.370) [-1129.994] -- 0:00:37
438500 -- [-1130.496] (-1129.753) (-1134.257) (-1130.829) * (-1132.773) (-1129.474) (-1133.640) [-1133.117] -- 0:00:37
439000 -- [-1130.807] (-1130.799) (-1130.254) (-1134.339) * (-1131.519) (-1135.317) (-1140.961) [-1131.410] -- 0:00:37
439500 -- (-1130.410) (-1136.541) [-1131.557] (-1136.596) * (-1133.871) (-1132.609) (-1133.339) [-1132.076] -- 0:00:36
440000 -- (-1132.202) (-1132.854) [-1134.560] (-1131.084) * (-1132.228) [-1131.908] (-1132.332) (-1136.597) -- 0:00:36
Average standard deviation of split frequencies: 0.012694
440500 -- [-1132.343] (-1130.660) (-1131.605) (-1130.229) * (-1134.202) [-1130.128] (-1133.466) (-1132.060) -- 0:00:36
441000 -- [-1130.677] (-1129.318) (-1131.275) (-1127.382) * [-1129.857] (-1130.789) (-1131.719) (-1133.711) -- 0:00:36
441500 -- (-1132.295) (-1131.200) [-1130.878] (-1130.634) * (-1131.524) (-1130.005) (-1134.797) [-1130.611] -- 0:00:36
442000 -- [-1133.353] (-1129.866) (-1133.341) (-1129.457) * (-1130.800) [-1131.355] (-1133.998) (-1130.906) -- 0:00:37
442500 -- (-1131.720) [-1130.234] (-1135.158) (-1133.411) * (-1133.035) (-1131.233) [-1128.633] (-1130.942) -- 0:00:37
443000 -- (-1133.700) (-1131.129) (-1130.948) [-1132.182] * [-1130.378] (-1130.826) (-1130.249) (-1133.667) -- 0:00:37
443500 -- [-1131.952] (-1130.573) (-1130.293) (-1130.718) * (-1135.663) (-1131.076) [-1130.316] (-1132.489) -- 0:00:37
444000 -- (-1131.422) (-1133.450) [-1130.104] (-1132.091) * (-1136.246) (-1134.662) (-1130.374) [-1133.159] -- 0:00:37
444500 -- (-1132.478) (-1135.242) [-1132.087] (-1136.378) * (-1132.417) (-1133.313) [-1130.811] (-1132.169) -- 0:00:37
445000 -- (-1132.102) [-1130.873] (-1129.422) (-1135.202) * [-1133.036] (-1132.883) (-1132.059) (-1133.656) -- 0:00:37
Average standard deviation of split frequencies: 0.012419
445500 -- [-1129.788] (-1133.842) (-1135.334) (-1133.174) * (-1130.743) (-1132.005) [-1129.076] (-1131.084) -- 0:00:37
446000 -- (-1132.628) [-1132.151] (-1130.361) (-1132.015) * (-1129.837) (-1130.785) (-1130.623) [-1130.745] -- 0:00:37
446500 -- [-1131.432] (-1133.994) (-1130.416) (-1130.023) * (-1131.035) (-1132.436) [-1129.407] (-1131.632) -- 0:00:37
447000 -- (-1132.044) (-1130.813) (-1129.416) [-1131.341] * (-1135.323) (-1133.781) (-1130.915) [-1130.687] -- 0:00:37
447500 -- [-1129.253] (-1136.137) (-1130.971) (-1130.904) * (-1132.573) (-1131.381) (-1130.586) [-1127.664] -- 0:00:37
448000 -- (-1129.098) (-1128.891) [-1130.327] (-1131.376) * (-1133.540) [-1131.126] (-1130.376) (-1131.140) -- 0:00:36
448500 -- (-1130.439) [-1132.602] (-1133.905) (-1131.185) * (-1131.806) (-1130.635) (-1130.222) [-1132.003] -- 0:00:36
449000 -- [-1129.528] (-1136.004) (-1130.734) (-1130.073) * (-1131.550) (-1134.568) [-1132.731] (-1134.589) -- 0:00:36
449500 -- (-1141.292) [-1128.481] (-1131.479) (-1130.058) * (-1132.245) [-1131.929] (-1131.423) (-1132.540) -- 0:00:36
450000 -- (-1133.490) (-1128.273) [-1131.823] (-1130.066) * (-1129.894) (-1130.723) [-1131.669] (-1132.827) -- 0:00:36
Average standard deviation of split frequencies: 0.012761
450500 -- (-1135.449) (-1130.427) (-1134.454) [-1129.131] * (-1133.399) (-1132.070) [-1131.839] (-1130.822) -- 0:00:36
451000 -- (-1129.956) [-1131.852] (-1137.834) (-1127.583) * [-1128.935] (-1130.481) (-1134.718) (-1128.893) -- 0:00:36
451500 -- (-1132.360) [-1129.626] (-1132.436) (-1132.861) * [-1132.740] (-1131.204) (-1132.511) (-1134.696) -- 0:00:36
452000 -- [-1128.503] (-1128.834) (-1131.555) (-1130.954) * (-1132.913) (-1128.152) (-1131.210) [-1131.201] -- 0:00:36
452500 -- [-1130.514] (-1130.443) (-1128.392) (-1131.426) * [-1132.577] (-1128.460) (-1129.884) (-1131.043) -- 0:00:36
453000 -- (-1130.815) (-1130.947) [-1130.385] (-1129.883) * (-1129.870) (-1131.408) (-1130.453) [-1128.799] -- 0:00:36
453500 -- (-1130.290) (-1129.478) (-1132.053) [-1129.862] * (-1135.006) (-1130.629) [-1131.024] (-1131.167) -- 0:00:36
454000 -- (-1134.852) [-1132.634] (-1128.876) (-1130.843) * (-1130.322) (-1129.985) (-1131.244) [-1132.073] -- 0:00:36
454500 -- (-1129.983) (-1133.859) [-1131.778] (-1130.995) * [-1128.275] (-1133.962) (-1132.553) (-1129.171) -- 0:00:36
455000 -- (-1129.670) (-1130.781) [-1131.355] (-1130.052) * (-1131.174) (-1130.209) (-1132.636) [-1131.062] -- 0:00:35
Average standard deviation of split frequencies: 0.013310
455500 -- (-1133.104) (-1131.970) (-1130.106) [-1129.147] * (-1129.684) (-1129.080) (-1134.558) [-1130.275] -- 0:00:35
456000 -- [-1133.044] (-1132.217) (-1130.151) (-1130.456) * (-1131.805) (-1130.116) [-1133.097] (-1130.909) -- 0:00:35
456500 -- (-1133.019) [-1132.210] (-1128.892) (-1136.457) * (-1135.496) (-1132.133) (-1135.658) [-1131.984] -- 0:00:35
457000 -- (-1133.944) (-1132.915) (-1142.660) [-1133.538] * (-1132.718) [-1130.579] (-1130.329) (-1130.443) -- 0:00:35
457500 -- (-1132.335) [-1127.998] (-1132.143) (-1131.082) * (-1131.255) [-1133.895] (-1130.272) (-1131.926) -- 0:00:36
458000 -- (-1130.738) (-1132.363) (-1137.125) [-1131.221] * (-1130.546) (-1131.782) (-1130.133) [-1129.784] -- 0:00:36
458500 -- (-1132.084) (-1130.808) (-1137.262) [-1129.713] * (-1132.443) [-1130.857] (-1130.543) (-1128.088) -- 0:00:36
459000 -- (-1132.333) [-1129.544] (-1131.763) (-1130.076) * (-1133.800) (-1133.279) [-1130.954] (-1131.276) -- 0:00:36
459500 -- (-1131.153) [-1131.750] (-1131.204) (-1134.052) * (-1131.492) (-1132.069) (-1130.717) [-1128.881] -- 0:00:36
460000 -- (-1134.525) [-1131.952] (-1131.570) (-1135.480) * (-1130.979) (-1132.162) [-1134.649] (-1133.000) -- 0:00:36
Average standard deviation of split frequencies: 0.013687
460500 -- (-1132.955) (-1134.267) (-1130.109) [-1135.083] * [-1130.296] (-1133.893) (-1131.114) (-1131.794) -- 0:00:36
461000 -- (-1129.931) (-1131.513) [-1128.866] (-1132.962) * (-1130.686) (-1131.016) (-1132.456) [-1131.835] -- 0:00:36
461500 -- (-1128.401) (-1129.619) (-1131.733) [-1130.015] * (-1131.684) [-1133.806] (-1134.921) (-1128.753) -- 0:00:36
462000 -- [-1133.187] (-1130.884) (-1130.908) (-1131.400) * (-1131.506) (-1132.488) [-1134.923] (-1130.953) -- 0:00:36
462500 -- (-1133.600) [-1129.180] (-1136.644) (-1128.974) * [-1132.524] (-1131.945) (-1136.438) (-1133.123) -- 0:00:36
463000 -- (-1132.063) (-1129.868) (-1131.707) [-1132.925] * (-1133.190) (-1129.787) (-1132.918) [-1133.019] -- 0:00:35
463500 -- (-1134.216) [-1130.016] (-1131.493) (-1131.368) * [-1135.045] (-1131.732) (-1133.445) (-1135.039) -- 0:00:35
464000 -- (-1129.980) (-1129.079) [-1131.588] (-1130.582) * (-1129.351) [-1133.064] (-1134.298) (-1131.234) -- 0:00:35
464500 -- [-1130.310] (-1129.050) (-1130.621) (-1129.646) * [-1130.484] (-1132.289) (-1131.215) (-1130.843) -- 0:00:35
465000 -- (-1137.000) (-1130.608) (-1130.901) [-1129.897] * [-1130.459] (-1137.534) (-1135.408) (-1134.668) -- 0:00:35
Average standard deviation of split frequencies: 0.013467
465500 -- [-1132.776] (-1132.341) (-1133.348) (-1130.683) * (-1131.465) (-1134.128) [-1130.018] (-1130.003) -- 0:00:35
466000 -- [-1131.809] (-1130.465) (-1130.332) (-1132.180) * [-1130.607] (-1129.005) (-1133.317) (-1129.609) -- 0:00:35
466500 -- [-1131.896] (-1139.392) (-1128.915) (-1133.142) * (-1133.352) [-1131.239] (-1131.890) (-1130.791) -- 0:00:35
467000 -- [-1132.465] (-1131.716) (-1129.917) (-1132.794) * [-1134.007] (-1130.150) (-1130.845) (-1131.284) -- 0:00:35
467500 -- (-1135.941) (-1132.898) [-1128.356] (-1130.517) * (-1138.257) (-1131.893) (-1132.070) [-1128.457] -- 0:00:35
468000 -- (-1132.700) (-1132.814) (-1132.804) [-1132.164] * (-1129.866) (-1130.707) [-1133.493] (-1132.094) -- 0:00:35
468500 -- (-1134.460) [-1130.397] (-1132.521) (-1131.514) * (-1131.720) [-1129.618] (-1134.931) (-1131.784) -- 0:00:35
469000 -- (-1131.865) (-1129.272) [-1128.176] (-1129.538) * (-1133.446) [-1130.946] (-1133.143) (-1131.178) -- 0:00:35
469500 -- (-1131.195) [-1129.986] (-1130.776) (-1129.082) * (-1133.399) (-1131.548) (-1130.684) [-1130.667] -- 0:00:35
470000 -- (-1134.963) [-1129.095] (-1131.712) (-1135.118) * (-1130.469) [-1129.519] (-1131.578) (-1131.006) -- 0:00:34
Average standard deviation of split frequencies: 0.013271
470500 -- (-1132.787) [-1130.940] (-1133.364) (-1131.635) * (-1136.657) (-1135.145) [-1130.136] (-1132.416) -- 0:00:34
471000 -- (-1132.014) (-1129.902) (-1129.985) [-1130.063] * (-1139.136) (-1129.838) [-1131.803] (-1134.768) -- 0:00:34
471500 -- (-1132.349) [-1129.612] (-1132.106) (-1131.937) * [-1131.747] (-1129.314) (-1133.740) (-1135.206) -- 0:00:34
472000 -- (-1132.208) (-1129.038) (-1132.054) [-1131.609] * (-1132.224) (-1128.220) [-1132.518] (-1136.133) -- 0:00:34
472500 -- [-1133.005] (-1132.033) (-1129.183) (-1135.172) * (-1134.387) (-1131.006) [-1134.063] (-1128.447) -- 0:00:35
473000 -- [-1132.509] (-1130.028) (-1131.819) (-1133.071) * (-1130.426) [-1129.897] (-1134.992) (-1128.825) -- 0:00:35
473500 -- [-1131.435] (-1131.641) (-1131.272) (-1131.910) * (-1130.845) (-1133.347) [-1134.050] (-1130.705) -- 0:00:35
474000 -- (-1134.232) [-1130.492] (-1134.688) (-1129.523) * [-1131.404] (-1130.295) (-1131.018) (-1132.027) -- 0:00:35
474500 -- (-1133.225) [-1131.432] (-1132.471) (-1132.108) * (-1130.562) (-1130.092) (-1133.192) [-1131.661] -- 0:00:35
475000 -- (-1132.335) (-1130.043) [-1132.961] (-1132.410) * (-1130.893) [-1130.744] (-1139.092) (-1132.140) -- 0:00:35
Average standard deviation of split frequencies: 0.012941
475500 -- [-1135.319] (-1131.211) (-1132.916) (-1133.879) * (-1130.716) (-1129.559) (-1130.154) [-1128.913] -- 0:00:35
476000 -- (-1135.776) (-1132.581) [-1131.926] (-1131.129) * (-1133.769) [-1136.524] (-1130.070) (-1131.305) -- 0:00:35
476500 -- (-1131.275) [-1129.896] (-1133.997) (-1131.582) * [-1131.710] (-1134.673) (-1130.811) (-1130.862) -- 0:00:35
477000 -- (-1133.343) (-1131.200) [-1133.729] (-1131.353) * [-1130.357] (-1133.765) (-1134.877) (-1129.618) -- 0:00:35
477500 -- [-1132.116] (-1131.368) (-1133.715) (-1131.893) * [-1131.393] (-1132.200) (-1136.200) (-1129.353) -- 0:00:35
478000 -- [-1132.101] (-1132.252) (-1131.029) (-1135.540) * (-1130.531) (-1130.726) [-1133.308] (-1133.356) -- 0:00:34
478500 -- (-1131.833) [-1131.724] (-1132.855) (-1133.759) * (-1130.775) (-1132.688) (-1136.984) [-1131.571] -- 0:00:34
479000 -- (-1132.636) (-1132.174) (-1132.174) [-1131.854] * (-1129.898) (-1129.150) (-1139.000) [-1129.338] -- 0:00:34
479500 -- [-1130.744] (-1132.895) (-1131.175) (-1131.976) * (-1129.722) (-1131.545) [-1130.614] (-1131.032) -- 0:00:34
480000 -- (-1131.105) (-1133.909) [-1134.124] (-1131.422) * (-1131.564) (-1137.197) (-1127.855) [-1129.926] -- 0:00:34
Average standard deviation of split frequencies: 0.013273
480500 -- (-1129.270) (-1130.324) (-1133.885) [-1130.494] * (-1130.301) (-1132.401) [-1131.105] (-1133.303) -- 0:00:34
481000 -- (-1132.232) (-1140.699) [-1130.546] (-1131.866) * (-1129.070) [-1131.300] (-1131.654) (-1133.102) -- 0:00:34
481500 -- (-1130.705) [-1131.901] (-1132.528) (-1132.055) * [-1129.499] (-1135.072) (-1133.897) (-1132.182) -- 0:00:34
482000 -- [-1130.763] (-1131.636) (-1138.139) (-1130.243) * [-1130.574] (-1132.786) (-1132.307) (-1132.761) -- 0:00:34
482500 -- [-1130.301] (-1132.266) (-1133.284) (-1128.818) * (-1130.445) (-1131.762) (-1131.470) [-1131.894] -- 0:00:34
483000 -- [-1130.358] (-1133.894) (-1131.873) (-1131.466) * (-1131.666) (-1132.088) (-1132.007) [-1133.538] -- 0:00:34
483500 -- (-1132.355) (-1132.872) [-1129.943] (-1131.033) * [-1129.804] (-1132.161) (-1132.235) (-1132.687) -- 0:00:34
484000 -- (-1132.063) (-1131.669) [-1128.723] (-1130.691) * (-1130.287) (-1131.802) (-1131.456) [-1131.688] -- 0:00:34
484500 -- (-1128.249) [-1129.749] (-1130.464) (-1131.015) * (-1130.537) (-1133.927) (-1129.007) [-1134.019] -- 0:00:34
485000 -- (-1132.690) (-1130.107) [-1129.583] (-1129.648) * (-1129.155) (-1133.743) (-1132.429) [-1131.212] -- 0:00:33
Average standard deviation of split frequencies: 0.013256
485500 -- (-1132.605) [-1128.515] (-1130.002) (-1129.952) * (-1132.522) (-1134.853) (-1131.998) [-1130.880] -- 0:00:33
486000 -- (-1132.233) [-1130.953] (-1130.710) (-1131.396) * (-1133.641) [-1132.644] (-1131.197) (-1130.983) -- 0:00:33
486500 -- (-1131.814) (-1129.449) [-1133.474] (-1130.036) * (-1129.773) [-1130.578] (-1132.308) (-1131.360) -- 0:00:33
487000 -- (-1130.646) [-1128.680] (-1133.596) (-1130.913) * (-1130.078) [-1130.613] (-1131.117) (-1133.410) -- 0:00:33
487500 -- (-1132.019) (-1131.754) (-1131.467) [-1132.725] * [-1131.916] (-1133.280) (-1131.538) (-1131.408) -- 0:00:33
488000 -- [-1130.217] (-1127.755) (-1133.872) (-1132.235) * [-1132.597] (-1131.582) (-1130.782) (-1132.291) -- 0:00:34
488500 -- (-1130.856) (-1128.616) (-1136.715) [-1130.235] * [-1131.122] (-1131.725) (-1129.466) (-1133.566) -- 0:00:34
489000 -- (-1133.511) (-1129.912) [-1137.090] (-1131.449) * (-1131.478) (-1132.458) (-1129.396) [-1133.479] -- 0:00:34
489500 -- (-1130.625) (-1131.141) [-1135.286] (-1131.871) * (-1134.419) [-1131.959] (-1128.976) (-1133.234) -- 0:00:34
490000 -- (-1130.531) (-1128.105) (-1136.106) [-1130.220] * (-1130.489) (-1135.098) [-1129.680] (-1133.050) -- 0:00:34
Average standard deviation of split frequencies: 0.013450
490500 -- (-1131.040) (-1130.349) (-1132.367) [-1132.807] * [-1133.788] (-1130.790) (-1133.536) (-1129.114) -- 0:00:34
491000 -- [-1129.481] (-1131.884) (-1134.385) (-1135.172) * (-1133.739) (-1131.242) [-1129.177] (-1130.152) -- 0:00:34
491500 -- [-1130.206] (-1132.947) (-1135.196) (-1135.095) * [-1130.227] (-1129.277) (-1130.040) (-1132.852) -- 0:00:34
492000 -- (-1131.808) (-1131.738) [-1129.880] (-1132.875) * (-1129.755) (-1133.964) (-1129.175) [-1128.776] -- 0:00:34
492500 -- (-1133.611) [-1130.156] (-1130.361) (-1130.233) * (-1131.746) (-1129.640) (-1132.924) [-1131.459] -- 0:00:34
493000 -- [-1132.483] (-1131.025) (-1133.744) (-1133.274) * (-1130.455) (-1131.844) [-1127.842] (-1133.198) -- 0:00:33
493500 -- (-1133.845) (-1131.433) [-1130.120] (-1133.544) * (-1132.424) [-1131.009] (-1132.159) (-1130.913) -- 0:00:33
494000 -- (-1130.292) (-1132.118) [-1129.974] (-1135.145) * (-1138.728) (-1130.702) [-1129.600] (-1141.028) -- 0:00:33
494500 -- (-1135.275) (-1135.518) (-1128.486) [-1133.521] * (-1132.027) (-1130.682) (-1133.322) [-1131.028] -- 0:00:33
495000 -- (-1131.371) (-1133.742) [-1130.372] (-1135.350) * (-1130.441) (-1131.079) (-1133.633) [-1134.925] -- 0:00:33
Average standard deviation of split frequencies: 0.013686
495500 -- (-1133.825) (-1134.443) [-1129.571] (-1134.793) * (-1130.773) (-1130.667) [-1129.568] (-1132.853) -- 0:00:33
496000 -- (-1131.436) (-1129.600) [-1129.946] (-1133.243) * (-1130.992) (-1134.119) [-1132.415] (-1130.497) -- 0:00:33
496500 -- (-1131.259) (-1134.058) (-1131.472) [-1131.441] * (-1131.236) [-1132.769] (-1129.227) (-1131.226) -- 0:00:33
497000 -- (-1139.306) (-1136.015) [-1130.691] (-1129.993) * (-1127.544) [-1132.785] (-1132.910) (-1131.858) -- 0:00:33
497500 -- (-1136.019) (-1131.603) [-1130.358] (-1131.400) * (-1131.028) (-1136.860) [-1130.239] (-1132.690) -- 0:00:33
498000 -- [-1131.081] (-1131.965) (-1131.268) (-1133.924) * (-1130.235) (-1135.923) (-1128.601) [-1130.198] -- 0:00:33
498500 -- [-1129.398] (-1131.039) (-1129.480) (-1135.460) * [-1128.517] (-1132.603) (-1135.232) (-1133.128) -- 0:00:33
499000 -- (-1130.906) [-1131.780] (-1131.296) (-1133.205) * [-1129.076] (-1133.094) (-1133.190) (-1132.296) -- 0:00:33
499500 -- [-1129.616] (-1134.402) (-1130.669) (-1130.844) * (-1134.626) (-1134.857) (-1131.842) [-1136.026] -- 0:00:33
500000 -- (-1131.660) [-1137.053] (-1129.575) (-1129.301) * [-1135.535] (-1133.283) (-1129.620) (-1134.139) -- 0:00:33
Average standard deviation of split frequencies: 0.014312
500500 -- (-1132.184) (-1131.568) [-1131.013] (-1131.156) * (-1137.099) [-1129.572] (-1131.302) (-1130.519) -- 0:00:32
501000 -- (-1131.190) (-1132.108) [-1130.344] (-1130.626) * (-1130.666) (-1130.079) [-1129.751] (-1130.052) -- 0:00:32
501500 -- (-1131.492) (-1132.300) (-1132.576) [-1130.556] * (-1130.129) [-1132.569] (-1130.699) (-1132.883) -- 0:00:32
502000 -- [-1131.522] (-1131.143) (-1136.152) (-1132.732) * (-1130.934) (-1131.621) (-1130.575) [-1128.799] -- 0:00:32
502500 -- (-1134.109) [-1133.048] (-1133.104) (-1134.242) * (-1131.900) (-1131.030) [-1128.591] (-1132.213) -- 0:00:32
503000 -- (-1131.590) (-1131.365) [-1132.613] (-1129.513) * (-1138.459) [-1131.642] (-1130.849) (-1129.821) -- 0:00:33
503500 -- (-1132.421) (-1131.509) (-1132.692) [-1130.135] * (-1132.156) [-1129.264] (-1131.966) (-1130.050) -- 0:00:33
504000 -- (-1134.137) [-1130.642] (-1131.976) (-1129.758) * (-1132.934) [-1129.436] (-1132.080) (-1129.387) -- 0:00:33
504500 -- (-1132.604) (-1137.851) (-1130.814) [-1130.685] * [-1131.721] (-1130.526) (-1134.656) (-1131.306) -- 0:00:33
505000 -- (-1132.287) (-1132.116) [-1131.790] (-1130.588) * (-1130.444) (-1130.668) (-1130.749) [-1132.055] -- 0:00:33
Average standard deviation of split frequencies: 0.013540
505500 -- (-1131.801) (-1131.583) [-1132.262] (-1131.536) * (-1131.389) [-1128.847] (-1130.672) (-1131.144) -- 0:00:33
506000 -- [-1135.347] (-1131.599) (-1132.699) (-1133.449) * [-1134.798] (-1130.112) (-1132.213) (-1130.224) -- 0:00:33
506500 -- [-1130.126] (-1137.429) (-1130.291) (-1132.699) * [-1131.431] (-1130.060) (-1133.612) (-1131.965) -- 0:00:33
507000 -- [-1131.247] (-1132.411) (-1130.456) (-1131.082) * (-1131.424) [-1132.154] (-1132.369) (-1132.685) -- 0:00:33
507500 -- (-1130.613) (-1134.516) [-1130.934] (-1133.665) * [-1132.644] (-1132.646) (-1132.391) (-1130.849) -- 0:00:32
508000 -- [-1130.032] (-1134.243) (-1132.474) (-1135.109) * (-1131.609) (-1129.654) [-1131.049] (-1129.681) -- 0:00:32
508500 -- (-1134.366) [-1131.630] (-1131.181) (-1133.359) * (-1131.690) (-1130.386) (-1130.531) [-1131.216] -- 0:00:32
509000 -- [-1132.897] (-1131.220) (-1131.067) (-1128.247) * (-1132.504) (-1130.361) [-1130.405] (-1131.165) -- 0:00:32
509500 -- [-1132.141] (-1131.902) (-1134.064) (-1131.821) * (-1131.943) (-1129.796) (-1130.190) [-1130.061] -- 0:00:32
510000 -- (-1131.286) (-1138.140) (-1132.540) [-1130.039] * (-1133.370) (-1130.425) (-1137.314) [-1131.829] -- 0:00:32
Average standard deviation of split frequencies: 0.014216
510500 -- (-1133.132) (-1135.475) (-1135.256) [-1131.029] * (-1131.682) (-1132.844) (-1127.966) [-1130.933] -- 0:00:32
511000 -- (-1133.047) [-1130.027] (-1129.855) (-1130.722) * [-1129.233] (-1131.965) (-1132.347) (-1132.603) -- 0:00:32
511500 -- [-1130.087] (-1131.544) (-1131.828) (-1128.532) * (-1129.677) (-1131.234) (-1132.525) [-1129.712] -- 0:00:32
512000 -- (-1130.142) [-1132.741] (-1131.869) (-1132.494) * (-1129.696) (-1131.845) [-1133.849] (-1135.212) -- 0:00:32
512500 -- [-1129.391] (-1131.526) (-1131.636) (-1131.527) * (-1131.758) (-1129.906) [-1132.503] (-1133.444) -- 0:00:32
513000 -- (-1132.210) [-1129.087] (-1131.931) (-1137.586) * (-1129.259) (-1132.156) (-1133.917) [-1131.003] -- 0:00:32
513500 -- (-1131.462) (-1131.559) (-1130.354) [-1130.076] * [-1129.793] (-1131.051) (-1133.892) (-1132.306) -- 0:00:32
514000 -- (-1131.275) (-1133.177) (-1130.116) [-1130.033] * (-1129.036) (-1130.332) [-1130.230] (-1135.857) -- 0:00:32
514500 -- [-1131.576] (-1130.822) (-1134.525) (-1130.214) * [-1131.352] (-1132.410) (-1130.005) (-1134.585) -- 0:00:32
515000 -- (-1130.031) [-1131.812] (-1132.110) (-1129.875) * (-1134.853) (-1131.911) (-1129.668) [-1131.578] -- 0:00:32
Average standard deviation of split frequencies: 0.014313
515500 -- (-1128.495) (-1133.236) (-1135.393) [-1134.590] * (-1130.669) [-1131.242] (-1129.402) (-1137.065) -- 0:00:31
516000 -- (-1132.140) (-1130.963) [-1133.580] (-1132.411) * (-1131.752) (-1131.619) (-1131.326) [-1131.475] -- 0:00:31
516500 -- (-1132.490) (-1133.438) (-1134.963) [-1129.754] * (-1133.835) (-1131.721) (-1130.983) [-1132.114] -- 0:00:31
517000 -- (-1132.289) (-1134.169) (-1130.384) [-1131.384] * (-1132.468) (-1131.656) [-1130.891] (-1132.869) -- 0:00:31
517500 -- (-1131.193) (-1130.671) (-1132.852) [-1130.779] * (-1129.433) (-1132.522) [-1132.056] (-1131.710) -- 0:00:31
518000 -- (-1132.250) (-1130.743) (-1132.353) [-1131.850] * (-1128.336) (-1131.723) [-1131.941] (-1132.048) -- 0:00:32
518500 -- [-1130.627] (-1130.422) (-1136.168) (-1130.591) * [-1130.406] (-1132.931) (-1130.690) (-1130.611) -- 0:00:32
519000 -- (-1129.329) [-1131.545] (-1134.631) (-1128.968) * (-1130.779) [-1130.682] (-1129.731) (-1130.806) -- 0:00:32
519500 -- (-1132.214) [-1131.070] (-1131.052) (-1132.277) * [-1130.117] (-1132.729) (-1131.594) (-1130.390) -- 0:00:32
520000 -- (-1130.962) (-1130.807) [-1130.934] (-1134.428) * [-1131.633] (-1134.800) (-1132.656) (-1130.409) -- 0:00:32
Average standard deviation of split frequencies: 0.013520
520500 -- (-1131.727) [-1130.320] (-1132.905) (-1135.469) * [-1128.913] (-1132.730) (-1132.988) (-1130.363) -- 0:00:32
521000 -- (-1129.706) (-1132.215) (-1133.231) [-1132.046] * [-1128.831] (-1132.819) (-1134.036) (-1131.920) -- 0:00:32
521500 -- [-1128.568] (-1130.964) (-1131.119) (-1136.358) * [-1129.493] (-1134.151) (-1133.973) (-1131.511) -- 0:00:32
522000 -- (-1129.205) [-1130.970] (-1130.479) (-1131.759) * (-1129.954) [-1135.717] (-1133.575) (-1131.072) -- 0:00:32
522500 -- (-1131.220) [-1130.889] (-1131.389) (-1131.047) * [-1130.446] (-1133.506) (-1130.699) (-1134.248) -- 0:00:31
523000 -- [-1131.932] (-1129.008) (-1131.182) (-1131.560) * (-1130.973) (-1132.697) [-1133.337] (-1131.304) -- 0:00:31
523500 -- (-1130.993) [-1127.892] (-1131.382) (-1134.655) * (-1131.556) [-1130.819] (-1131.356) (-1133.430) -- 0:00:31
524000 -- (-1130.722) (-1131.799) (-1131.299) [-1131.270] * [-1129.876] (-1132.459) (-1131.587) (-1132.637) -- 0:00:31
524500 -- [-1130.803] (-1131.046) (-1134.688) (-1138.550) * (-1128.492) (-1132.394) (-1135.868) [-1132.296] -- 0:00:31
525000 -- [-1130.996] (-1132.354) (-1130.140) (-1133.482) * (-1130.032) [-1129.343] (-1136.854) (-1133.219) -- 0:00:31
Average standard deviation of split frequencies: 0.013264
525500 -- [-1130.852] (-1133.253) (-1130.889) (-1132.670) * (-1135.871) (-1131.082) (-1135.478) [-1137.119] -- 0:00:31
526000 -- (-1131.999) [-1134.089] (-1131.598) (-1132.220) * [-1131.815] (-1129.849) (-1133.171) (-1131.094) -- 0:00:31
526500 -- (-1130.820) [-1132.281] (-1130.602) (-1130.731) * [-1132.591] (-1136.702) (-1132.147) (-1130.876) -- 0:00:31
527000 -- (-1130.236) (-1130.341) (-1132.662) [-1132.744] * (-1132.646) [-1131.727] (-1134.674) (-1131.203) -- 0:00:31
527500 -- (-1132.126) (-1129.178) [-1135.517] (-1133.110) * (-1131.366) (-1131.670) [-1130.906] (-1134.188) -- 0:00:31
528000 -- (-1131.310) (-1132.190) (-1134.592) [-1134.958] * (-1133.354) (-1130.340) (-1133.232) [-1129.745] -- 0:00:31
528500 -- (-1133.344) (-1133.111) [-1130.105] (-1130.951) * (-1130.388) (-1133.589) (-1133.624) [-1131.778] -- 0:00:31
529000 -- (-1131.890) [-1133.707] (-1130.375) (-1133.684) * (-1129.200) (-1132.208) [-1132.373] (-1129.517) -- 0:00:31
529500 -- (-1132.447) (-1132.259) [-1129.797] (-1129.348) * (-1132.077) (-1130.602) [-1132.674] (-1133.290) -- 0:00:31
530000 -- [-1131.924] (-1132.891) (-1129.649) (-1133.218) * [-1130.117] (-1129.733) (-1131.038) (-1129.686) -- 0:00:31
Average standard deviation of split frequencies: 0.014036
530500 -- (-1131.221) (-1132.496) (-1129.842) [-1131.733] * [-1132.617] (-1129.226) (-1129.531) (-1133.623) -- 0:00:30
531000 -- [-1131.568] (-1129.950) (-1130.224) (-1131.958) * (-1131.075) [-1131.180] (-1131.447) (-1133.231) -- 0:00:30
531500 -- (-1131.986) [-1131.307] (-1132.597) (-1134.168) * (-1131.917) [-1134.899] (-1129.375) (-1133.209) -- 0:00:30
532000 -- (-1130.183) [-1130.663] (-1130.328) (-1131.392) * (-1131.792) (-1130.085) (-1130.121) [-1131.026] -- 0:00:30
532500 -- [-1131.556] (-1131.277) (-1131.554) (-1130.944) * (-1133.908) [-1129.187] (-1132.316) (-1128.848) -- 0:00:30
533000 -- (-1131.493) [-1132.163] (-1132.251) (-1132.027) * (-1131.929) (-1128.621) (-1134.442) [-1128.472] -- 0:00:30
533500 -- [-1129.964] (-1128.913) (-1130.926) (-1133.949) * [-1129.938] (-1130.059) (-1130.982) (-1131.187) -- 0:00:31
534000 -- (-1132.004) (-1135.560) (-1136.518) [-1132.078] * (-1129.531) (-1131.006) (-1130.924) [-1131.992] -- 0:00:31
534500 -- (-1132.387) (-1130.905) (-1130.628) [-1130.148] * (-1130.093) (-1129.912) (-1129.820) [-1132.324] -- 0:00:31
535000 -- [-1134.854] (-1130.509) (-1128.580) (-1131.238) * (-1131.785) (-1132.206) (-1131.353) [-1130.646] -- 0:00:31
Average standard deviation of split frequencies: 0.014072
535500 -- (-1130.803) (-1132.992) [-1130.152] (-1128.997) * (-1128.768) (-1130.996) (-1130.201) [-1131.198] -- 0:00:31
536000 -- (-1132.836) (-1128.961) [-1130.428] (-1130.510) * [-1130.523] (-1131.819) (-1131.852) (-1129.115) -- 0:00:31
536500 -- [-1132.820] (-1129.449) (-1129.895) (-1132.261) * (-1134.032) (-1130.832) [-1130.250] (-1131.759) -- 0:00:31
537000 -- (-1133.100) [-1129.847] (-1132.723) (-1130.434) * (-1131.467) (-1131.972) [-1129.782] (-1132.429) -- 0:00:31
537500 -- (-1131.941) (-1130.486) (-1131.586) [-1131.117] * [-1131.333] (-1130.687) (-1132.605) (-1132.371) -- 0:00:30
538000 -- (-1129.319) [-1129.663] (-1129.747) (-1128.390) * [-1131.527] (-1129.831) (-1129.510) (-1131.749) -- 0:00:30
538500 -- (-1136.268) [-1131.436] (-1129.708) (-1134.800) * (-1129.763) [-1131.036] (-1135.375) (-1134.031) -- 0:00:30
539000 -- (-1138.408) [-1130.640] (-1131.453) (-1129.241) * (-1132.919) (-1134.012) (-1131.627) [-1137.159] -- 0:00:30
539500 -- [-1131.986] (-1129.901) (-1132.544) (-1132.525) * [-1130.594] (-1140.257) (-1133.192) (-1132.970) -- 0:00:30
540000 -- (-1133.576) (-1128.528) [-1130.855] (-1131.162) * [-1128.488] (-1131.821) (-1134.823) (-1132.864) -- 0:00:30
Average standard deviation of split frequencies: 0.014008
540500 -- (-1131.038) (-1130.160) [-1131.379] (-1131.484) * (-1130.046) (-1130.124) [-1135.506] (-1132.629) -- 0:00:30
541000 -- (-1131.795) [-1131.517] (-1131.360) (-1130.507) * (-1135.456) (-1134.878) [-1130.375] (-1130.456) -- 0:00:30
541500 -- [-1131.726] (-1131.019) (-1136.842) (-1131.094) * [-1128.419] (-1130.154) (-1131.220) (-1130.177) -- 0:00:30
542000 -- (-1134.468) [-1134.945] (-1134.990) (-1130.873) * (-1133.310) (-1134.532) [-1133.513] (-1130.680) -- 0:00:30
542500 -- (-1132.598) [-1133.684] (-1136.561) (-1132.465) * (-1135.419) (-1138.346) (-1130.472) [-1130.891] -- 0:00:30
543000 -- (-1137.428) (-1132.918) (-1136.552) [-1133.013] * (-1129.572) (-1136.278) (-1130.794) [-1130.607] -- 0:00:30
543500 -- (-1130.674) (-1130.262) (-1133.891) [-1130.501] * (-1131.603) (-1132.146) [-1129.748] (-1136.471) -- 0:00:30
544000 -- [-1132.576] (-1131.152) (-1135.512) (-1130.957) * (-1128.911) (-1129.349) (-1131.416) [-1133.460] -- 0:00:30
544500 -- [-1131.034] (-1132.436) (-1128.000) (-1131.955) * (-1130.864) (-1133.296) [-1131.487] (-1130.155) -- 0:00:30
545000 -- [-1131.258] (-1132.425) (-1131.943) (-1130.106) * (-1129.578) (-1130.944) [-1131.733] (-1132.944) -- 0:00:30
Average standard deviation of split frequencies: 0.013756
545500 -- (-1131.232) [-1132.353] (-1131.833) (-1130.279) * (-1132.791) (-1131.393) (-1133.145) [-1130.033] -- 0:00:29
546000 -- (-1131.105) (-1135.681) [-1134.009] (-1132.203) * (-1130.146) [-1129.914] (-1129.361) (-1130.570) -- 0:00:29
546500 -- (-1132.060) (-1132.949) (-1135.299) [-1134.762] * (-1128.881) (-1132.276) (-1131.016) [-1129.361] -- 0:00:29
547000 -- [-1131.266] (-1130.614) (-1131.915) (-1129.725) * (-1132.673) (-1131.202) [-1128.727] (-1131.939) -- 0:00:29
547500 -- [-1131.534] (-1131.274) (-1131.593) (-1128.586) * (-1129.586) (-1129.873) (-1132.226) [-1134.631] -- 0:00:29
548000 -- (-1132.622) (-1135.329) [-1130.640] (-1131.510) * [-1132.786] (-1133.835) (-1131.181) (-1130.196) -- 0:00:29
548500 -- (-1131.574) [-1130.462] (-1132.401) (-1130.570) * (-1134.293) (-1132.530) [-1131.489] (-1130.260) -- 0:00:29
549000 -- (-1133.427) (-1130.631) [-1136.129] (-1131.934) * (-1130.100) [-1131.694] (-1134.245) (-1129.954) -- 0:00:30
549500 -- (-1132.745) (-1130.600) (-1134.331) [-1130.428] * [-1129.987] (-1132.314) (-1133.165) (-1133.236) -- 0:00:30
550000 -- (-1131.627) (-1133.152) [-1131.715] (-1136.149) * [-1131.272] (-1128.264) (-1131.897) (-1134.408) -- 0:00:30
Average standard deviation of split frequencies: 0.013982
550500 -- (-1135.377) (-1132.683) [-1132.247] (-1128.349) * (-1132.448) (-1133.007) (-1130.718) [-1132.910] -- 0:00:30
551000 -- [-1130.303] (-1128.962) (-1130.386) (-1129.720) * (-1134.941) (-1135.664) [-1131.829] (-1130.231) -- 0:00:30
551500 -- (-1131.374) (-1132.107) [-1133.110] (-1130.886) * [-1132.437] (-1132.720) (-1132.109) (-1133.775) -- 0:00:30
552000 -- (-1133.856) (-1132.491) (-1130.266) [-1134.296] * (-1130.211) [-1128.647] (-1136.050) (-1134.429) -- 0:00:30
552500 -- [-1130.147] (-1133.598) (-1130.110) (-1132.952) * (-1130.571) [-1128.893] (-1128.706) (-1133.636) -- 0:00:29
553000 -- (-1131.988) (-1131.254) [-1130.008] (-1128.244) * (-1132.280) (-1131.840) (-1134.149) [-1130.310] -- 0:00:29
553500 -- (-1133.378) (-1133.370) [-1130.313] (-1128.553) * (-1130.383) (-1132.801) [-1134.692] (-1129.030) -- 0:00:29
554000 -- (-1130.825) (-1131.517) [-1131.172] (-1130.366) * (-1132.120) (-1132.681) [-1131.199] (-1134.999) -- 0:00:29
554500 -- (-1132.873) [-1131.039] (-1130.865) (-1130.356) * (-1130.414) (-1134.929) [-1130.510] (-1130.307) -- 0:00:29
555000 -- [-1134.592] (-1131.283) (-1132.358) (-1129.824) * [-1135.460] (-1131.570) (-1132.714) (-1130.236) -- 0:00:29
Average standard deviation of split frequencies: 0.014244
555500 -- (-1129.551) (-1130.945) (-1134.682) [-1131.112] * (-1131.797) (-1132.325) (-1131.141) [-1129.209] -- 0:00:29
556000 -- (-1133.106) (-1130.837) (-1132.311) [-1128.721] * (-1131.979) (-1133.279) (-1130.185) [-1129.772] -- 0:00:29
556500 -- (-1130.623) (-1133.027) [-1137.540] (-1136.229) * (-1133.099) [-1129.428] (-1132.872) (-1130.115) -- 0:00:29
557000 -- (-1130.997) (-1133.651) [-1132.303] (-1128.982) * (-1131.875) (-1133.594) [-1132.300] (-1130.316) -- 0:00:29
557500 -- (-1129.799) (-1130.829) [-1132.763] (-1132.261) * (-1130.454) (-1137.107) (-1133.397) [-1131.553] -- 0:00:29
558000 -- (-1130.255) (-1131.255) (-1130.937) [-1128.705] * (-1131.281) (-1134.356) (-1129.311) [-1132.879] -- 0:00:29
558500 -- (-1131.043) (-1129.003) (-1133.549) [-1131.435] * [-1129.318] (-1132.002) (-1133.490) (-1131.911) -- 0:00:29
559000 -- (-1131.709) (-1134.401) (-1130.848) [-1131.937] * (-1130.796) [-1130.967] (-1130.115) (-1137.232) -- 0:00:29
559500 -- (-1130.192) [-1132.022] (-1130.422) (-1132.463) * (-1132.216) (-1132.827) (-1131.100) [-1132.287] -- 0:00:29
560000 -- (-1131.873) [-1130.893] (-1132.346) (-1129.908) * (-1131.200) [-1134.050] (-1132.181) (-1130.492) -- 0:00:29
Average standard deviation of split frequencies: 0.014181
560500 -- (-1128.668) (-1137.212) (-1132.803) [-1132.274] * (-1131.904) (-1132.664) (-1132.106) [-1128.927] -- 0:00:29
561000 -- (-1138.509) (-1135.852) (-1129.257) [-1130.004] * (-1131.663) [-1130.898] (-1130.725) (-1132.010) -- 0:00:28
561500 -- (-1131.434) (-1133.502) (-1132.152) [-1129.235] * (-1131.098) (-1129.836) (-1130.858) [-1130.694] -- 0:00:28
562000 -- [-1132.574] (-1132.240) (-1138.215) (-1131.929) * (-1131.637) (-1130.639) (-1130.031) [-1130.877] -- 0:00:28
562500 -- (-1131.236) (-1130.815) (-1134.224) [-1132.078] * (-1131.648) (-1132.762) (-1132.738) [-1128.601] -- 0:00:28
563000 -- [-1131.044] (-1132.637) (-1133.501) (-1130.782) * (-1131.341) (-1132.298) (-1131.693) [-1129.896] -- 0:00:28
563500 -- [-1132.417] (-1133.364) (-1133.261) (-1128.671) * (-1128.648) (-1130.226) (-1130.817) [-1130.505] -- 0:00:28
564000 -- (-1132.731) (-1131.490) (-1130.217) [-1132.177] * (-1130.201) (-1133.237) (-1136.950) [-1133.651] -- 0:00:29
564500 -- (-1131.039) (-1130.740) (-1129.337) [-1129.310] * [-1129.712] (-1132.580) (-1132.837) (-1136.260) -- 0:00:29
565000 -- (-1129.984) (-1131.339) (-1134.935) [-1129.472] * (-1132.851) (-1129.499) (-1133.150) [-1129.224] -- 0:00:29
Average standard deviation of split frequencies: 0.013326
565500 -- (-1130.433) (-1130.226) [-1127.820] (-1132.318) * (-1131.874) [-1132.819] (-1131.005) (-1128.765) -- 0:00:29
566000 -- (-1132.443) [-1132.244] (-1134.784) (-1129.120) * [-1130.446] (-1130.886) (-1130.837) (-1129.745) -- 0:00:29
566500 -- [-1131.268] (-1130.722) (-1129.986) (-1129.467) * (-1130.730) (-1130.858) [-1131.222] (-1129.536) -- 0:00:29
567000 -- (-1130.680) [-1132.182] (-1131.520) (-1131.905) * [-1129.227] (-1133.232) (-1128.994) (-1132.118) -- 0:00:29
567500 -- [-1129.928] (-1139.620) (-1128.897) (-1130.658) * (-1132.910) (-1132.173) (-1131.182) [-1130.463] -- 0:00:28
568000 -- (-1129.732) (-1133.585) [-1129.251] (-1129.180) * (-1129.399) (-1131.199) [-1130.633] (-1130.271) -- 0:00:28
568500 -- [-1129.229] (-1136.369) (-1132.683) (-1129.930) * [-1132.201] (-1130.940) (-1129.897) (-1132.113) -- 0:00:28
569000 -- [-1128.769] (-1134.171) (-1131.678) (-1130.045) * (-1131.994) [-1130.012] (-1134.042) (-1131.398) -- 0:00:28
569500 -- (-1134.374) (-1133.549) (-1128.009) [-1128.458] * (-1132.540) (-1132.028) [-1129.565] (-1131.378) -- 0:00:28
570000 -- (-1137.170) [-1130.839] (-1134.591) (-1128.959) * (-1131.262) (-1128.827) [-1132.711] (-1135.053) -- 0:00:28
Average standard deviation of split frequencies: 0.013162
570500 -- (-1131.679) [-1129.559] (-1132.223) (-1130.380) * (-1132.287) (-1129.931) [-1131.950] (-1132.911) -- 0:00:28
571000 -- (-1132.794) (-1130.785) (-1130.543) [-1131.655] * (-1133.020) (-1131.125) (-1133.075) [-1129.130] -- 0:00:28
571500 -- (-1132.435) (-1133.567) [-1129.532] (-1131.428) * (-1130.378) [-1131.586] (-1132.585) (-1131.736) -- 0:00:28
572000 -- (-1130.770) (-1134.338) [-1131.224] (-1131.450) * [-1129.991] (-1128.886) (-1130.422) (-1138.231) -- 0:00:28
572500 -- (-1130.669) (-1133.214) (-1131.359) [-1131.155] * (-1129.823) (-1128.611) [-1129.136] (-1131.210) -- 0:00:28
573000 -- (-1131.371) (-1138.751) (-1132.060) [-1130.359] * (-1129.565) [-1129.908] (-1130.870) (-1129.444) -- 0:00:28
573500 -- (-1131.287) [-1132.309] (-1133.025) (-1132.809) * [-1129.221] (-1130.669) (-1130.937) (-1131.749) -- 0:00:28
574000 -- (-1130.941) (-1134.162) [-1132.409] (-1134.659) * (-1133.188) [-1129.651] (-1133.564) (-1131.538) -- 0:00:28
574500 -- (-1130.962) (-1135.365) [-1130.027] (-1133.647) * (-1130.499) [-1133.486] (-1131.428) (-1132.116) -- 0:00:28
575000 -- (-1133.595) [-1131.705] (-1134.719) (-1133.209) * (-1131.651) (-1131.445) [-1129.533] (-1130.905) -- 0:00:28
Average standard deviation of split frequencies: 0.012713
575500 -- (-1131.410) (-1132.501) (-1139.096) [-1130.975] * (-1130.566) (-1131.993) (-1130.544) [-1131.140] -- 0:00:28
576000 -- [-1130.483] (-1132.016) (-1129.905) (-1131.464) * (-1129.014) [-1130.491] (-1130.712) (-1136.673) -- 0:00:27
576500 -- [-1132.080] (-1132.479) (-1132.043) (-1136.244) * [-1128.017] (-1132.018) (-1132.034) (-1132.811) -- 0:00:27
577000 -- (-1131.734) (-1131.909) [-1131.478] (-1135.050) * (-1129.844) (-1134.049) (-1134.060) [-1130.363] -- 0:00:27
577500 -- (-1129.739) (-1132.145) (-1132.424) [-1130.266] * (-1131.544) [-1134.036] (-1130.340) (-1129.027) -- 0:00:27
578000 -- [-1130.788] (-1131.429) (-1130.496) (-1132.510) * [-1128.334] (-1136.273) (-1128.725) (-1130.561) -- 0:00:27
578500 -- (-1134.920) (-1132.147) (-1129.798) [-1131.133] * (-1131.563) (-1131.316) [-1129.613] (-1133.882) -- 0:00:27
579000 -- (-1137.480) [-1133.921] (-1132.557) (-1130.782) * (-1132.825) (-1128.624) [-1131.049] (-1129.752) -- 0:00:27
579500 -- [-1134.674] (-1132.945) (-1133.289) (-1131.673) * (-1133.055) (-1131.090) (-1132.225) [-1130.537] -- 0:00:28
580000 -- (-1136.364) (-1132.280) [-1129.843] (-1135.625) * (-1133.038) (-1130.080) (-1132.826) [-1131.215] -- 0:00:28
Average standard deviation of split frequencies: 0.012232
580500 -- [-1131.340] (-1136.167) (-1130.841) (-1128.750) * (-1133.274) [-1129.420] (-1131.807) (-1131.834) -- 0:00:28
581000 -- [-1131.243] (-1135.068) (-1128.708) (-1131.017) * (-1130.058) [-1130.496] (-1130.797) (-1129.729) -- 0:00:28
581500 -- (-1133.023) (-1131.503) (-1130.474) [-1131.364] * (-1131.629) (-1129.628) [-1128.996] (-1132.775) -- 0:00:28
582000 -- (-1130.416) (-1131.370) (-1129.727) [-1132.217] * [-1132.094] (-1132.431) (-1130.756) (-1134.566) -- 0:00:28
582500 -- (-1133.489) [-1131.936] (-1134.870) (-1132.178) * (-1133.662) (-1129.908) [-1130.123] (-1130.281) -- 0:00:27
583000 -- (-1132.219) [-1133.695] (-1132.877) (-1131.831) * [-1128.038] (-1129.985) (-1131.869) (-1128.573) -- 0:00:27
583500 -- (-1132.110) [-1130.039] (-1130.627) (-1129.888) * (-1133.291) [-1127.815] (-1131.481) (-1133.437) -- 0:00:27
584000 -- (-1131.018) [-1134.244] (-1131.029) (-1131.108) * [-1131.283] (-1129.995) (-1131.764) (-1129.753) -- 0:00:27
584500 -- (-1132.437) [-1131.877] (-1135.851) (-1132.265) * (-1131.266) [-1128.901] (-1132.186) (-1129.880) -- 0:00:27
585000 -- [-1131.057] (-1131.488) (-1130.949) (-1130.289) * [-1131.216] (-1130.290) (-1133.566) (-1129.734) -- 0:00:27
Average standard deviation of split frequencies: 0.012549
585500 -- (-1132.542) [-1132.773] (-1133.517) (-1132.653) * (-1131.758) (-1129.574) [-1130.865] (-1132.231) -- 0:00:27
586000 -- (-1130.853) (-1131.507) [-1135.206] (-1131.646) * [-1132.120] (-1128.440) (-1131.134) (-1131.289) -- 0:00:27
586500 -- (-1134.496) (-1132.015) (-1137.412) [-1134.103] * (-1141.032) (-1130.277) [-1130.041] (-1131.959) -- 0:00:27
587000 -- (-1133.552) [-1130.603] (-1133.764) (-1131.316) * (-1132.177) (-1130.740) (-1130.227) [-1131.538] -- 0:00:27
587500 -- (-1133.608) [-1130.174] (-1130.122) (-1132.196) * [-1131.701] (-1131.605) (-1130.901) (-1132.603) -- 0:00:27
588000 -- (-1129.606) [-1131.972] (-1131.776) (-1131.853) * (-1132.273) [-1130.293] (-1135.613) (-1134.838) -- 0:00:27
588500 -- (-1131.246) (-1132.510) [-1129.085] (-1132.068) * (-1132.479) (-1133.272) (-1133.490) [-1130.481] -- 0:00:27
589000 -- [-1133.547] (-1132.672) (-1131.715) (-1130.754) * [-1129.031] (-1131.614) (-1132.348) (-1131.372) -- 0:00:27
589500 -- (-1129.814) (-1131.655) [-1132.673] (-1130.964) * (-1130.180) (-1132.289) [-1130.919] (-1131.957) -- 0:00:27
590000 -- (-1130.553) (-1130.987) [-1131.375] (-1142.457) * (-1129.896) [-1131.446] (-1130.322) (-1131.407) -- 0:00:27
Average standard deviation of split frequencies: 0.013621
590500 -- (-1130.728) (-1130.826) (-1130.584) [-1129.045] * [-1129.385] (-1131.438) (-1130.005) (-1131.030) -- 0:00:27
591000 -- (-1132.981) [-1130.547] (-1130.715) (-1130.381) * [-1129.413] (-1131.138) (-1131.904) (-1135.672) -- 0:00:26
591500 -- (-1129.401) (-1132.966) (-1131.583) [-1130.145] * (-1130.760) (-1131.317) (-1141.230) [-1132.759] -- 0:00:26
592000 -- (-1131.948) (-1132.397) [-1130.841] (-1129.983) * (-1133.895) [-1128.998] (-1132.677) (-1136.771) -- 0:00:26
592500 -- (-1130.643) (-1129.911) (-1135.158) [-1131.141] * [-1133.273] (-1127.902) (-1131.719) (-1135.901) -- 0:00:26
593000 -- (-1134.063) (-1131.916) [-1130.616] (-1132.173) * (-1131.968) (-1129.250) (-1130.978) [-1132.216] -- 0:00:26
593500 -- (-1131.993) (-1130.430) [-1135.107] (-1131.157) * (-1129.112) (-1130.186) [-1129.814] (-1134.324) -- 0:00:26
594000 -- (-1132.925) [-1129.919] (-1131.580) (-1128.010) * (-1136.660) (-1134.640) [-1130.424] (-1132.786) -- 0:00:26
594500 -- (-1135.872) (-1133.149) [-1134.882] (-1133.566) * (-1131.765) (-1132.306) [-1129.931] (-1131.629) -- 0:00:26
595000 -- (-1130.765) (-1131.469) (-1133.124) [-1131.464] * [-1128.690] (-1130.713) (-1129.402) (-1130.612) -- 0:00:27
Average standard deviation of split frequencies: 0.013393
595500 -- (-1131.176) (-1133.399) [-1130.050] (-1129.211) * (-1130.756) (-1130.994) (-1130.029) [-1131.749] -- 0:00:27
596000 -- (-1130.572) [-1129.785] (-1134.092) (-1133.127) * (-1132.499) [-1133.173] (-1129.260) (-1131.820) -- 0:00:27
596500 -- (-1131.234) [-1131.623] (-1132.471) (-1136.022) * (-1130.046) (-1130.775) (-1135.775) [-1132.783] -- 0:00:27
597000 -- (-1132.693) [-1130.479] (-1134.552) (-1131.099) * (-1133.781) (-1130.416) [-1128.863] (-1132.683) -- 0:00:27
597500 -- (-1134.779) [-1131.560] (-1133.053) (-1130.959) * [-1133.603] (-1129.156) (-1129.630) (-1133.856) -- 0:00:26
598000 -- [-1131.115] (-1130.761) (-1131.774) (-1130.220) * (-1130.128) (-1133.183) (-1133.296) [-1131.673] -- 0:00:26
598500 -- (-1131.761) (-1135.261) [-1130.234] (-1131.704) * (-1130.059) [-1134.753] (-1130.613) (-1131.598) -- 0:00:26
599000 -- (-1133.431) (-1129.979) [-1131.486] (-1130.810) * (-1130.814) [-1134.806] (-1130.227) (-1130.317) -- 0:00:26
599500 -- (-1133.154) [-1129.578] (-1132.455) (-1131.150) * (-1129.007) [-1128.971] (-1129.852) (-1130.663) -- 0:00:26
600000 -- (-1130.433) [-1130.348] (-1130.951) (-1129.264) * (-1137.209) (-1130.126) [-1129.575] (-1132.381) -- 0:00:26
Average standard deviation of split frequencies: 0.013132
600500 -- (-1130.233) [-1128.552] (-1130.949) (-1131.285) * (-1130.538) (-1130.919) [-1129.990] (-1130.588) -- 0:00:26
601000 -- [-1130.193] (-1129.190) (-1129.325) (-1133.293) * (-1128.863) [-1131.254] (-1132.859) (-1132.804) -- 0:00:26
601500 -- (-1129.800) [-1132.379] (-1130.910) (-1131.296) * (-1132.230) (-1131.298) (-1128.778) [-1131.499] -- 0:00:26
602000 -- (-1131.394) (-1133.921) (-1133.400) [-1127.968] * (-1131.839) [-1131.948] (-1132.804) (-1130.543) -- 0:00:26
602500 -- [-1129.663] (-1132.680) (-1129.636) (-1131.586) * (-1132.887) (-1130.292) [-1134.574] (-1129.671) -- 0:00:26
603000 -- [-1132.390] (-1133.915) (-1136.292) (-1131.126) * (-1130.357) (-1130.433) [-1133.783] (-1134.581) -- 0:00:26
603500 -- [-1131.725] (-1130.637) (-1133.806) (-1136.885) * (-1131.191) (-1130.820) (-1132.411) [-1132.787] -- 0:00:26
604000 -- [-1130.188] (-1133.124) (-1132.821) (-1132.288) * (-1130.798) (-1132.606) [-1129.798] (-1131.146) -- 0:00:26
604500 -- [-1131.454] (-1132.290) (-1131.999) (-1133.244) * [-1132.331] (-1136.284) (-1130.763) (-1132.249) -- 0:00:26
605000 -- [-1131.008] (-1131.148) (-1135.108) (-1130.579) * (-1131.581) (-1129.821) (-1129.311) [-1128.522] -- 0:00:26
Average standard deviation of split frequencies: 0.012706
605500 -- (-1130.569) [-1129.880] (-1129.730) (-1129.364) * (-1133.237) (-1131.598) [-1130.758] (-1130.772) -- 0:00:26
606000 -- [-1131.717] (-1130.040) (-1131.026) (-1133.149) * [-1130.564] (-1134.946) (-1131.567) (-1132.168) -- 0:00:26
606500 -- (-1134.204) [-1130.291] (-1133.569) (-1131.872) * (-1129.792) (-1130.430) (-1130.953) [-1131.849] -- 0:00:25
607000 -- (-1131.100) (-1130.861) (-1130.544) [-1132.425] * [-1128.781] (-1129.462) (-1130.408) (-1130.805) -- 0:00:25
607500 -- [-1129.029] (-1131.444) (-1134.400) (-1133.580) * [-1129.879] (-1133.393) (-1134.518) (-1130.018) -- 0:00:25
608000 -- (-1128.906) (-1130.665) [-1131.762] (-1131.003) * (-1134.267) [-1130.143] (-1132.083) (-1129.834) -- 0:00:25
608500 -- (-1132.237) [-1130.079] (-1135.617) (-1132.832) * [-1129.323] (-1129.561) (-1130.354) (-1130.946) -- 0:00:25
609000 -- (-1134.040) [-1130.054] (-1133.811) (-1130.681) * (-1130.438) [-1128.127] (-1129.651) (-1130.589) -- 0:00:25
609500 -- (-1135.183) (-1130.160) [-1131.440] (-1130.292) * (-1130.946) (-1131.177) [-1131.831] (-1130.597) -- 0:00:25
610000 -- (-1130.331) (-1129.170) (-1135.722) [-1129.035] * [-1132.319] (-1132.789) (-1135.941) (-1132.895) -- 0:00:26
Average standard deviation of split frequencies: 0.012094
610500 -- (-1135.136) [-1130.148] (-1131.793) (-1130.529) * (-1128.838) [-1130.050] (-1131.485) (-1134.250) -- 0:00:26
611000 -- (-1131.611) (-1130.150) [-1131.457] (-1132.909) * (-1130.640) [-1132.094] (-1130.880) (-1131.844) -- 0:00:26
611500 -- [-1131.100] (-1129.133) (-1130.726) (-1131.125) * (-1134.386) (-1133.666) (-1130.003) [-1131.327] -- 0:00:26
612000 -- (-1132.667) (-1135.331) (-1133.650) [-1134.753] * (-1133.071) [-1129.272] (-1129.195) (-1130.748) -- 0:00:25
612500 -- (-1131.410) [-1129.133] (-1132.376) (-1130.323) * [-1131.447] (-1132.648) (-1130.822) (-1130.500) -- 0:00:25
613000 -- [-1130.376] (-1129.922) (-1130.951) (-1129.983) * [-1132.758] (-1130.663) (-1130.122) (-1131.336) -- 0:00:25
613500 -- (-1131.528) (-1131.525) (-1130.407) [-1129.647] * [-1129.953] (-1131.852) (-1130.255) (-1130.009) -- 0:00:25
614000 -- [-1131.604] (-1129.825) (-1136.182) (-1131.483) * [-1131.858] (-1133.485) (-1129.599) (-1131.847) -- 0:00:25
614500 -- (-1130.575) [-1131.057] (-1137.360) (-1133.597) * (-1131.968) [-1133.242] (-1133.742) (-1133.118) -- 0:00:25
615000 -- (-1129.949) [-1130.425] (-1140.227) (-1131.842) * (-1132.943) [-1131.758] (-1131.464) (-1130.443) -- 0:00:25
Average standard deviation of split frequencies: 0.012652
615500 -- (-1130.647) [-1135.353] (-1137.342) (-1135.171) * [-1131.306] (-1130.121) (-1132.747) (-1131.966) -- 0:00:25
616000 -- (-1131.426) [-1133.819] (-1136.950) (-1131.205) * [-1132.870] (-1131.349) (-1127.493) (-1131.139) -- 0:00:25
616500 -- (-1130.900) (-1132.932) (-1134.024) [-1134.769] * (-1133.507) (-1130.137) (-1129.884) [-1130.081] -- 0:00:25
617000 -- [-1133.046] (-1131.968) (-1130.890) (-1132.062) * (-1131.561) (-1127.905) (-1129.700) [-1130.328] -- 0:00:25
617500 -- [-1130.608] (-1132.147) (-1131.786) (-1132.146) * (-1132.464) (-1129.505) (-1128.392) [-1130.069] -- 0:00:25
618000 -- (-1131.639) [-1130.402] (-1134.269) (-1130.404) * (-1135.642) [-1130.170] (-1129.094) (-1132.975) -- 0:00:25
618500 -- (-1129.082) (-1130.233) [-1129.021] (-1133.038) * [-1130.930] (-1133.947) (-1128.715) (-1132.448) -- 0:00:25
619000 -- (-1128.746) [-1128.767] (-1131.902) (-1131.715) * (-1130.821) [-1129.643] (-1133.550) (-1133.303) -- 0:00:25
619500 -- (-1128.429) (-1132.381) [-1130.239] (-1132.751) * (-1130.763) [-1129.869] (-1133.612) (-1132.453) -- 0:00:25
620000 -- (-1129.736) (-1130.543) [-1133.801] (-1132.280) * (-1134.238) [-1128.445] (-1133.265) (-1132.279) -- 0:00:25
Average standard deviation of split frequencies: 0.012709
620500 -- (-1133.444) (-1131.075) [-1129.426] (-1130.353) * (-1132.665) [-1132.211] (-1130.668) (-1130.156) -- 0:00:25
621000 -- [-1131.784] (-1130.730) (-1131.468) (-1131.598) * (-1133.298) (-1133.390) [-1131.579] (-1130.393) -- 0:00:25
621500 -- (-1130.911) (-1131.184) (-1130.020) [-1130.393] * (-1130.412) (-1132.213) [-1134.003] (-1132.261) -- 0:00:24
622000 -- [-1130.089] (-1130.506) (-1129.216) (-1130.445) * (-1131.444) [-1130.686] (-1131.146) (-1132.124) -- 0:00:24
622500 -- (-1131.974) (-1131.779) (-1129.874) [-1131.263] * (-1140.764) [-1129.114] (-1130.619) (-1136.232) -- 0:00:24
623000 -- (-1131.049) [-1130.563] (-1131.497) (-1131.588) * (-1133.289) (-1129.322) [-1128.871] (-1130.655) -- 0:00:24
623500 -- (-1133.994) [-1132.450] (-1131.248) (-1133.011) * (-1136.087) [-1128.924] (-1133.310) (-1129.544) -- 0:00:24
624000 -- [-1131.189] (-1130.710) (-1130.001) (-1130.256) * (-1132.464) (-1134.546) (-1132.187) [-1134.221] -- 0:00:24
624500 -- (-1132.752) (-1131.321) [-1129.496] (-1132.211) * [-1130.909] (-1131.527) (-1132.351) (-1130.207) -- 0:00:24
625000 -- (-1130.704) (-1128.135) (-1128.574) [-1133.996] * [-1132.536] (-1133.303) (-1130.801) (-1129.439) -- 0:00:24
Average standard deviation of split frequencies: 0.012450
625500 -- (-1129.182) [-1128.282] (-1129.135) (-1130.575) * (-1129.938) (-1129.313) [-1132.091] (-1131.862) -- 0:00:25
626000 -- (-1131.495) (-1131.266) (-1129.800) [-1135.145] * [-1132.781] (-1129.763) (-1132.223) (-1131.372) -- 0:00:25
626500 -- [-1129.935] (-1130.743) (-1130.225) (-1130.622) * (-1130.094) [-1130.239] (-1132.053) (-1132.771) -- 0:00:25
627000 -- [-1132.179] (-1132.642) (-1130.839) (-1131.249) * (-1130.420) (-1131.664) (-1129.957) [-1129.017] -- 0:00:24
627500 -- [-1129.749] (-1132.018) (-1130.221) (-1137.659) * (-1134.632) [-1132.219] (-1132.752) (-1130.301) -- 0:00:24
628000 -- [-1129.823] (-1132.046) (-1131.071) (-1133.698) * (-1131.942) [-1129.286] (-1130.467) (-1131.918) -- 0:00:24
628500 -- (-1133.017) [-1131.377] (-1130.936) (-1129.330) * (-1131.911) [-1129.374] (-1131.265) (-1132.010) -- 0:00:24
629000 -- [-1129.714] (-1130.707) (-1131.447) (-1131.091) * [-1130.872] (-1131.105) (-1132.535) (-1131.116) -- 0:00:24
629500 -- (-1131.558) [-1130.573] (-1132.744) (-1130.617) * (-1135.787) (-1129.708) [-1130.801] (-1135.401) -- 0:00:24
630000 -- (-1130.033) [-1132.904] (-1131.000) (-1133.651) * (-1130.754) (-1129.838) [-1131.708] (-1130.482) -- 0:00:24
Average standard deviation of split frequencies: 0.012807
630500 -- (-1134.513) (-1130.807) [-1129.508] (-1132.904) * [-1130.674] (-1130.432) (-1130.651) (-1131.263) -- 0:00:24
631000 -- (-1131.890) (-1132.225) (-1130.353) [-1130.667] * (-1131.034) (-1130.774) (-1133.097) [-1130.740] -- 0:00:24
631500 -- (-1131.263) (-1133.686) (-1130.932) [-1130.729] * [-1130.825] (-1130.431) (-1131.253) (-1129.790) -- 0:00:24
632000 -- (-1132.291) (-1133.922) [-1130.003] (-1131.167) * (-1130.802) [-1131.664] (-1129.143) (-1130.199) -- 0:00:24
632500 -- [-1135.610] (-1132.916) (-1131.240) (-1132.563) * (-1129.923) (-1131.312) (-1130.509) [-1132.475] -- 0:00:24
633000 -- (-1130.492) [-1132.020] (-1131.657) (-1134.934) * (-1130.278) (-1131.460) (-1131.628) [-1130.504] -- 0:00:24
633500 -- (-1132.679) (-1130.734) [-1132.303] (-1135.020) * [-1131.175] (-1129.809) (-1138.345) (-1132.618) -- 0:00:24
634000 -- (-1130.538) (-1130.996) [-1131.606] (-1129.397) * (-1131.729) (-1132.091) [-1131.784] (-1129.526) -- 0:00:24
634500 -- [-1128.994] (-1127.874) (-1129.934) (-1130.043) * [-1131.881] (-1132.870) (-1130.477) (-1132.087) -- 0:00:24
635000 -- (-1130.603) (-1132.572) [-1130.406] (-1130.968) * [-1130.518] (-1132.600) (-1130.848) (-1129.858) -- 0:00:24
Average standard deviation of split frequencies: 0.012502
635500 -- [-1132.653] (-1130.070) (-1131.735) (-1130.415) * [-1133.468] (-1132.463) (-1132.412) (-1130.520) -- 0:00:24
636000 -- (-1132.192) (-1133.962) [-1130.832] (-1132.838) * (-1131.045) (-1137.946) [-1132.257] (-1129.860) -- 0:00:24
636500 -- (-1137.956) (-1128.935) (-1130.964) [-1130.614] * (-1131.937) (-1134.151) [-1129.286] (-1132.028) -- 0:00:23
637000 -- (-1134.490) (-1130.591) [-1129.619] (-1130.901) * [-1130.480] (-1133.650) (-1130.633) (-1130.271) -- 0:00:23
637500 -- (-1129.506) (-1133.959) (-1130.184) [-1133.122] * (-1130.987) [-1132.930] (-1133.359) (-1130.308) -- 0:00:23
638000 -- [-1129.747] (-1134.858) (-1130.054) (-1131.211) * (-1132.594) (-1132.103) [-1136.500] (-1129.810) -- 0:00:23
638500 -- (-1131.217) (-1135.146) (-1129.616) [-1131.120] * [-1134.100] (-1132.662) (-1132.874) (-1131.072) -- 0:00:23
639000 -- (-1130.648) (-1131.050) (-1134.173) [-1131.962] * (-1133.581) (-1133.366) (-1131.936) [-1131.030] -- 0:00:23
639500 -- (-1130.788) (-1129.357) [-1133.298] (-1130.818) * (-1132.141) (-1134.740) (-1134.116) [-1130.012] -- 0:00:23
640000 -- [-1128.309] (-1127.801) (-1130.025) (-1133.322) * (-1131.762) (-1133.599) (-1136.122) [-1132.271] -- 0:00:23
Average standard deviation of split frequencies: 0.012018
640500 -- (-1128.975) (-1129.947) [-1131.568] (-1133.474) * (-1132.471) [-1132.849] (-1134.614) (-1130.029) -- 0:00:24
641000 -- [-1130.471] (-1130.976) (-1131.200) (-1131.226) * (-1132.874) (-1132.224) (-1136.877) [-1129.212] -- 0:00:24
641500 -- [-1129.195] (-1132.799) (-1130.975) (-1131.763) * (-1133.560) [-1132.682] (-1129.533) (-1134.665) -- 0:00:24
642000 -- (-1129.209) [-1131.563] (-1129.461) (-1131.099) * (-1133.944) [-1131.765] (-1130.583) (-1131.259) -- 0:00:23
642500 -- [-1129.214] (-1132.851) (-1129.805) (-1129.505) * [-1134.026] (-1130.534) (-1130.793) (-1129.732) -- 0:00:23
643000 -- (-1131.128) (-1131.164) [-1128.377] (-1132.037) * (-1131.654) (-1130.753) [-1131.752] (-1132.234) -- 0:00:23
643500 -- (-1131.254) (-1131.812) [-1133.650] (-1130.785) * (-1132.148) (-1134.429) [-1129.656] (-1129.477) -- 0:00:23
644000 -- (-1134.088) (-1131.218) (-1131.130) [-1132.145] * (-1133.356) (-1133.321) [-1132.922] (-1129.489) -- 0:00:23
644500 -- (-1133.333) (-1132.430) (-1129.527) [-1134.313] * (-1130.858) (-1131.633) (-1138.188) [-1128.697] -- 0:00:23
645000 -- (-1134.073) (-1131.295) (-1129.608) [-1130.900] * (-1131.535) [-1130.804] (-1135.116) (-1134.938) -- 0:00:23
Average standard deviation of split frequencies: 0.011578
645500 -- (-1130.735) (-1130.848) [-1131.099] (-1131.929) * (-1131.527) [-1133.252] (-1131.804) (-1130.642) -- 0:00:23
646000 -- (-1132.667) (-1129.628) [-1129.805] (-1132.906) * (-1134.167) [-1130.657] (-1130.821) (-1130.457) -- 0:00:23
646500 -- [-1132.116] (-1130.008) (-1131.063) (-1130.770) * (-1134.381) (-1130.344) (-1133.193) [-1133.053] -- 0:00:23
647000 -- (-1130.153) (-1132.102) (-1132.993) [-1131.613] * (-1135.245) (-1130.831) [-1131.514] (-1129.964) -- 0:00:23
647500 -- (-1132.572) (-1130.801) (-1129.908) [-1132.633] * (-1135.364) (-1128.992) [-1130.349] (-1132.525) -- 0:00:23
648000 -- [-1129.856] (-1129.117) (-1130.105) (-1136.689) * (-1135.025) [-1128.766] (-1131.393) (-1130.473) -- 0:00:23
648500 -- [-1129.736] (-1131.948) (-1130.548) (-1132.079) * (-1136.369) [-1130.811] (-1133.357) (-1130.224) -- 0:00:23
649000 -- (-1129.395) [-1128.960] (-1129.211) (-1131.732) * (-1134.505) (-1130.343) (-1132.078) [-1128.050] -- 0:00:23
649500 -- (-1130.786) (-1130.834) (-1133.613) [-1131.683] * (-1130.979) [-1130.198] (-1132.413) (-1129.338) -- 0:00:23
650000 -- [-1129.419] (-1128.577) (-1135.361) (-1132.535) * (-1130.539) [-1127.976] (-1130.753) (-1131.525) -- 0:00:23
Average standard deviation of split frequencies: 0.012220
650500 -- (-1132.482) (-1132.123) [-1130.944] (-1133.565) * [-1131.864] (-1131.526) (-1134.504) (-1129.603) -- 0:00:23
651000 -- (-1128.565) (-1131.472) [-1129.927] (-1133.519) * (-1131.439) [-1127.709] (-1129.617) (-1130.431) -- 0:00:23
651500 -- [-1130.500] (-1130.718) (-1136.071) (-1129.752) * (-1130.147) [-1131.865] (-1130.415) (-1132.514) -- 0:00:23
652000 -- [-1130.766] (-1132.595) (-1133.205) (-1130.698) * [-1131.057] (-1131.107) (-1132.672) (-1132.209) -- 0:00:22
652500 -- (-1132.723) (-1132.290) (-1131.913) [-1133.498] * (-1133.057) [-1130.567] (-1135.083) (-1130.443) -- 0:00:22
653000 -- (-1133.210) (-1130.922) [-1130.047] (-1132.844) * (-1134.727) [-1129.881] (-1133.734) (-1129.452) -- 0:00:22
653500 -- (-1134.603) [-1132.136] (-1128.528) (-1132.863) * (-1130.674) (-1133.970) [-1130.601] (-1131.292) -- 0:00:22
654000 -- (-1132.407) (-1133.530) [-1129.893] (-1130.871) * [-1134.681] (-1129.065) (-1129.973) (-1133.393) -- 0:00:22
654500 -- [-1132.825] (-1133.355) (-1130.373) (-1130.661) * (-1136.024) (-1129.296) [-1132.265] (-1130.693) -- 0:00:22
655000 -- (-1130.727) [-1132.137] (-1130.358) (-1133.803) * (-1133.581) (-1128.219) (-1131.145) [-1131.157] -- 0:00:22
Average standard deviation of split frequencies: 0.011881
655500 -- (-1131.762) (-1138.418) [-1128.055] (-1131.220) * (-1131.320) (-1130.100) [-1130.367] (-1130.854) -- 0:00:23
656000 -- (-1130.356) (-1129.305) (-1131.282) [-1131.974] * (-1132.030) [-1128.241] (-1130.344) (-1128.610) -- 0:00:23
656500 -- (-1129.844) (-1135.271) [-1129.838] (-1138.180) * (-1132.074) (-1130.495) (-1131.556) [-1130.196] -- 0:00:23
657000 -- (-1132.080) (-1130.556) [-1132.475] (-1130.559) * (-1132.259) [-1130.618] (-1133.273) (-1130.576) -- 0:00:22
657500 -- (-1132.449) (-1130.502) [-1131.455] (-1138.375) * (-1134.088) (-1131.698) (-1129.681) [-1131.373] -- 0:00:22
658000 -- (-1130.510) [-1131.691] (-1132.082) (-1131.638) * [-1136.354] (-1129.339) (-1131.039) (-1132.849) -- 0:00:22
658500 -- [-1131.379] (-1130.370) (-1132.377) (-1131.418) * (-1134.133) [-1134.482] (-1131.170) (-1134.668) -- 0:00:22
659000 -- (-1134.049) [-1132.679] (-1131.446) (-1135.375) * (-1131.044) (-1135.968) (-1131.568) [-1130.503] -- 0:00:22
659500 -- (-1130.550) (-1133.431) (-1132.141) [-1131.348] * (-1133.333) (-1130.068) [-1129.452] (-1133.890) -- 0:00:22
660000 -- (-1131.607) (-1131.819) (-1130.475) [-1131.847] * (-1132.219) [-1130.810] (-1130.085) (-1131.986) -- 0:00:22
Average standard deviation of split frequencies: 0.011416
660500 -- (-1130.050) (-1133.410) (-1134.923) [-1132.041] * (-1130.875) (-1130.217) [-1132.945] (-1133.451) -- 0:00:22
661000 -- [-1130.029] (-1131.326) (-1131.235) (-1132.784) * (-1129.403) [-1128.156] (-1133.603) (-1132.091) -- 0:00:22
661500 -- [-1130.544] (-1133.238) (-1132.190) (-1130.623) * (-1131.442) [-1133.029] (-1130.368) (-1134.692) -- 0:00:22
662000 -- (-1131.674) [-1133.067] (-1129.855) (-1131.612) * (-1135.774) (-1132.590) [-1131.535] (-1131.739) -- 0:00:22
662500 -- (-1132.279) (-1131.400) [-1132.449] (-1131.084) * (-1135.999) (-1132.292) [-1128.865] (-1134.882) -- 0:00:22
663000 -- (-1133.625) (-1130.274) (-1131.533) [-1131.543] * (-1130.225) (-1130.248) [-1132.410] (-1130.304) -- 0:00:22
663500 -- [-1131.041] (-1130.370) (-1131.969) (-1132.748) * (-1129.875) (-1130.958) (-1133.016) [-1129.510] -- 0:00:22
664000 -- [-1130.121] (-1130.395) (-1130.070) (-1133.428) * [-1132.422] (-1130.088) (-1133.371) (-1134.782) -- 0:00:22
664500 -- (-1130.868) (-1131.249) (-1131.329) [-1131.396] * (-1128.999) [-1131.099] (-1136.117) (-1131.654) -- 0:00:22
665000 -- [-1129.600] (-1130.808) (-1136.489) (-1131.812) * (-1131.711) (-1130.955) (-1136.652) [-1131.146] -- 0:00:22
Average standard deviation of split frequencies: 0.011655
665500 -- (-1131.419) (-1129.435) [-1131.378] (-1134.389) * (-1134.178) [-1130.257] (-1132.819) (-1132.864) -- 0:00:22
666000 -- (-1133.447) (-1132.356) [-1129.135] (-1131.844) * [-1128.212] (-1129.430) (-1131.011) (-1136.631) -- 0:00:22
666500 -- (-1131.339) (-1130.889) [-1131.436] (-1132.777) * (-1130.124) (-1128.630) [-1130.802] (-1134.165) -- 0:00:22
667000 -- [-1130.855] (-1133.016) (-1131.328) (-1139.453) * (-1129.801) [-1131.613] (-1131.842) (-1131.289) -- 0:00:21
667500 -- (-1131.425) (-1132.807) (-1133.170) [-1130.198] * [-1128.679] (-1129.575) (-1134.296) (-1131.555) -- 0:00:21
668000 -- [-1129.941] (-1135.689) (-1132.153) (-1132.794) * (-1131.068) (-1131.817) [-1130.029] (-1131.400) -- 0:00:21
668500 -- (-1131.024) (-1134.811) (-1132.350) [-1131.005] * (-1129.194) (-1129.263) [-1131.040] (-1132.873) -- 0:00:21
669000 -- (-1129.862) (-1133.329) [-1132.304] (-1129.294) * [-1130.829] (-1131.636) (-1130.831) (-1132.431) -- 0:00:21
669500 -- (-1135.776) (-1130.472) (-1129.878) [-1129.908] * (-1130.085) [-1128.558] (-1130.601) (-1131.363) -- 0:00:21
670000 -- (-1130.782) (-1129.318) [-1130.172] (-1130.411) * [-1132.308] (-1129.514) (-1132.528) (-1130.704) -- 0:00:21
Average standard deviation of split frequencies: 0.011949
670500 -- (-1130.915) (-1129.919) [-1128.150] (-1130.299) * (-1131.948) (-1128.044) (-1132.222) [-1131.337] -- 0:00:21
671000 -- (-1131.843) (-1134.337) [-1130.312] (-1132.126) * (-1134.556) (-1132.477) (-1130.649) [-1131.669] -- 0:00:22
671500 -- (-1136.276) [-1134.844] (-1132.704) (-1132.620) * (-1132.080) (-1132.735) (-1133.680) [-1132.839] -- 0:00:22
672000 -- (-1130.961) [-1131.790] (-1130.536) (-1133.035) * (-1131.678) (-1134.280) [-1133.470] (-1133.371) -- 0:00:21
672500 -- (-1129.496) [-1129.760] (-1131.516) (-1130.589) * [-1129.662] (-1135.370) (-1131.815) (-1131.334) -- 0:00:21
673000 -- (-1130.846) (-1131.163) (-1131.760) [-1130.062] * (-1131.425) [-1130.232] (-1131.273) (-1131.181) -- 0:00:21
673500 -- [-1129.055] (-1131.865) (-1130.670) (-1134.069) * (-1131.903) (-1131.540) (-1130.248) [-1131.590] -- 0:00:21
674000 -- (-1130.941) [-1129.339] (-1130.504) (-1130.386) * (-1133.012) (-1130.332) (-1132.100) [-1133.478] -- 0:00:21
674500 -- [-1131.466] (-1132.795) (-1135.118) (-1130.440) * [-1132.988] (-1128.853) (-1131.916) (-1130.618) -- 0:00:21
675000 -- [-1131.898] (-1131.538) (-1132.737) (-1131.888) * [-1128.859] (-1129.773) (-1130.555) (-1134.976) -- 0:00:21
Average standard deviation of split frequencies: 0.012227
675500 -- (-1130.962) (-1130.016) [-1129.187] (-1129.619) * (-1132.178) [-1132.880] (-1131.274) (-1132.446) -- 0:00:21
676000 -- (-1130.734) (-1128.942) (-1128.621) [-1130.407] * (-1136.202) (-1135.943) (-1134.305) [-1129.957] -- 0:00:21
676500 -- (-1127.877) (-1131.248) [-1130.587] (-1130.941) * [-1131.829] (-1131.935) (-1133.093) (-1130.300) -- 0:00:21
677000 -- (-1130.500) [-1128.092] (-1129.827) (-1131.666) * [-1128.844] (-1132.316) (-1132.651) (-1132.047) -- 0:00:21
677500 -- [-1133.712] (-1132.050) (-1135.211) (-1131.059) * [-1130.077] (-1132.210) (-1133.504) (-1133.371) -- 0:00:21
678000 -- [-1131.493] (-1129.338) (-1129.746) (-1132.932) * (-1130.884) [-1129.962] (-1135.523) (-1132.111) -- 0:00:21
678500 -- [-1131.738] (-1130.896) (-1133.883) (-1130.757) * (-1130.634) (-1129.510) (-1131.014) [-1133.355] -- 0:00:21
679000 -- (-1131.735) [-1128.645] (-1138.019) (-1129.187) * (-1131.546) (-1129.950) (-1132.585) [-1133.084] -- 0:00:21
679500 -- [-1132.284] (-1131.454) (-1136.628) (-1129.914) * (-1132.472) (-1130.009) (-1132.863) [-1132.145] -- 0:00:21
680000 -- (-1130.303) (-1128.421) [-1132.082] (-1132.234) * [-1133.241] (-1131.001) (-1133.075) (-1131.292) -- 0:00:21
Average standard deviation of split frequencies: 0.011681
680500 -- (-1129.554) [-1131.576] (-1131.354) (-1132.052) * [-1131.813] (-1131.634) (-1134.461) (-1130.674) -- 0:00:21
681000 -- [-1128.578] (-1133.046) (-1134.050) (-1132.306) * [-1130.427] (-1129.205) (-1130.859) (-1133.457) -- 0:00:21
681500 -- [-1129.029] (-1135.823) (-1133.048) (-1130.159) * [-1130.302] (-1131.883) (-1130.861) (-1133.517) -- 0:00:21
682000 -- (-1130.943) [-1131.817] (-1134.402) (-1131.854) * (-1130.452) (-1133.720) (-1135.713) [-1132.520] -- 0:00:20
682500 -- [-1130.307] (-1128.058) (-1132.663) (-1131.148) * (-1131.069) (-1131.125) (-1134.957) [-1129.243] -- 0:00:20
683000 -- (-1132.317) (-1131.120) [-1132.355] (-1131.346) * (-1133.845) (-1130.633) (-1132.103) [-1131.339] -- 0:00:20
683500 -- (-1132.687) (-1134.408) [-1130.655] (-1130.850) * (-1132.326) (-1134.232) (-1134.387) [-1131.135] -- 0:00:20
684000 -- (-1136.661) (-1132.490) (-1136.937) [-1130.252] * (-1133.161) (-1134.283) (-1129.610) [-1131.620] -- 0:00:20
684500 -- [-1136.676] (-1130.779) (-1137.476) (-1129.257) * (-1132.289) (-1135.703) [-1129.891] (-1133.204) -- 0:00:20
685000 -- (-1130.917) (-1130.975) [-1132.352] (-1134.443) * (-1131.414) (-1129.840) (-1131.645) [-1131.953] -- 0:00:20
Average standard deviation of split frequencies: 0.011407
685500 -- (-1130.611) [-1128.828] (-1131.360) (-1133.765) * (-1131.086) (-1130.477) [-1131.632] (-1131.890) -- 0:00:20
686000 -- (-1130.757) [-1131.609] (-1133.650) (-1130.293) * (-1131.991) [-1130.954] (-1130.227) (-1133.372) -- 0:00:21
686500 -- (-1131.686) (-1130.261) (-1137.469) [-1131.761] * (-1132.482) (-1133.750) (-1131.023) [-1132.431] -- 0:00:21
687000 -- (-1131.974) (-1130.369) [-1130.987] (-1131.601) * [-1128.174] (-1133.454) (-1131.474) (-1130.358) -- 0:00:20
687500 -- (-1130.315) (-1129.039) (-1133.848) [-1131.992] * [-1129.910] (-1132.371) (-1129.935) (-1131.608) -- 0:00:20
688000 -- [-1131.611] (-1131.071) (-1130.448) (-1132.676) * (-1131.029) (-1131.049) (-1133.674) [-1131.911] -- 0:00:20
688500 -- (-1130.449) [-1129.798] (-1131.549) (-1133.150) * (-1130.711) (-1131.151) [-1131.134] (-1129.828) -- 0:00:20
689000 -- (-1131.736) (-1131.651) [-1132.273] (-1131.111) * (-1132.231) (-1130.768) (-1130.143) [-1129.268] -- 0:00:20
689500 -- (-1132.701) (-1127.917) [-1131.775] (-1131.254) * (-1130.858) [-1135.056] (-1130.967) (-1130.971) -- 0:00:20
690000 -- (-1133.758) [-1133.774] (-1130.667) (-1130.704) * (-1133.968) (-1132.639) [-1132.242] (-1130.592) -- 0:00:20
Average standard deviation of split frequencies: 0.011649
690500 -- (-1131.054) [-1130.884] (-1129.204) (-1132.137) * [-1129.992] (-1134.990) (-1129.335) (-1128.264) -- 0:00:20
691000 -- (-1130.214) [-1135.002] (-1133.416) (-1136.457) * [-1129.733] (-1131.154) (-1130.919) (-1129.687) -- 0:00:20
691500 -- (-1132.642) (-1128.134) [-1132.307] (-1131.119) * (-1131.941) (-1128.552) [-1131.789] (-1131.149) -- 0:00:20
692000 -- (-1133.276) [-1128.721] (-1130.156) (-1131.064) * (-1131.565) (-1130.712) (-1131.671) [-1128.993] -- 0:00:20
692500 -- (-1131.597) [-1129.124] (-1131.580) (-1131.765) * (-1132.063) (-1131.323) (-1131.523) [-1132.440] -- 0:00:20
693000 -- [-1130.737] (-1130.975) (-1133.399) (-1133.609) * [-1129.654] (-1132.280) (-1130.875) (-1130.372) -- 0:00:20
693500 -- (-1131.177) (-1129.214) [-1131.679] (-1131.490) * (-1131.782) (-1133.873) (-1131.555) [-1129.996] -- 0:00:20
694000 -- (-1131.192) (-1128.800) [-1129.999] (-1130.550) * (-1130.792) (-1129.995) (-1132.616) [-1131.460] -- 0:00:20
694500 -- (-1131.415) [-1132.992] (-1132.834) (-1132.519) * (-1131.900) (-1130.690) (-1134.391) [-1130.896] -- 0:00:20
695000 -- [-1129.849] (-1128.318) (-1130.015) (-1133.749) * (-1132.359) (-1130.831) (-1130.569) [-1132.258] -- 0:00:20
Average standard deviation of split frequencies: 0.011650
695500 -- [-1129.714] (-1130.927) (-1130.962) (-1134.393) * [-1131.737] (-1130.186) (-1131.485) (-1131.521) -- 0:00:20
696000 -- (-1135.108) [-1128.617] (-1129.858) (-1132.360) * [-1129.568] (-1128.878) (-1129.206) (-1131.935) -- 0:00:20
696500 -- [-1131.053] (-1129.390) (-1131.450) (-1131.430) * (-1133.009) (-1131.754) (-1130.976) [-1130.646] -- 0:00:20
697000 -- (-1131.769) (-1129.865) [-1130.927] (-1132.375) * [-1131.778] (-1131.166) (-1130.656) (-1130.629) -- 0:00:19
697500 -- (-1134.714) [-1129.175] (-1128.640) (-1133.964) * (-1131.456) [-1132.621] (-1130.872) (-1133.862) -- 0:00:19
698000 -- [-1130.001] (-1131.389) (-1129.752) (-1135.811) * (-1131.435) (-1135.386) [-1134.252] (-1131.261) -- 0:00:19
698500 -- (-1130.675) [-1131.491] (-1131.257) (-1131.636) * [-1130.597] (-1132.986) (-1130.760) (-1131.327) -- 0:00:19
699000 -- (-1130.771) (-1129.241) (-1134.047) [-1131.489] * (-1130.462) [-1130.668] (-1133.195) (-1131.610) -- 0:00:19
699500 -- (-1137.086) [-1132.469] (-1134.069) (-1130.475) * [-1129.405] (-1133.398) (-1132.160) (-1131.756) -- 0:00:19
700000 -- (-1132.462) [-1129.266] (-1134.518) (-1129.861) * [-1128.825] (-1133.828) (-1132.052) (-1132.620) -- 0:00:19
Average standard deviation of split frequencies: 0.011124
700500 -- (-1131.585) (-1131.219) [-1130.375] (-1130.779) * [-1129.532] (-1130.012) (-1134.102) (-1136.739) -- 0:00:19
701000 -- (-1136.209) [-1133.243] (-1129.659) (-1130.703) * [-1131.765] (-1127.830) (-1131.954) (-1133.889) -- 0:00:20
701500 -- [-1138.219] (-1130.054) (-1131.328) (-1131.451) * (-1130.333) (-1130.238) (-1131.970) [-1131.612] -- 0:00:19
702000 -- [-1130.619] (-1135.469) (-1133.321) (-1132.040) * (-1130.843) (-1131.852) [-1130.018] (-1132.697) -- 0:00:19
702500 -- [-1131.149] (-1132.169) (-1132.116) (-1131.977) * (-1131.571) (-1131.046) (-1131.935) [-1130.505] -- 0:00:19
703000 -- (-1129.351) (-1129.423) [-1130.855] (-1131.125) * (-1132.103) (-1130.310) [-1130.051] (-1131.429) -- 0:00:19
703500 -- [-1131.721] (-1130.305) (-1130.972) (-1134.753) * [-1130.498] (-1131.740) (-1130.768) (-1129.859) -- 0:00:19
704000 -- (-1132.834) [-1134.520] (-1132.977) (-1135.387) * [-1132.906] (-1131.374) (-1131.320) (-1134.931) -- 0:00:19
704500 -- [-1130.396] (-1130.766) (-1133.419) (-1131.506) * (-1133.159) (-1130.929) (-1131.302) [-1130.954] -- 0:00:19
705000 -- [-1129.567] (-1129.522) (-1131.779) (-1131.279) * (-1132.293) (-1131.965) (-1129.866) [-1132.892] -- 0:00:19
Average standard deviation of split frequencies: 0.011440
705500 -- (-1135.788) (-1133.162) [-1133.113] (-1131.548) * (-1135.022) (-1130.690) [-1130.637] (-1131.277) -- 0:00:19
706000 -- [-1133.057] (-1133.622) (-1130.287) (-1132.590) * (-1133.150) (-1128.250) (-1129.946) [-1133.598] -- 0:00:19
706500 -- (-1132.437) (-1133.172) (-1130.586) [-1131.120] * (-1133.771) [-1132.003] (-1129.080) (-1132.961) -- 0:00:19
707000 -- (-1133.393) (-1132.226) (-1134.574) [-1129.403] * (-1131.431) [-1131.828] (-1130.397) (-1133.339) -- 0:00:19
707500 -- [-1130.018] (-1132.518) (-1132.618) (-1133.308) * (-1135.528) (-1132.431) (-1133.452) [-1133.143] -- 0:00:19
708000 -- [-1132.426] (-1130.529) (-1132.699) (-1131.194) * (-1133.010) [-1130.516] (-1128.377) (-1132.853) -- 0:00:19
708500 -- (-1130.223) (-1130.110) [-1132.097] (-1132.835) * [-1130.241] (-1137.819) (-1127.350) (-1132.808) -- 0:00:19
709000 -- [-1130.065] (-1132.392) (-1131.206) (-1129.735) * (-1132.646) (-1133.868) [-1130.717] (-1131.156) -- 0:00:19
709500 -- (-1128.907) [-1133.684] (-1131.395) (-1130.869) * (-1130.664) (-1129.347) [-1132.425] (-1130.903) -- 0:00:19
710000 -- (-1132.268) (-1131.305) (-1131.736) [-1131.766] * (-1132.682) [-1130.458] (-1128.612) (-1129.618) -- 0:00:19
Average standard deviation of split frequencies: 0.011365
710500 -- (-1131.301) (-1133.347) [-1132.262] (-1129.881) * (-1132.712) (-1130.604) [-1130.414] (-1133.077) -- 0:00:19
711000 -- (-1130.611) (-1133.149) [-1131.705] (-1128.428) * (-1131.929) [-1133.732] (-1129.472) (-1131.044) -- 0:00:19
711500 -- (-1130.968) (-1130.707) (-1131.793) [-1128.561] * (-1130.584) (-1127.618) [-1130.818] (-1136.500) -- 0:00:19
712000 -- (-1133.156) (-1131.203) [-1130.020] (-1131.110) * (-1133.981) (-1132.181) (-1130.065) [-1129.713] -- 0:00:19
712500 -- (-1133.563) (-1130.976) [-1133.495] (-1131.842) * [-1132.004] (-1129.040) (-1129.999) (-1131.646) -- 0:00:18
713000 -- (-1129.364) (-1133.077) [-1130.942] (-1133.367) * (-1128.840) [-1128.349] (-1130.598) (-1135.325) -- 0:00:18
713500 -- (-1131.730) (-1131.817) (-1131.807) [-1129.522] * [-1131.263] (-1131.361) (-1136.165) (-1134.682) -- 0:00:18
714000 -- [-1132.410] (-1133.531) (-1129.300) (-1130.509) * (-1130.585) [-1130.325] (-1132.472) (-1134.898) -- 0:00:18
714500 -- (-1135.105) (-1131.832) [-1130.836] (-1129.800) * (-1129.629) (-1131.600) [-1137.469] (-1129.949) -- 0:00:18
715000 -- [-1130.350] (-1132.466) (-1131.488) (-1132.342) * (-1131.086) (-1128.910) [-1130.054] (-1133.098) -- 0:00:18
Average standard deviation of split frequencies: 0.011719
715500 -- (-1131.473) (-1132.095) (-1133.295) [-1132.161] * (-1128.427) (-1131.094) (-1129.980) [-1132.259] -- 0:00:18
716000 -- (-1131.388) (-1134.280) (-1133.904) [-1133.809] * (-1130.413) (-1136.952) [-1129.618] (-1132.706) -- 0:00:18
716500 -- (-1135.247) [-1133.052] (-1133.855) (-1131.098) * (-1129.496) (-1131.509) [-1134.167] (-1129.937) -- 0:00:18
717000 -- (-1132.170) [-1131.409] (-1130.021) (-1131.433) * (-1131.447) [-1132.655] (-1130.059) (-1130.700) -- 0:00:18
717500 -- (-1129.984) (-1132.872) [-1131.844] (-1130.669) * (-1130.872) [-1130.664] (-1131.129) (-1135.289) -- 0:00:18
718000 -- (-1131.700) (-1134.646) (-1132.449) [-1128.076] * (-1132.059) (-1132.076) (-1131.125) [-1129.508] -- 0:00:18
718500 -- (-1135.341) (-1131.401) (-1132.246) [-1131.253] * [-1131.119] (-1132.566) (-1131.214) (-1131.699) -- 0:00:18
719000 -- (-1132.622) (-1131.752) [-1134.741] (-1131.788) * (-1130.148) (-1131.140) [-1130.601] (-1139.012) -- 0:00:18
719500 -- [-1133.306] (-1130.946) (-1134.920) (-1134.246) * (-1131.587) [-1131.631] (-1129.945) (-1137.802) -- 0:00:18
720000 -- (-1129.726) (-1133.903) (-1133.966) [-1131.391] * (-1128.362) (-1131.537) [-1129.347] (-1130.339) -- 0:00:18
Average standard deviation of split frequencies: 0.011818
720500 -- [-1130.773] (-1128.784) (-1132.681) (-1130.686) * (-1133.087) [-1133.950] (-1130.412) (-1130.592) -- 0:00:18
721000 -- (-1131.366) (-1130.532) [-1131.920] (-1129.758) * [-1136.206] (-1129.598) (-1130.322) (-1131.313) -- 0:00:18
721500 -- [-1132.005] (-1131.664) (-1130.306) (-1130.193) * (-1131.622) (-1132.690) [-1130.096] (-1133.949) -- 0:00:18
722000 -- (-1129.536) [-1130.833] (-1131.226) (-1130.038) * (-1133.401) (-1130.850) [-1127.682] (-1132.648) -- 0:00:18
722500 -- (-1133.298) (-1129.577) [-1131.264] (-1131.545) * (-1131.898) [-1132.165] (-1130.263) (-1132.152) -- 0:00:18
723000 -- (-1131.443) (-1128.874) (-1131.002) [-1131.053] * (-1131.378) (-1135.480) [-1132.467] (-1131.130) -- 0:00:18
723500 -- (-1129.545) (-1129.878) [-1131.634] (-1128.648) * [-1132.755] (-1132.527) (-1129.159) (-1132.853) -- 0:00:18
724000 -- (-1130.660) (-1134.564) [-1130.023] (-1130.429) * (-1132.527) [-1131.529] (-1134.532) (-1131.865) -- 0:00:18
724500 -- [-1134.035] (-1134.282) (-1131.504) (-1133.077) * (-1130.725) (-1130.750) (-1130.523) [-1129.089] -- 0:00:18
725000 -- (-1133.597) (-1138.106) (-1132.848) [-1131.251] * (-1129.262) (-1131.538) [-1130.321] (-1131.325) -- 0:00:18
Average standard deviation of split frequencies: 0.011688
725500 -- (-1133.528) [-1131.611] (-1131.788) (-1133.608) * (-1130.437) (-1132.482) (-1133.123) [-1131.888] -- 0:00:18
726000 -- (-1132.679) (-1131.278) [-1132.035] (-1131.156) * (-1137.566) (-1129.719) [-1129.815] (-1133.780) -- 0:00:18
726500 -- (-1130.744) (-1132.052) [-1132.852] (-1131.385) * [-1130.420] (-1131.677) (-1131.136) (-1130.861) -- 0:00:18
727000 -- [-1131.295] (-1132.498) (-1139.878) (-1130.948) * (-1130.680) [-1130.848] (-1132.859) (-1129.881) -- 0:00:18
727500 -- (-1129.304) (-1131.909) [-1133.015] (-1131.419) * (-1135.201) (-1131.185) [-1129.452] (-1129.152) -- 0:00:17
728000 -- (-1131.574) (-1130.947) (-1131.902) [-1135.011] * (-1129.487) [-1132.830] (-1131.050) (-1133.897) -- 0:00:17
728500 -- [-1129.648] (-1128.735) (-1130.672) (-1135.689) * [-1131.848] (-1131.409) (-1131.346) (-1131.063) -- 0:00:17
729000 -- [-1127.277] (-1129.595) (-1131.791) (-1135.413) * (-1130.366) (-1129.743) [-1129.830] (-1129.797) -- 0:00:17
729500 -- (-1131.980) [-1130.997] (-1131.542) (-1133.557) * (-1133.692) (-1133.263) (-1132.099) [-1128.733] -- 0:00:17
730000 -- (-1133.702) [-1131.678] (-1131.474) (-1131.843) * [-1132.217] (-1131.537) (-1132.695) (-1133.409) -- 0:00:17
Average standard deviation of split frequencies: 0.011527
730500 -- (-1132.443) (-1131.749) [-1134.019] (-1131.212) * [-1131.900] (-1133.399) (-1131.107) (-1132.551) -- 0:00:17
731000 -- [-1131.829] (-1131.610) (-1132.366) (-1133.764) * (-1130.787) (-1132.720) [-1127.876] (-1128.274) -- 0:00:17
731500 -- (-1131.835) [-1130.764] (-1130.864) (-1130.821) * (-1130.426) [-1131.902] (-1132.417) (-1128.821) -- 0:00:17
732000 -- (-1131.531) (-1129.392) (-1132.031) [-1131.273] * (-1128.954) (-1133.220) (-1130.495) [-1130.031] -- 0:00:17
732500 -- (-1136.155) (-1128.454) (-1130.814) [-1132.076] * (-1131.720) (-1136.544) [-1131.059] (-1129.023) -- 0:00:17
733000 -- [-1130.760] (-1129.124) (-1132.631) (-1131.837) * (-1136.996) (-1128.862) (-1131.989) [-1132.016] -- 0:00:17
733500 -- (-1129.025) [-1128.705] (-1133.898) (-1131.526) * [-1131.397] (-1131.258) (-1130.425) (-1133.917) -- 0:00:17
734000 -- [-1130.266] (-1132.475) (-1130.184) (-1130.987) * (-1132.026) (-1130.542) [-1129.884] (-1129.285) -- 0:00:17
734500 -- [-1129.545] (-1131.100) (-1136.044) (-1130.663) * (-1134.143) [-1130.573] (-1130.881) (-1130.032) -- 0:00:17
735000 -- (-1131.866) (-1130.393) (-1130.248) [-1129.945] * [-1131.163] (-1129.619) (-1130.879) (-1130.390) -- 0:00:17
Average standard deviation of split frequencies: 0.011700
735500 -- [-1131.103] (-1131.697) (-1128.994) (-1132.378) * (-1131.514) (-1133.261) [-1130.099] (-1134.523) -- 0:00:17
736000 -- [-1131.461] (-1131.170) (-1131.248) (-1130.506) * [-1131.086] (-1132.119) (-1128.596) (-1136.534) -- 0:00:17
736500 -- [-1129.648] (-1130.470) (-1130.204) (-1131.857) * [-1131.452] (-1133.473) (-1133.370) (-1132.156) -- 0:00:17
737000 -- (-1129.915) [-1130.572] (-1130.915) (-1139.683) * [-1133.505] (-1131.599) (-1128.719) (-1132.645) -- 0:00:17
737500 -- (-1129.147) [-1129.592] (-1131.186) (-1134.171) * (-1132.891) (-1134.774) [-1132.620] (-1131.160) -- 0:00:17
738000 -- (-1135.536) [-1129.323] (-1132.613) (-1131.448) * (-1130.394) (-1129.727) (-1135.447) [-1132.544] -- 0:00:17
738500 -- (-1134.473) (-1129.302) [-1131.078] (-1131.135) * (-1129.350) [-1130.356] (-1132.243) (-1129.095) -- 0:00:17
739000 -- (-1133.712) (-1132.785) (-1131.919) [-1133.128] * (-1130.562) (-1130.638) (-1132.074) [-1128.989] -- 0:00:17
739500 -- (-1130.024) (-1134.568) (-1130.767) [-1132.812] * [-1130.139] (-1129.641) (-1130.725) (-1129.380) -- 0:00:17
740000 -- (-1130.662) [-1129.468] (-1131.039) (-1129.903) * (-1130.229) (-1132.025) [-1129.633] (-1132.788) -- 0:00:17
Average standard deviation of split frequencies: 0.011414
740500 -- (-1132.328) (-1132.415) (-1130.313) [-1131.141] * (-1136.003) (-1131.688) (-1132.304) [-1131.624] -- 0:00:17
741000 -- (-1142.153) (-1131.628) (-1134.546) [-1132.242] * (-1132.994) [-1131.151] (-1128.542) (-1129.831) -- 0:00:17
741500 -- (-1137.012) [-1131.731] (-1131.160) (-1132.078) * (-1132.493) (-1134.545) [-1130.863] (-1128.935) -- 0:00:17
742000 -- (-1139.442) (-1129.028) (-1131.307) [-1131.725] * (-1132.427) [-1129.953] (-1132.556) (-1135.236) -- 0:00:17
742500 -- (-1129.161) (-1131.754) (-1131.274) [-1130.702] * [-1131.759] (-1135.872) (-1134.542) (-1137.702) -- 0:00:16
743000 -- (-1128.713) (-1127.596) [-1130.614] (-1133.184) * (-1130.900) (-1134.112) [-1131.718] (-1131.401) -- 0:00:16
743500 -- [-1131.176] (-1129.535) (-1131.886) (-1135.142) * (-1131.335) (-1133.494) [-1129.343] (-1127.774) -- 0:00:16
744000 -- (-1131.555) (-1133.911) (-1133.378) [-1132.045] * (-1136.094) (-1133.843) [-1133.258] (-1130.140) -- 0:00:16
744500 -- (-1128.684) [-1132.108] (-1133.729) (-1133.125) * (-1135.598) (-1132.672) [-1129.885] (-1129.558) -- 0:00:16
745000 -- (-1130.168) (-1128.228) [-1128.881] (-1133.523) * (-1131.621) (-1131.576) (-1131.124) [-1132.695] -- 0:00:16
Average standard deviation of split frequencies: 0.010574
745500 -- (-1131.457) [-1130.832] (-1130.261) (-1131.426) * (-1130.832) (-1132.614) (-1138.040) [-1131.517] -- 0:00:16
746000 -- (-1133.644) (-1132.313) (-1132.571) [-1130.843] * (-1132.843) [-1131.950] (-1132.151) (-1132.876) -- 0:00:16
746500 -- [-1131.397] (-1132.939) (-1130.682) (-1133.255) * (-1137.679) (-1131.516) [-1130.237] (-1130.385) -- 0:00:16
747000 -- [-1135.064] (-1131.261) (-1133.210) (-1130.636) * (-1136.055) [-1130.655] (-1129.267) (-1133.033) -- 0:00:16
747500 -- (-1129.262) [-1129.618] (-1134.501) (-1132.217) * (-1136.314) [-1130.615] (-1131.648) (-1132.611) -- 0:00:16
748000 -- (-1134.487) (-1129.381) [-1134.428] (-1133.273) * (-1144.897) (-1130.536) (-1129.660) [-1132.343] -- 0:00:16
748500 -- (-1134.814) (-1130.400) [-1135.663] (-1134.013) * (-1131.337) (-1133.681) (-1129.520) [-1128.897] -- 0:00:16
749000 -- (-1131.638) (-1131.396) (-1134.878) [-1133.071] * (-1131.583) (-1130.741) (-1132.418) [-1129.657] -- 0:00:16
749500 -- (-1132.483) (-1130.596) (-1130.202) [-1128.214] * (-1133.399) [-1132.769] (-1129.744) (-1131.190) -- 0:00:16
750000 -- (-1130.855) (-1129.402) [-1130.436] (-1132.383) * [-1131.568] (-1130.919) (-1134.724) (-1133.488) -- 0:00:16
Average standard deviation of split frequencies: 0.010424
750500 -- (-1128.574) (-1131.056) (-1130.704) [-1129.235] * [-1131.386] (-1130.818) (-1132.666) (-1134.648) -- 0:00:16
751000 -- (-1131.711) [-1131.493] (-1129.234) (-1130.177) * (-1132.303) (-1131.319) (-1135.717) [-1133.100] -- 0:00:16
751500 -- (-1129.337) (-1130.627) [-1130.292] (-1135.536) * (-1132.594) (-1129.177) (-1133.586) [-1130.089] -- 0:00:16
752000 -- (-1130.096) (-1131.733) [-1133.100] (-1130.822) * (-1129.092) (-1130.167) (-1134.194) [-1130.361] -- 0:00:16
752500 -- [-1131.929] (-1130.900) (-1131.653) (-1132.775) * (-1130.197) (-1133.908) [-1129.556] (-1133.497) -- 0:00:16
753000 -- [-1129.050] (-1133.568) (-1130.924) (-1131.165) * (-1131.502) (-1142.017) (-1131.716) [-1130.869] -- 0:00:16
753500 -- [-1129.548] (-1131.422) (-1130.300) (-1131.193) * (-1131.750) (-1131.430) (-1134.531) [-1130.764] -- 0:00:16
754000 -- [-1133.752] (-1132.421) (-1130.179) (-1132.726) * (-1131.434) (-1131.418) (-1128.046) [-1132.058] -- 0:00:16
754500 -- (-1135.635) [-1132.389] (-1134.965) (-1129.817) * (-1127.706) (-1131.434) (-1133.840) [-1135.141] -- 0:00:16
755000 -- (-1131.167) (-1130.691) (-1131.334) [-1132.932] * [-1132.416] (-1131.470) (-1134.360) (-1133.685) -- 0:00:16
Average standard deviation of split frequencies: 0.010226
755500 -- (-1131.597) [-1131.267] (-1132.109) (-1135.119) * (-1132.104) [-1129.541] (-1131.857) (-1131.072) -- 0:00:16
756000 -- (-1128.247) (-1131.450) (-1133.126) [-1130.686] * [-1128.560] (-1129.719) (-1131.226) (-1136.768) -- 0:00:16
756500 -- (-1129.987) (-1132.410) [-1132.620] (-1131.519) * (-1130.856) [-1130.037] (-1130.989) (-1132.648) -- 0:00:16
757000 -- (-1130.584) [-1132.068] (-1132.467) (-1131.893) * (-1130.510) (-1130.809) (-1133.341) [-1131.129] -- 0:00:16
757500 -- (-1128.788) [-1131.773] (-1132.208) (-1130.253) * [-1130.705] (-1129.503) (-1131.906) (-1132.512) -- 0:00:16
758000 -- (-1131.395) [-1133.196] (-1134.759) (-1130.939) * (-1129.754) (-1130.369) [-1132.459] (-1133.176) -- 0:00:15
758500 -- (-1128.706) (-1134.755) [-1135.330] (-1131.444) * (-1134.937) (-1130.297) [-1133.250] (-1130.241) -- 0:00:15
759000 -- (-1129.209) (-1130.515) [-1133.927] (-1130.580) * [-1133.951] (-1129.833) (-1130.098) (-1138.944) -- 0:00:15
759500 -- (-1131.308) [-1129.943] (-1129.509) (-1132.937) * (-1132.544) [-1131.331] (-1129.453) (-1142.997) -- 0:00:15
760000 -- (-1132.006) (-1131.006) (-1129.932) [-1130.961] * (-1134.851) [-1129.785] (-1131.588) (-1132.084) -- 0:00:15
Average standard deviation of split frequencies: 0.010163
760500 -- (-1133.411) (-1129.910) [-1133.683] (-1129.553) * (-1130.072) [-1133.776] (-1132.651) (-1132.449) -- 0:00:15
761000 -- [-1132.491] (-1132.263) (-1128.580) (-1132.917) * (-1129.525) (-1129.744) [-1132.145] (-1130.782) -- 0:00:15
761500 -- [-1133.242] (-1131.784) (-1131.767) (-1129.935) * (-1129.797) (-1129.945) (-1133.588) [-1130.504] -- 0:00:15
762000 -- (-1133.573) (-1133.458) (-1130.920) [-1130.277] * [-1130.352] (-1128.454) (-1132.125) (-1133.131) -- 0:00:15
762500 -- (-1133.295) (-1132.313) (-1130.963) [-1130.891] * (-1130.080) (-1131.888) [-1130.900] (-1131.649) -- 0:00:15
763000 -- [-1132.958] (-1129.510) (-1132.162) (-1133.880) * (-1129.628) (-1134.345) (-1130.970) [-1131.175] -- 0:00:15
763500 -- (-1130.278) (-1133.387) (-1130.774) [-1132.048] * [-1135.374] (-1138.276) (-1132.340) (-1132.302) -- 0:00:15
764000 -- [-1133.769] (-1134.549) (-1132.787) (-1132.778) * (-1130.977) (-1133.198) (-1134.643) [-1130.375] -- 0:00:15
764500 -- (-1133.303) (-1129.360) [-1132.149] (-1132.775) * [-1131.974] (-1132.209) (-1136.260) (-1129.734) -- 0:00:15
765000 -- [-1131.525] (-1135.045) (-1129.937) (-1131.243) * [-1131.378] (-1132.997) (-1134.361) (-1130.599) -- 0:00:15
Average standard deviation of split frequencies: 0.009847
765500 -- [-1133.997] (-1143.718) (-1129.635) (-1129.702) * [-1130.303] (-1131.148) (-1131.153) (-1128.487) -- 0:00:15
766000 -- (-1134.816) (-1134.993) (-1127.800) [-1129.450] * (-1133.335) [-1130.908] (-1135.924) (-1128.804) -- 0:00:15
766500 -- (-1140.850) (-1133.087) [-1130.091] (-1132.441) * (-1129.422) (-1132.338) [-1129.649] (-1132.388) -- 0:00:15
767000 -- (-1136.944) (-1130.702) [-1129.692] (-1130.217) * (-1130.510) (-1130.252) [-1133.612] (-1132.764) -- 0:00:15
767500 -- [-1131.943] (-1131.218) (-1134.610) (-1132.473) * [-1133.528] (-1133.090) (-1133.579) (-1130.022) -- 0:00:15
768000 -- (-1132.128) (-1132.098) [-1129.562] (-1133.091) * [-1132.154] (-1132.170) (-1129.968) (-1131.891) -- 0:00:15
768500 -- (-1130.936) [-1132.309] (-1130.402) (-1131.900) * [-1127.803] (-1132.789) (-1132.821) (-1131.304) -- 0:00:15
769000 -- [-1132.591] (-1134.153) (-1132.488) (-1131.300) * [-1129.179] (-1132.873) (-1134.692) (-1130.895) -- 0:00:15
769500 -- (-1133.103) (-1133.129) [-1133.466] (-1129.750) * (-1129.144) (-1132.292) [-1134.006] (-1135.734) -- 0:00:15
770000 -- (-1135.491) (-1130.599) (-1131.245) [-1129.270] * (-1130.361) [-1129.460] (-1130.103) (-1129.129) -- 0:00:15
Average standard deviation of split frequencies: 0.010032
770500 -- [-1130.652] (-1129.450) (-1132.769) (-1131.334) * (-1128.753) (-1131.980) (-1131.963) [-1130.196] -- 0:00:15
771000 -- (-1135.368) [-1130.082] (-1130.769) (-1129.345) * [-1131.849] (-1132.577) (-1129.918) (-1130.926) -- 0:00:15
771500 -- (-1135.245) [-1130.847] (-1131.019) (-1133.250) * (-1135.165) [-1130.789] (-1134.307) (-1130.250) -- 0:00:15
772000 -- (-1133.183) [-1133.488] (-1129.984) (-1130.515) * [-1129.789] (-1129.769) (-1131.563) (-1131.663) -- 0:00:15
772500 -- [-1131.355] (-1130.368) (-1131.312) (-1133.181) * (-1131.329) [-1129.484] (-1128.669) (-1131.973) -- 0:00:15
773000 -- (-1132.396) (-1134.214) (-1129.632) [-1131.096] * (-1134.402) (-1134.002) [-1131.809] (-1129.431) -- 0:00:14
773500 -- (-1132.383) (-1131.030) [-1129.106] (-1131.574) * (-1133.504) (-1135.491) [-1129.826] (-1130.643) -- 0:00:14
774000 -- (-1132.963) (-1130.004) (-1130.435) [-1129.542] * [-1129.790] (-1133.931) (-1133.050) (-1130.469) -- 0:00:14
774500 -- (-1146.803) (-1130.969) [-1134.346] (-1129.084) * (-1128.557) (-1130.659) (-1131.540) [-1129.181] -- 0:00:14
775000 -- (-1134.692) (-1131.030) [-1133.849] (-1131.176) * (-1134.199) [-1130.740] (-1132.025) (-1133.196) -- 0:00:14
Average standard deviation of split frequencies: 0.010327
775500 -- (-1131.275) [-1134.779] (-1137.873) (-1130.011) * [-1131.739] (-1130.240) (-1130.042) (-1134.606) -- 0:00:14
776000 -- [-1131.360] (-1130.306) (-1131.365) (-1133.040) * [-1130.994] (-1130.364) (-1131.221) (-1130.888) -- 0:00:14
776500 -- [-1130.274] (-1131.276) (-1130.696) (-1131.206) * (-1132.948) [-1129.772] (-1130.482) (-1131.213) -- 0:00:14
777000 -- (-1129.696) [-1132.168] (-1132.365) (-1128.192) * [-1131.295] (-1132.113) (-1136.724) (-1131.031) -- 0:00:14
777500 -- (-1128.694) (-1132.208) [-1132.354] (-1130.620) * (-1129.139) (-1133.213) (-1132.954) [-1132.115] -- 0:00:14
778000 -- [-1130.844] (-1132.078) (-1130.791) (-1129.406) * (-1131.636) (-1132.599) (-1132.623) [-1129.988] -- 0:00:14
778500 -- [-1134.356] (-1135.646) (-1133.532) (-1129.989) * (-1129.682) [-1131.712] (-1129.294) (-1130.571) -- 0:00:14
779000 -- (-1132.586) (-1136.809) [-1134.230] (-1133.458) * (-1131.051) (-1134.444) (-1134.207) [-1129.439] -- 0:00:14
779500 -- (-1133.261) (-1130.396) [-1132.923] (-1132.295) * (-1130.484) (-1131.785) (-1136.144) [-1133.868] -- 0:00:14
780000 -- (-1133.967) (-1130.187) [-1130.840] (-1131.369) * (-1136.198) [-1131.692] (-1133.657) (-1132.633) -- 0:00:14
Average standard deviation of split frequencies: 0.010386
780500 -- (-1131.659) [-1133.840] (-1130.393) (-1133.768) * (-1135.621) (-1131.772) (-1130.926) [-1130.256] -- 0:00:14
781000 -- (-1132.895) (-1130.885) (-1128.268) [-1130.114] * [-1132.987] (-1133.943) (-1131.552) (-1132.064) -- 0:00:14
781500 -- [-1134.028] (-1132.165) (-1132.486) (-1130.247) * [-1131.843] (-1131.440) (-1133.554) (-1132.572) -- 0:00:14
782000 -- (-1134.752) [-1129.926] (-1131.113) (-1132.116) * (-1132.514) (-1132.322) (-1131.413) [-1132.087] -- 0:00:14
782500 -- (-1132.563) (-1131.191) [-1130.346] (-1133.088) * (-1135.849) [-1129.599] (-1130.409) (-1129.998) -- 0:00:14
783000 -- (-1131.390) (-1135.055) (-1129.180) [-1130.755] * [-1131.537] (-1130.264) (-1135.491) (-1130.703) -- 0:00:14
783500 -- (-1132.324) (-1135.127) [-1130.870] (-1133.775) * (-1132.451) [-1130.483] (-1130.879) (-1132.671) -- 0:00:14
784000 -- (-1133.497) [-1127.826] (-1134.235) (-1128.715) * (-1131.173) (-1130.395) (-1131.049) [-1132.803] -- 0:00:14
784500 -- (-1130.240) (-1129.409) (-1132.329) [-1129.875] * (-1129.963) (-1132.493) (-1131.270) [-1129.516] -- 0:00:14
785000 -- (-1131.974) (-1133.865) [-1129.500] (-1130.222) * [-1132.350] (-1130.907) (-1130.596) (-1131.576) -- 0:00:14
Average standard deviation of split frequencies: 0.010516
785500 -- [-1130.083] (-1127.500) (-1129.856) (-1130.162) * [-1131.891] (-1131.777) (-1132.614) (-1132.616) -- 0:00:14
786000 -- (-1130.517) [-1127.746] (-1129.114) (-1130.649) * [-1131.468] (-1131.571) (-1137.536) (-1131.373) -- 0:00:14
786500 -- (-1130.694) (-1135.740) (-1129.544) [-1131.358] * (-1131.876) (-1132.136) [-1131.971] (-1129.779) -- 0:00:14
787000 -- (-1128.999) (-1130.782) (-1133.062) [-1131.034] * (-1132.370) (-1134.006) (-1131.450) [-1130.458] -- 0:00:14
787500 -- [-1132.032] (-1130.861) (-1128.895) (-1131.143) * (-1132.040) (-1135.945) [-1134.620] (-1133.141) -- 0:00:14
788000 -- (-1130.471) [-1131.740] (-1130.687) (-1132.135) * [-1130.448] (-1130.219) (-1132.937) (-1129.208) -- 0:00:13
788500 -- (-1130.154) (-1131.366) [-1129.958] (-1132.494) * (-1129.569) [-1130.397] (-1135.349) (-1129.007) -- 0:00:13
789000 -- (-1132.197) (-1139.270) (-1135.761) [-1131.539] * [-1130.897] (-1130.998) (-1134.903) (-1132.117) -- 0:00:13
789500 -- (-1130.941) [-1131.020] (-1137.729) (-1132.046) * (-1132.768) (-1134.913) (-1134.619) [-1130.873] -- 0:00:13
790000 -- [-1132.334] (-1130.982) (-1134.863) (-1131.762) * (-1130.811) [-1131.620] (-1133.100) (-1130.344) -- 0:00:13
Average standard deviation of split frequencies: 0.010374
790500 -- (-1133.849) (-1135.159) [-1127.785] (-1138.476) * (-1131.977) (-1130.688) [-1132.731] (-1133.733) -- 0:00:13
791000 -- (-1130.642) (-1134.157) [-1127.670] (-1131.011) * [-1130.617] (-1129.235) (-1130.938) (-1129.196) -- 0:00:13
791500 -- (-1130.351) (-1133.172) (-1132.527) [-1130.035] * (-1130.676) (-1130.664) [-1130.886] (-1132.065) -- 0:00:13
792000 -- (-1132.051) [-1129.734] (-1130.980) (-1133.517) * (-1132.409) (-1131.301) [-1129.248] (-1130.883) -- 0:00:13
792500 -- (-1130.990) (-1131.285) [-1127.821] (-1132.199) * (-1136.171) (-1136.748) (-1130.835) [-1130.934] -- 0:00:13
793000 -- [-1129.403] (-1130.901) (-1133.294) (-1129.658) * [-1131.286] (-1133.198) (-1130.737) (-1130.551) -- 0:00:13
793500 -- (-1133.584) (-1135.713) [-1133.145] (-1132.935) * (-1132.550) [-1133.363] (-1132.411) (-1131.185) -- 0:00:13
794000 -- (-1130.499) (-1131.300) [-1129.907] (-1133.403) * (-1132.516) [-1131.034] (-1132.710) (-1132.150) -- 0:00:13
794500 -- [-1130.007] (-1130.812) (-1129.518) (-1136.371) * (-1132.007) (-1133.431) [-1132.640] (-1133.302) -- 0:00:13
795000 -- (-1132.677) [-1129.347] (-1129.655) (-1131.704) * (-1130.194) [-1131.772] (-1129.846) (-1131.005) -- 0:00:13
Average standard deviation of split frequencies: 0.010028
795500 -- (-1133.926) (-1132.862) (-1134.792) [-1129.377] * (-1130.670) [-1131.888] (-1129.580) (-1132.630) -- 0:00:13
796000 -- (-1132.040) (-1131.630) [-1129.896] (-1133.702) * (-1130.229) [-1131.299] (-1130.045) (-1132.189) -- 0:00:13
796500 -- [-1130.131] (-1131.694) (-1131.688) (-1133.028) * (-1131.165) [-1134.577] (-1129.307) (-1131.308) -- 0:00:13
797000 -- (-1134.407) [-1130.542] (-1133.862) (-1135.792) * (-1129.773) [-1129.670] (-1136.964) (-1131.803) -- 0:00:13
797500 -- (-1130.973) [-1133.618] (-1131.977) (-1131.204) * (-1133.157) (-1131.720) [-1129.587] (-1134.013) -- 0:00:13
798000 -- (-1132.384) (-1133.853) (-1128.987) [-1130.749] * (-1133.030) (-1132.106) (-1131.667) [-1133.582] -- 0:00:13
798500 -- (-1131.316) (-1131.858) (-1134.356) [-1129.617] * [-1130.351] (-1131.827) (-1130.520) (-1130.092) -- 0:00:13
799000 -- (-1130.577) (-1132.965) [-1134.353] (-1129.482) * (-1133.211) (-1132.688) (-1129.226) [-1130.391] -- 0:00:13
799500 -- [-1131.660] (-1132.819) (-1137.568) (-1132.405) * (-1136.065) (-1133.695) [-1130.478] (-1131.180) -- 0:00:13
800000 -- (-1133.150) (-1135.060) (-1130.182) [-1132.342] * (-1135.655) (-1131.477) (-1129.539) [-1130.618] -- 0:00:13
Average standard deviation of split frequencies: 0.010245
800500 -- [-1134.478] (-1133.492) (-1130.538) (-1133.601) * [-1132.317] (-1132.839) (-1133.646) (-1128.823) -- 0:00:13
801000 -- (-1131.502) (-1130.600) [-1133.625] (-1139.327) * (-1137.765) (-1129.866) [-1133.149] (-1131.099) -- 0:00:13
801500 -- [-1132.154] (-1130.917) (-1129.596) (-1133.306) * [-1128.346] (-1132.952) (-1130.392) (-1136.949) -- 0:00:13
802000 -- (-1131.757) (-1135.952) [-1133.420] (-1131.198) * (-1128.447) [-1129.295] (-1130.376) (-1133.389) -- 0:00:13
802500 -- (-1131.987) [-1135.043] (-1133.808) (-1133.282) * (-1129.067) [-1130.809] (-1134.502) (-1130.984) -- 0:00:13
803000 -- (-1131.703) [-1131.388] (-1131.831) (-1130.863) * [-1129.058] (-1138.872) (-1133.940) (-1133.116) -- 0:00:13
803500 -- (-1133.922) (-1129.517) [-1130.382] (-1131.548) * [-1131.724] (-1130.523) (-1132.239) (-1128.851) -- 0:00:12
804000 -- (-1131.940) (-1129.517) [-1130.382] (-1131.553) * (-1131.253) [-1129.801] (-1129.219) (-1130.803) -- 0:00:12
804500 -- (-1131.798) (-1131.453) (-1130.269) [-1130.116] * (-1131.226) (-1130.271) (-1130.869) [-1130.806] -- 0:00:12
805000 -- (-1130.835) (-1128.600) (-1130.730) [-1130.469] * (-1137.487) [-1131.914] (-1131.615) (-1130.817) -- 0:00:12
Average standard deviation of split frequencies: 0.010723
805500 -- [-1131.665] (-1132.167) (-1132.052) (-1132.673) * [-1130.537] (-1134.656) (-1131.140) (-1129.421) -- 0:00:12
806000 -- (-1130.582) (-1133.937) [-1131.300] (-1131.024) * (-1134.137) (-1132.625) [-1128.657] (-1130.574) -- 0:00:12
806500 -- (-1134.798) (-1135.886) (-1132.228) [-1133.406] * (-1129.973) (-1132.433) [-1131.056] (-1130.586) -- 0:00:12
807000 -- (-1131.200) (-1139.886) (-1133.963) [-1128.837] * (-1130.742) (-1130.431) [-1132.314] (-1129.264) -- 0:00:12
807500 -- (-1134.838) [-1129.491] (-1132.067) (-1134.010) * (-1130.575) (-1132.429) (-1129.808) [-1130.517] -- 0:00:12
808000 -- (-1132.271) (-1130.972) [-1132.603] (-1130.983) * (-1131.086) (-1129.743) (-1130.265) [-1129.044] -- 0:00:12
808500 -- (-1131.577) (-1130.147) [-1128.625] (-1133.022) * (-1130.365) (-1130.398) [-1130.244] (-1129.636) -- 0:00:12
809000 -- (-1128.987) [-1129.084] (-1131.999) (-1131.178) * (-1130.169) [-1134.818] (-1131.161) (-1132.861) -- 0:00:12
809500 -- (-1130.797) (-1132.647) (-1131.377) [-1130.735] * (-1135.767) (-1129.720) [-1127.930] (-1136.336) -- 0:00:12
810000 -- (-1128.560) [-1130.823] (-1131.982) (-1133.744) * (-1136.851) (-1131.283) [-1131.599] (-1134.815) -- 0:00:12
Average standard deviation of split frequencies: 0.010932
810500 -- [-1133.369] (-1128.848) (-1130.369) (-1136.479) * (-1137.691) (-1132.980) [-1131.745] (-1131.402) -- 0:00:12
811000 -- (-1129.775) [-1132.000] (-1130.970) (-1130.455) * (-1131.278) (-1132.373) [-1130.421] (-1129.770) -- 0:00:12
811500 -- (-1132.630) (-1132.777) [-1132.386] (-1136.112) * (-1129.538) (-1131.128) (-1130.777) [-1130.488] -- 0:00:12
812000 -- (-1131.573) [-1130.568] (-1132.786) (-1132.900) * (-1130.386) (-1136.081) (-1130.527) [-1131.069] -- 0:00:12
812500 -- [-1130.870] (-1129.520) (-1137.750) (-1132.304) * (-1129.383) [-1133.912] (-1132.279) (-1131.608) -- 0:00:12
813000 -- (-1131.284) (-1131.626) (-1130.065) [-1132.874] * (-1132.540) (-1132.739) [-1130.578] (-1130.579) -- 0:00:12
813500 -- (-1133.280) [-1130.665] (-1130.542) (-1131.133) * (-1130.260) (-1129.758) [-1131.020] (-1131.735) -- 0:00:12
814000 -- (-1136.507) (-1132.886) (-1127.923) [-1130.692] * (-1130.548) [-1129.312] (-1131.699) (-1134.417) -- 0:00:12
814500 -- (-1132.378) (-1131.630) [-1129.985] (-1132.528) * [-1130.130] (-1131.211) (-1130.302) (-1133.106) -- 0:00:12
815000 -- [-1131.846] (-1128.422) (-1132.889) (-1131.488) * [-1129.319] (-1131.717) (-1131.523) (-1140.502) -- 0:00:12
Average standard deviation of split frequencies: 0.011015
815500 -- [-1131.214] (-1131.472) (-1131.111) (-1131.309) * [-1128.637] (-1135.591) (-1131.378) (-1135.144) -- 0:00:12
816000 -- (-1130.988) (-1129.850) [-1131.128] (-1131.892) * (-1132.771) (-1132.038) (-1130.921) [-1131.261] -- 0:00:12
816500 -- (-1131.294) (-1133.589) [-1129.274] (-1130.772) * (-1133.717) [-1131.563] (-1130.303) (-1130.302) -- 0:00:12
817000 -- (-1132.044) (-1133.435) (-1134.195) [-1130.387] * (-1132.264) (-1131.730) (-1131.786) [-1132.252] -- 0:00:12
817500 -- (-1130.322) [-1132.573] (-1133.198) (-1131.539) * (-1128.428) [-1132.309] (-1128.218) (-1139.940) -- 0:00:12
818000 -- (-1132.511) (-1128.387) (-1131.625) [-1131.868] * (-1128.061) (-1132.537) [-1130.636] (-1132.618) -- 0:00:12
818500 -- (-1129.887) [-1130.016] (-1130.766) (-1133.311) * (-1131.917) (-1134.760) [-1129.772] (-1132.494) -- 0:00:11
819000 -- (-1134.898) [-1131.331] (-1131.876) (-1132.217) * (-1131.853) [-1134.750] (-1131.532) (-1130.966) -- 0:00:11
819500 -- (-1132.280) (-1133.161) (-1130.881) [-1131.843] * (-1129.409) [-1131.844] (-1134.505) (-1130.622) -- 0:00:11
820000 -- (-1135.095) (-1134.377) [-1130.121] (-1130.399) * [-1133.523] (-1133.482) (-1134.767) (-1131.982) -- 0:00:11
Average standard deviation of split frequencies: 0.010531
820500 -- [-1134.038] (-1133.925) (-1130.619) (-1129.497) * (-1133.969) [-1130.560] (-1134.131) (-1135.721) -- 0:00:11
821000 -- (-1132.213) (-1130.621) [-1130.619] (-1132.544) * (-1133.413) [-1129.752] (-1138.915) (-1132.316) -- 0:00:11
821500 -- (-1131.610) [-1133.610] (-1131.208) (-1133.826) * [-1136.383] (-1128.140) (-1140.553) (-1131.568) -- 0:00:11
822000 -- [-1130.818] (-1131.670) (-1131.595) (-1134.577) * (-1132.348) (-1130.345) (-1130.895) [-1129.094] -- 0:00:11
822500 -- [-1130.768] (-1132.685) (-1130.181) (-1129.127) * (-1132.054) (-1131.914) [-1132.890] (-1131.745) -- 0:00:11
823000 -- (-1133.937) (-1133.759) (-1134.945) [-1132.096] * (-1128.671) [-1130.575] (-1133.075) (-1133.863) -- 0:00:11
823500 -- (-1132.597) (-1134.292) [-1133.793] (-1130.920) * [-1131.108] (-1129.612) (-1132.424) (-1132.214) -- 0:00:11
824000 -- (-1131.183) (-1128.738) (-1129.866) [-1132.925] * [-1129.010] (-1127.957) (-1131.239) (-1131.943) -- 0:00:11
824500 -- (-1130.354) [-1128.262] (-1132.673) (-1135.212) * [-1129.603] (-1131.726) (-1132.576) (-1130.978) -- 0:00:11
825000 -- [-1130.191] (-1131.075) (-1130.296) (-1132.309) * (-1133.519) [-1129.804] (-1131.207) (-1130.392) -- 0:00:11
Average standard deviation of split frequencies: 0.010235
825500 -- [-1134.585] (-1131.045) (-1129.376) (-1129.265) * (-1134.511) [-1128.916] (-1129.852) (-1130.631) -- 0:00:11
826000 -- [-1128.134] (-1131.315) (-1127.939) (-1129.201) * (-1135.866) [-1129.174] (-1130.655) (-1132.268) -- 0:00:11
826500 -- (-1130.410) (-1129.698) [-1128.229] (-1129.274) * [-1132.411] (-1131.382) (-1131.049) (-1132.573) -- 0:00:11
827000 -- [-1131.500] (-1128.327) (-1134.499) (-1132.494) * (-1134.258) (-1134.359) [-1131.241] (-1132.233) -- 0:00:11
827500 -- [-1131.818] (-1129.212) (-1131.614) (-1130.412) * (-1131.272) (-1131.137) (-1132.321) [-1128.198] -- 0:00:11
828000 -- (-1132.338) [-1129.643] (-1130.034) (-1131.400) * (-1130.989) [-1135.252] (-1131.141) (-1129.640) -- 0:00:11
828500 -- [-1130.575] (-1132.138) (-1131.910) (-1130.060) * [-1130.836] (-1132.010) (-1132.258) (-1129.273) -- 0:00:11
829000 -- (-1133.869) [-1131.111] (-1129.857) (-1132.885) * (-1131.023) (-1130.569) [-1133.377] (-1134.224) -- 0:00:11
829500 -- (-1134.184) [-1129.708] (-1130.545) (-1134.146) * (-1131.003) (-1129.862) (-1131.820) [-1134.986] -- 0:00:11
830000 -- (-1135.927) [-1129.938] (-1130.911) (-1129.852) * (-1130.506) (-1130.908) (-1142.410) [-1131.330] -- 0:00:11
Average standard deviation of split frequencies: 0.010026
830500 -- (-1139.091) (-1130.945) (-1132.467) [-1132.331] * [-1131.204] (-1132.022) (-1134.654) (-1135.611) -- 0:00:11
831000 -- (-1130.541) [-1130.225] (-1130.349) (-1131.728) * (-1131.896) [-1133.764] (-1135.507) (-1138.872) -- 0:00:11
831500 -- (-1131.971) [-1132.844] (-1128.904) (-1130.217) * (-1129.315) (-1134.438) [-1131.608] (-1139.004) -- 0:00:11
832000 -- (-1130.933) [-1132.195] (-1133.931) (-1132.914) * (-1133.699) (-1138.675) [-1131.067] (-1131.285) -- 0:00:11
832500 -- (-1131.918) (-1130.528) (-1130.610) [-1132.717] * (-1131.924) [-1136.523] (-1130.820) (-1130.892) -- 0:00:11
833000 -- (-1129.227) (-1134.139) [-1131.805] (-1132.688) * (-1133.674) (-1136.812) (-1130.922) [-1131.134] -- 0:00:11
833500 -- (-1133.478) (-1132.931) [-1130.673] (-1132.342) * [-1131.712] (-1130.720) (-1132.625) (-1129.880) -- 0:00:10
834000 -- [-1131.433] (-1131.089) (-1130.356) (-1132.494) * (-1130.999) (-1130.613) [-1137.904] (-1138.054) -- 0:00:10
834500 -- (-1130.955) [-1132.384] (-1129.825) (-1132.027) * [-1130.721] (-1133.802) (-1134.335) (-1129.844) -- 0:00:10
835000 -- (-1132.622) (-1130.508) (-1132.833) [-1130.134] * (-1130.474) (-1131.741) [-1131.386] (-1130.304) -- 0:00:10
Average standard deviation of split frequencies: 0.009962
835500 -- (-1130.436) [-1130.953] (-1130.647) (-1132.153) * (-1133.080) [-1128.740] (-1131.186) (-1132.446) -- 0:00:10
836000 -- (-1130.860) (-1132.447) (-1133.166) [-1129.711] * (-1134.634) (-1131.036) [-1131.254] (-1131.036) -- 0:00:10
836500 -- (-1129.934) [-1132.325] (-1131.513) (-1129.443) * (-1131.678) (-1127.955) (-1132.601) [-1130.152] -- 0:00:10
837000 -- (-1132.116) (-1132.688) (-1131.607) [-1131.902] * (-1131.415) [-1128.161] (-1132.172) (-1129.983) -- 0:00:10
837500 -- [-1130.270] (-1132.519) (-1133.591) (-1129.834) * (-1130.812) [-1128.754] (-1137.321) (-1135.200) -- 0:00:10
838000 -- (-1130.978) (-1130.728) [-1133.981] (-1132.764) * (-1132.794) [-1131.480] (-1132.027) (-1137.185) -- 0:00:10
838500 -- (-1135.411) [-1130.545] (-1134.981) (-1131.654) * (-1132.475) [-1130.128] (-1133.702) (-1129.840) -- 0:00:10
839000 -- [-1132.117] (-1131.288) (-1134.168) (-1129.062) * (-1132.133) (-1130.954) (-1130.993) [-1132.939] -- 0:00:10
839500 -- (-1131.452) [-1131.607] (-1130.752) (-1134.529) * (-1130.337) [-1131.404] (-1128.923) (-1132.667) -- 0:00:10
840000 -- [-1130.603] (-1132.766) (-1131.298) (-1131.069) * [-1130.804] (-1129.195) (-1130.334) (-1129.805) -- 0:00:10
Average standard deviation of split frequencies: 0.009981
840500 -- (-1131.187) (-1132.597) [-1129.091] (-1129.848) * (-1134.473) [-1129.703] (-1130.941) (-1131.462) -- 0:00:10
841000 -- [-1131.401] (-1134.568) (-1131.753) (-1130.271) * (-1133.842) [-1131.368] (-1130.811) (-1129.238) -- 0:00:10
841500 -- (-1131.656) (-1135.073) (-1131.491) [-1130.163] * (-1131.268) (-1130.480) [-1129.574] (-1130.601) -- 0:00:10
842000 -- [-1130.996] (-1130.811) (-1131.548) (-1129.597) * [-1130.736] (-1131.343) (-1129.815) (-1131.397) -- 0:00:10
842500 -- [-1132.038] (-1131.932) (-1135.086) (-1129.939) * (-1131.973) (-1131.758) (-1131.545) [-1132.852] -- 0:00:10
843000 -- (-1130.981) (-1131.591) [-1129.807] (-1130.592) * (-1133.828) (-1130.133) (-1134.487) [-1127.718] -- 0:00:10
843500 -- (-1129.772) (-1131.017) (-1132.104) [-1131.300] * (-1133.274) (-1130.752) (-1130.995) [-1127.986] -- 0:00:10
844000 -- (-1129.490) (-1133.743) [-1133.754] (-1131.069) * (-1134.351) (-1128.296) (-1133.309) [-1131.801] -- 0:00:10
844500 -- (-1130.896) (-1133.474) [-1134.003] (-1129.055) * (-1133.224) (-1129.286) [-1130.513] (-1133.774) -- 0:00:10
845000 -- (-1131.953) [-1129.441] (-1131.957) (-1130.896) * [-1129.445] (-1132.248) (-1129.518) (-1133.047) -- 0:00:10
Average standard deviation of split frequencies: 0.009881
845500 -- [-1131.253] (-1131.407) (-1133.454) (-1130.956) * [-1132.659] (-1128.332) (-1134.345) (-1133.633) -- 0:00:10
846000 -- (-1132.108) (-1135.221) (-1131.242) [-1131.450] * [-1133.662] (-1129.285) (-1133.633) (-1130.574) -- 0:00:10
846500 -- (-1132.027) (-1135.857) [-1132.704] (-1132.360) * (-1132.108) (-1130.439) (-1131.678) [-1129.301] -- 0:00:10
847000 -- (-1131.132) [-1134.415] (-1130.855) (-1130.446) * (-1133.369) (-1131.757) (-1131.541) [-1127.927] -- 0:00:10
847500 -- (-1131.360) (-1132.393) (-1129.640) [-1133.118] * (-1130.199) (-1131.703) [-1131.980] (-1130.727) -- 0:00:10
848000 -- (-1133.196) (-1132.473) (-1131.473) [-1132.019] * (-1129.761) (-1131.138) [-1131.030] (-1132.174) -- 0:00:10
848500 -- (-1133.614) (-1130.953) [-1130.213] (-1132.445) * (-1136.176) (-1129.635) (-1132.071) [-1132.814] -- 0:00:09
849000 -- (-1134.278) (-1130.290) (-1130.273) [-1131.790] * (-1132.208) (-1129.169) [-1131.561] (-1129.555) -- 0:00:09
849500 -- (-1131.594) [-1129.261] (-1133.293) (-1131.725) * [-1128.947] (-1129.340) (-1129.811) (-1132.553) -- 0:00:09
850000 -- (-1132.681) (-1130.652) [-1132.258] (-1131.048) * [-1130.646] (-1135.258) (-1129.992) (-1131.548) -- 0:00:09
Average standard deviation of split frequencies: 0.009827
850500 -- (-1130.416) [-1130.937] (-1131.482) (-1131.328) * (-1132.809) [-1127.656] (-1130.265) (-1132.169) -- 0:00:09
851000 -- (-1129.569) [-1129.371] (-1130.232) (-1130.513) * [-1132.563] (-1131.372) (-1130.231) (-1130.354) -- 0:00:09
851500 -- (-1129.230) (-1130.965) (-1130.386) [-1129.812] * (-1132.688) (-1131.857) [-1130.043] (-1129.637) -- 0:00:09
852000 -- (-1132.906) (-1131.184) [-1130.897] (-1130.685) * (-1134.855) (-1131.277) [-1131.978] (-1130.085) -- 0:00:09
852500 -- [-1129.342] (-1136.951) (-1132.783) (-1131.580) * [-1135.425] (-1130.377) (-1132.612) (-1134.423) -- 0:00:09
853000 -- (-1132.550) (-1129.242) (-1133.049) [-1135.230] * (-1133.437) [-1130.419] (-1131.648) (-1131.183) -- 0:00:09
853500 -- [-1131.455] (-1130.644) (-1131.807) (-1132.310) * (-1132.762) [-1128.580] (-1132.635) (-1131.204) -- 0:00:09
854000 -- [-1130.934] (-1130.501) (-1129.685) (-1130.502) * (-1133.472) [-1129.504] (-1131.736) (-1129.304) -- 0:00:09
854500 -- [-1130.927] (-1133.972) (-1131.671) (-1129.374) * (-1131.327) [-1130.398] (-1133.894) (-1131.969) -- 0:00:09
855000 -- (-1133.088) [-1132.626] (-1132.878) (-1133.768) * (-1131.184) [-1130.159] (-1134.225) (-1130.316) -- 0:00:09
Average standard deviation of split frequencies: 0.009766
855500 -- (-1132.908) (-1136.714) (-1135.366) [-1131.989] * (-1131.231) (-1137.975) (-1131.699) [-1129.189] -- 0:00:09
856000 -- (-1130.816) [-1131.114] (-1131.448) (-1134.459) * (-1133.255) (-1131.589) (-1132.126) [-1130.689] -- 0:00:09
856500 -- (-1130.036) (-1132.441) [-1130.205] (-1135.017) * (-1132.188) [-1132.588] (-1133.123) (-1132.998) -- 0:00:09
857000 -- [-1129.130] (-1130.261) (-1131.233) (-1134.298) * (-1135.144) (-1130.314) (-1132.785) [-1129.360] -- 0:00:09
857500 -- (-1131.638) [-1129.861] (-1131.360) (-1129.856) * [-1130.934] (-1131.013) (-1131.376) (-1130.386) -- 0:00:09
858000 -- (-1134.065) (-1131.461) [-1131.007] (-1135.348) * (-1130.591) [-1130.935] (-1135.912) (-1129.153) -- 0:00:09
858500 -- [-1129.956] (-1133.444) (-1136.533) (-1134.312) * [-1131.281] (-1130.913) (-1130.588) (-1130.242) -- 0:00:09
859000 -- (-1134.428) [-1129.284] (-1129.030) (-1130.047) * (-1131.750) (-1132.599) (-1131.052) [-1130.965] -- 0:00:09
859500 -- (-1132.267) (-1130.735) [-1136.998] (-1132.195) * (-1133.377) [-1131.745] (-1130.753) (-1131.068) -- 0:00:09
860000 -- (-1132.392) [-1131.269] (-1134.750) (-1131.865) * [-1131.095] (-1133.018) (-1131.802) (-1134.911) -- 0:00:09
Average standard deviation of split frequencies: 0.009786
860500 -- (-1131.751) [-1133.130] (-1132.184) (-1132.136) * (-1131.653) [-1133.897] (-1134.458) (-1138.630) -- 0:00:09
861000 -- (-1132.183) (-1132.228) (-1131.435) [-1130.287] * (-1130.090) (-1135.122) [-1134.956] (-1136.084) -- 0:00:09
861500 -- [-1130.196] (-1132.553) (-1131.796) (-1132.172) * (-1131.921) [-1130.730] (-1130.183) (-1133.938) -- 0:00:09
862000 -- [-1130.911] (-1130.266) (-1131.784) (-1131.135) * (-1131.086) (-1138.535) [-1130.981] (-1129.974) -- 0:00:09
862500 -- (-1128.366) [-1132.119] (-1132.773) (-1128.483) * [-1134.443] (-1130.390) (-1135.713) (-1132.079) -- 0:00:09
863000 -- [-1130.410] (-1130.405) (-1131.733) (-1127.993) * (-1129.482) (-1131.816) [-1130.113] (-1134.778) -- 0:00:09
863500 -- (-1129.972) [-1132.387] (-1131.081) (-1131.391) * [-1128.855] (-1129.880) (-1132.369) (-1132.558) -- 0:00:09
864000 -- (-1129.429) [-1133.153] (-1128.756) (-1130.180) * (-1131.604) (-1133.098) (-1134.670) [-1130.213] -- 0:00:08
864500 -- (-1132.520) (-1133.736) [-1129.649] (-1130.511) * [-1131.103] (-1130.634) (-1131.037) (-1128.933) -- 0:00:08
865000 -- (-1134.447) (-1130.777) (-1133.895) [-1129.877] * (-1133.520) [-1128.956] (-1130.946) (-1135.947) -- 0:00:08
Average standard deviation of split frequencies: 0.009689
865500 -- (-1133.087) [-1130.710] (-1134.503) (-1133.705) * (-1128.885) (-1129.829) (-1131.637) [-1132.893] -- 0:00:08
866000 -- (-1129.133) [-1131.540] (-1131.964) (-1130.393) * (-1131.268) (-1135.995) [-1134.457] (-1132.109) -- 0:00:08
866500 -- (-1128.221) (-1130.680) (-1130.077) [-1130.961] * (-1131.071) (-1129.697) [-1130.676] (-1131.731) -- 0:00:08
867000 -- (-1128.943) [-1130.817] (-1131.280) (-1130.464) * (-1132.027) [-1132.745] (-1132.988) (-1132.414) -- 0:00:08
867500 -- (-1132.957) (-1132.077) (-1131.410) [-1132.752] * (-1133.198) (-1136.195) (-1131.393) [-1132.764] -- 0:00:08
868000 -- (-1132.970) (-1130.787) [-1133.215] (-1133.457) * (-1133.821) (-1133.721) (-1132.482) [-1132.031] -- 0:00:08
868500 -- (-1134.402) (-1133.503) [-1133.266] (-1137.070) * [-1131.570] (-1134.748) (-1129.948) (-1131.025) -- 0:00:08
869000 -- [-1130.102] (-1130.777) (-1134.241) (-1135.322) * [-1133.096] (-1133.006) (-1130.668) (-1131.649) -- 0:00:08
869500 -- [-1131.209] (-1129.873) (-1132.441) (-1130.547) * (-1130.356) (-1136.167) [-1129.652] (-1132.825) -- 0:00:08
870000 -- [-1130.972] (-1128.779) (-1133.444) (-1130.482) * (-1130.629) (-1132.745) [-1129.970] (-1131.594) -- 0:00:08
Average standard deviation of split frequencies: 0.009529
870500 -- [-1129.746] (-1131.920) (-1135.879) (-1129.991) * [-1132.016] (-1137.688) (-1132.679) (-1132.603) -- 0:00:08
871000 -- (-1130.726) (-1131.853) (-1130.625) [-1130.883] * (-1130.461) [-1134.109] (-1129.889) (-1131.562) -- 0:00:08
871500 -- (-1131.174) (-1130.779) (-1129.413) [-1136.186] * (-1130.523) [-1130.566] (-1131.077) (-1129.359) -- 0:00:08
872000 -- (-1134.032) (-1132.149) (-1134.115) [-1130.995] * (-1128.743) (-1130.117) [-1132.715] (-1130.917) -- 0:00:08
872500 -- [-1131.005] (-1133.353) (-1134.066) (-1133.092) * (-1128.819) [-1132.371] (-1134.671) (-1131.252) -- 0:00:08
873000 -- (-1132.264) (-1129.227) [-1129.776] (-1129.492) * [-1130.685] (-1135.777) (-1133.619) (-1131.800) -- 0:00:08
873500 -- [-1133.590] (-1132.129) (-1131.131) (-1133.627) * [-1133.880] (-1133.067) (-1131.995) (-1133.495) -- 0:00:08
874000 -- [-1130.609] (-1129.647) (-1130.260) (-1131.880) * (-1131.320) (-1131.338) (-1133.729) [-1134.925] -- 0:00:08
874500 -- (-1131.555) (-1127.896) [-1133.358] (-1130.936) * (-1130.046) (-1131.739) [-1132.262] (-1130.482) -- 0:00:08
875000 -- (-1133.172) [-1132.046] (-1130.627) (-1131.976) * (-1132.893) (-1133.220) [-1131.477] (-1132.349) -- 0:00:08
Average standard deviation of split frequencies: 0.009615
875500 -- (-1129.781) (-1130.404) (-1134.416) [-1130.592] * [-1129.203] (-1130.580) (-1130.183) (-1131.756) -- 0:00:08
876000 -- [-1130.338] (-1133.825) (-1132.343) (-1136.694) * (-1130.588) [-1130.841] (-1136.787) (-1130.694) -- 0:00:08
876500 -- [-1128.397] (-1130.772) (-1132.115) (-1135.151) * (-1132.137) (-1132.772) [-1132.615] (-1131.525) -- 0:00:08
877000 -- (-1129.211) (-1131.641) (-1132.930) [-1130.613] * (-1130.049) (-1133.394) [-1136.641] (-1132.443) -- 0:00:08
877500 -- (-1130.862) [-1132.488] (-1131.279) (-1131.578) * (-1127.905) (-1132.425) [-1130.762] (-1130.654) -- 0:00:08
878000 -- (-1129.633) (-1130.600) [-1133.644] (-1135.816) * (-1132.481) (-1129.068) (-1130.800) [-1132.136] -- 0:00:08
878500 -- (-1133.220) (-1130.733) (-1130.780) [-1138.067] * (-1132.922) (-1134.492) [-1131.784] (-1130.048) -- 0:00:08
879000 -- (-1135.805) (-1135.819) (-1130.374) [-1133.912] * (-1129.334) (-1130.058) (-1130.160) [-1132.672] -- 0:00:07
879500 -- (-1130.856) (-1130.730) [-1133.442] (-1133.961) * (-1129.738) (-1131.645) [-1131.597] (-1136.950) -- 0:00:07
880000 -- (-1130.948) (-1134.059) (-1128.683) [-1133.812] * (-1130.498) [-1128.730] (-1130.634) (-1133.423) -- 0:00:07
Average standard deviation of split frequencies: 0.009706
880500 -- (-1129.831) (-1134.953) (-1130.414) [-1135.106] * (-1134.261) (-1129.323) [-1130.618] (-1131.526) -- 0:00:07
881000 -- [-1131.200] (-1128.592) (-1129.531) (-1134.575) * (-1129.455) (-1131.352) (-1129.342) [-1133.218] -- 0:00:07
881500 -- (-1131.237) (-1128.762) [-1130.674] (-1134.915) * [-1132.754] (-1128.580) (-1130.247) (-1132.101) -- 0:00:07
882000 -- (-1135.193) [-1131.108] (-1131.478) (-1134.471) * (-1130.168) (-1131.725) [-1130.675] (-1131.258) -- 0:00:07
882500 -- [-1132.065] (-1132.496) (-1129.994) (-1133.698) * (-1130.992) (-1128.931) (-1131.154) [-1130.578] -- 0:00:07
883000 -- (-1131.460) (-1133.323) [-1128.462] (-1130.748) * (-1131.822) [-1129.755] (-1130.955) (-1130.728) -- 0:00:07
883500 -- (-1132.624) (-1132.734) (-1129.350) [-1131.416] * (-1129.121) (-1133.777) [-1131.058] (-1130.760) -- 0:00:07
884000 -- (-1133.455) (-1132.268) (-1130.924) [-1131.171] * (-1129.364) [-1131.510] (-1131.366) (-1131.965) -- 0:00:07
884500 -- (-1131.620) [-1130.805] (-1133.953) (-1131.224) * (-1132.938) (-1130.213) [-1130.556] (-1132.698) -- 0:00:07
885000 -- (-1132.192) [-1129.963] (-1133.215) (-1133.718) * (-1135.805) [-1131.964] (-1131.243) (-1134.089) -- 0:00:07
Average standard deviation of split frequencies: 0.009683
885500 -- (-1133.247) (-1130.020) [-1132.217] (-1130.348) * (-1130.916) (-1130.555) [-1131.213] (-1130.276) -- 0:00:07
886000 -- [-1130.669] (-1128.716) (-1132.351) (-1131.879) * [-1132.606] (-1130.385) (-1129.331) (-1135.574) -- 0:00:07
886500 -- (-1130.281) (-1131.740) (-1133.971) [-1134.083] * (-1133.167) [-1132.591] (-1129.432) (-1130.687) -- 0:00:07
887000 -- (-1129.652) (-1130.594) (-1136.303) [-1131.489] * (-1134.835) (-1130.822) [-1131.485] (-1130.831) -- 0:00:07
887500 -- (-1130.409) [-1129.600] (-1133.328) (-1128.513) * [-1130.075] (-1132.199) (-1128.804) (-1133.593) -- 0:00:07
888000 -- (-1132.854) (-1132.618) (-1129.254) [-1131.802] * [-1129.634] (-1129.529) (-1134.435) (-1132.438) -- 0:00:07
888500 -- (-1130.203) (-1138.200) (-1130.770) [-1131.740] * (-1133.314) [-1133.865] (-1131.697) (-1134.143) -- 0:00:07
889000 -- [-1134.818] (-1130.738) (-1131.332) (-1132.465) * (-1133.927) (-1131.131) [-1131.193] (-1130.590) -- 0:00:07
889500 -- (-1132.248) (-1133.493) (-1133.811) [-1132.601] * (-1135.276) (-1134.459) (-1132.292) [-1132.333] -- 0:00:07
890000 -- (-1131.781) (-1133.139) [-1130.877] (-1131.549) * (-1135.745) (-1129.558) (-1133.187) [-1132.139] -- 0:00:07
Average standard deviation of split frequencies: 0.010127
890500 -- [-1131.672] (-1132.364) (-1131.019) (-1131.198) * (-1134.107) (-1129.131) [-1132.629] (-1136.050) -- 0:00:07
891000 -- [-1129.566] (-1132.217) (-1130.034) (-1132.756) * (-1132.283) (-1130.726) (-1131.193) [-1131.410] -- 0:00:07
891500 -- [-1132.116] (-1132.478) (-1132.207) (-1129.864) * [-1135.170] (-1135.224) (-1131.889) (-1133.234) -- 0:00:07
892000 -- (-1132.222) (-1131.075) (-1132.040) [-1130.707] * (-1129.559) [-1130.822] (-1131.864) (-1136.898) -- 0:00:07
892500 -- (-1131.918) (-1130.604) [-1131.024] (-1130.871) * (-1133.077) (-1134.742) (-1133.417) [-1130.816] -- 0:00:07
893000 -- (-1134.017) (-1132.099) (-1129.743) [-1130.733] * (-1132.871) (-1132.568) (-1137.269) [-1131.461] -- 0:00:07
893500 -- (-1132.116) (-1133.683) (-1131.031) [-1130.563] * (-1129.559) [-1132.688] (-1136.753) (-1133.083) -- 0:00:07
894000 -- (-1129.864) (-1132.332) [-1133.223] (-1131.641) * (-1130.254) (-1130.264) (-1135.329) [-1132.110] -- 0:00:06
894500 -- (-1130.244) (-1138.175) [-1130.548] (-1132.446) * (-1130.141) [-1131.132] (-1130.661) (-1133.490) -- 0:00:06
895000 -- (-1130.695) (-1130.406) (-1131.601) [-1129.988] * (-1132.821) (-1134.699) [-1129.239] (-1133.949) -- 0:00:06
Average standard deviation of split frequencies: 0.010382
895500 -- (-1128.373) (-1130.663) [-1130.326] (-1132.023) * (-1129.732) [-1133.574] (-1132.250) (-1130.925) -- 0:00:06
896000 -- (-1132.321) (-1131.987) (-1129.208) [-1131.035] * (-1133.886) (-1131.614) [-1130.086] (-1130.849) -- 0:00:06
896500 -- (-1130.152) (-1130.996) [-1134.399] (-1132.580) * (-1131.182) [-1130.242] (-1132.422) (-1133.313) -- 0:00:06
897000 -- (-1134.992) (-1132.259) (-1133.366) [-1129.547] * (-1129.986) (-1136.600) [-1132.114] (-1132.894) -- 0:00:06
897500 -- (-1136.418) [-1130.075] (-1129.781) (-1130.981) * (-1129.315) [-1132.099] (-1131.173) (-1129.795) -- 0:00:06
898000 -- (-1133.064) (-1131.113) [-1131.689] (-1129.874) * (-1133.227) (-1132.476) [-1130.160] (-1131.797) -- 0:00:06
898500 -- (-1134.324) [-1129.637] (-1129.278) (-1129.175) * (-1133.737) (-1130.232) (-1130.806) [-1133.647] -- 0:00:06
899000 -- (-1129.929) (-1131.655) [-1131.814] (-1131.529) * (-1128.235) [-1131.878] (-1130.379) (-1130.806) -- 0:00:06
899500 -- (-1130.907) [-1130.246] (-1133.860) (-1133.607) * (-1128.871) [-1130.952] (-1130.481) (-1131.412) -- 0:00:06
900000 -- (-1130.998) (-1132.754) (-1131.866) [-1130.830] * (-1135.287) (-1131.446) [-1132.380] (-1131.124) -- 0:00:06
Average standard deviation of split frequencies: 0.010259
900500 -- (-1131.821) [-1129.805] (-1130.712) (-1132.961) * (-1135.069) (-1132.489) (-1133.463) [-1130.949] -- 0:00:06
901000 -- [-1129.415] (-1130.504) (-1130.762) (-1136.000) * (-1131.127) (-1131.441) [-1131.215] (-1131.627) -- 0:00:06
901500 -- (-1128.719) [-1129.046] (-1133.598) (-1133.003) * (-1129.877) (-1130.152) [-1130.864] (-1131.041) -- 0:00:06
902000 -- [-1129.780] (-1128.658) (-1133.833) (-1131.117) * (-1131.000) (-1130.770) [-1131.723] (-1132.482) -- 0:00:06
902500 -- [-1130.483] (-1130.925) (-1130.748) (-1132.532) * (-1130.739) [-1132.313] (-1131.070) (-1133.682) -- 0:00:06
903000 -- (-1133.540) (-1129.460) [-1132.110] (-1132.141) * [-1131.802] (-1131.765) (-1130.838) (-1134.930) -- 0:00:06
903500 -- (-1133.955) [-1131.026] (-1133.838) (-1131.673) * (-1135.647) [-1130.938] (-1131.631) (-1131.785) -- 0:00:06
904000 -- (-1134.201) (-1130.771) (-1129.368) [-1132.342] * [-1131.478] (-1133.689) (-1132.642) (-1131.706) -- 0:00:06
904500 -- (-1134.088) [-1130.957] (-1131.788) (-1131.702) * [-1132.591] (-1134.146) (-1129.834) (-1134.759) -- 0:00:06
905000 -- (-1131.222) (-1132.328) (-1132.529) [-1129.810] * [-1130.593] (-1134.572) (-1135.097) (-1136.928) -- 0:00:06
Average standard deviation of split frequencies: 0.010337
905500 -- (-1130.510) [-1133.835] (-1134.455) (-1131.660) * (-1131.636) (-1135.288) [-1130.339] (-1133.405) -- 0:00:06
906000 -- (-1130.937) (-1130.763) [-1134.799] (-1130.543) * (-1131.933) [-1132.328] (-1131.551) (-1131.188) -- 0:00:06
906500 -- [-1132.191] (-1133.561) (-1131.444) (-1132.481) * (-1130.050) [-1130.247] (-1130.735) (-1130.596) -- 0:00:06
907000 -- (-1132.022) (-1129.453) [-1131.760] (-1135.464) * [-1130.940] (-1131.490) (-1133.782) (-1136.348) -- 0:00:06
907500 -- (-1134.731) (-1129.830) [-1132.031] (-1131.798) * [-1129.508] (-1131.670) (-1129.609) (-1132.911) -- 0:00:06
908000 -- [-1129.798] (-1128.735) (-1132.092) (-1131.421) * [-1128.932] (-1130.391) (-1133.332) (-1130.833) -- 0:00:06
908500 -- (-1131.453) [-1129.984] (-1133.336) (-1133.140) * (-1135.269) (-1131.695) (-1134.650) [-1129.356] -- 0:00:06
909000 -- (-1134.747) (-1132.950) (-1132.962) [-1130.536] * (-1133.730) (-1134.581) (-1130.382) [-1129.345] -- 0:00:06
909500 -- (-1130.975) [-1131.373] (-1131.741) (-1131.468) * (-1130.244) (-1132.413) [-1131.177] (-1129.776) -- 0:00:05
910000 -- (-1133.158) [-1130.714] (-1133.749) (-1129.718) * (-1129.913) [-1130.266] (-1130.633) (-1129.579) -- 0:00:05
Average standard deviation of split frequencies: 0.010526
910500 -- (-1131.459) (-1130.987) [-1130.177] (-1132.883) * (-1132.876) [-1132.276] (-1130.693) (-1128.343) -- 0:00:05
911000 -- [-1130.637] (-1130.318) (-1131.839) (-1133.481) * (-1131.187) [-1130.167] (-1131.810) (-1131.964) -- 0:00:05
911500 -- (-1130.941) (-1130.716) [-1133.187] (-1130.744) * [-1131.547] (-1129.937) (-1131.186) (-1129.827) -- 0:00:05
912000 -- (-1133.417) (-1130.554) (-1130.234) [-1133.788] * (-1131.227) (-1132.061) (-1131.402) [-1130.706] -- 0:00:05
912500 -- (-1131.983) [-1129.344] (-1133.198) (-1130.893) * (-1132.156) [-1130.608] (-1131.263) (-1132.339) -- 0:00:05
913000 -- (-1129.994) (-1132.890) (-1130.060) [-1131.255] * (-1128.380) (-1130.756) (-1131.783) [-1130.551] -- 0:00:05
913500 -- (-1133.119) (-1131.975) (-1131.446) [-1131.206] * (-1133.948) [-1129.990] (-1131.234) (-1132.013) -- 0:00:05
914000 -- (-1129.293) [-1130.497] (-1130.876) (-1131.032) * (-1131.786) [-1129.455] (-1131.044) (-1135.607) -- 0:00:05
914500 -- (-1134.244) [-1130.574] (-1130.606) (-1129.007) * (-1131.664) [-1130.325] (-1131.008) (-1137.678) -- 0:00:05
915000 -- (-1131.889) [-1132.742] (-1131.342) (-1128.954) * (-1131.010) [-1130.807] (-1132.176) (-1132.447) -- 0:00:05
Average standard deviation of split frequencies: 0.010396
915500 -- (-1130.711) (-1133.453) (-1130.173) [-1130.110] * [-1130.453] (-1131.292) (-1135.016) (-1132.306) -- 0:00:05
916000 -- (-1130.472) (-1131.359) [-1128.818] (-1128.802) * (-1130.016) [-1131.301] (-1134.977) (-1130.365) -- 0:00:05
916500 -- (-1132.533) (-1131.388) (-1131.642) [-1129.300] * [-1131.095] (-1132.018) (-1138.452) (-1133.011) -- 0:00:05
917000 -- (-1133.806) [-1130.278] (-1133.012) (-1131.187) * [-1132.342] (-1139.022) (-1131.127) (-1131.399) -- 0:00:05
917500 -- (-1131.940) (-1133.887) [-1131.085] (-1132.350) * (-1131.878) (-1132.154) (-1134.379) [-1130.977] -- 0:00:05
918000 -- (-1131.001) (-1132.427) [-1129.928] (-1134.335) * [-1130.024] (-1133.780) (-1134.926) (-1133.782) -- 0:00:05
918500 -- (-1129.864) (-1133.088) [-1129.641] (-1131.124) * (-1131.272) (-1130.165) (-1131.082) [-1134.181] -- 0:00:05
919000 -- [-1128.896] (-1131.586) (-1129.873) (-1132.343) * (-1134.417) (-1132.014) [-1127.948] (-1130.880) -- 0:00:05
919500 -- (-1128.895) (-1128.897) (-1130.283) [-1131.186] * (-1133.130) [-1131.694] (-1129.479) (-1131.022) -- 0:00:05
920000 -- (-1131.336) [-1133.141] (-1132.899) (-1131.412) * (-1130.363) (-1132.209) (-1130.203) [-1130.370] -- 0:00:05
Average standard deviation of split frequencies: 0.010548
920500 -- (-1131.775) (-1132.333) [-1132.688] (-1132.093) * (-1130.699) [-1131.269] (-1129.137) (-1130.466) -- 0:00:05
921000 -- (-1134.244) (-1133.424) [-1130.059] (-1130.948) * (-1131.373) [-1130.932] (-1133.518) (-1130.101) -- 0:00:05
921500 -- [-1130.111] (-1132.726) (-1130.206) (-1132.972) * (-1133.418) (-1131.498) (-1131.304) [-1132.525] -- 0:00:05
922000 -- (-1130.889) (-1131.901) [-1130.786] (-1135.449) * (-1137.140) (-1133.148) [-1131.020] (-1130.765) -- 0:00:05
922500 -- (-1129.014) [-1130.323] (-1131.014) (-1129.066) * (-1134.396) (-1130.330) (-1131.268) [-1129.421] -- 0:00:05
923000 -- (-1131.230) (-1131.778) [-1136.549] (-1129.450) * (-1131.235) (-1131.768) [-1132.773] (-1129.088) -- 0:00:05
923500 -- (-1129.063) (-1130.270) (-1133.474) [-1130.038] * (-1131.358) (-1129.963) [-1130.546] (-1129.089) -- 0:00:05
924000 -- [-1131.879] (-1130.652) (-1132.213) (-1132.663) * (-1133.229) [-1133.481] (-1131.279) (-1130.127) -- 0:00:05
924500 -- [-1132.631] (-1132.419) (-1130.685) (-1131.285) * [-1130.800] (-1130.407) (-1131.967) (-1128.768) -- 0:00:04
925000 -- (-1131.063) [-1129.495] (-1130.404) (-1130.762) * [-1131.974] (-1135.340) (-1129.812) (-1132.249) -- 0:00:04
Average standard deviation of split frequencies: 0.010148
925500 -- [-1132.859] (-1133.198) (-1131.892) (-1133.537) * (-1131.943) [-1131.789] (-1128.420) (-1129.790) -- 0:00:04
926000 -- [-1132.551] (-1132.448) (-1134.338) (-1137.909) * (-1129.110) [-1134.429] (-1131.439) (-1130.024) -- 0:00:04
926500 -- [-1129.287] (-1134.748) (-1137.165) (-1134.297) * (-1131.274) [-1131.695] (-1131.347) (-1132.068) -- 0:00:04
927000 -- [-1130.223] (-1132.031) (-1132.088) (-1130.954) * [-1130.559] (-1132.105) (-1128.454) (-1131.374) -- 0:00:04
927500 -- [-1132.095] (-1130.360) (-1129.534) (-1130.710) * [-1130.629] (-1132.326) (-1133.184) (-1131.162) -- 0:00:04
928000 -- (-1130.367) (-1131.865) (-1131.147) [-1132.781] * (-1130.934) (-1134.664) (-1137.423) [-1129.906] -- 0:00:04
928500 -- [-1130.551] (-1130.244) (-1138.117) (-1132.538) * (-1131.003) [-1133.143] (-1129.967) (-1130.505) -- 0:00:04
929000 -- (-1130.238) (-1130.560) [-1130.122] (-1130.005) * (-1134.240) (-1133.511) (-1130.923) [-1131.808] -- 0:00:04
929500 -- [-1127.992] (-1132.142) (-1129.968) (-1132.807) * [-1132.042] (-1130.557) (-1128.918) (-1131.735) -- 0:00:04
930000 -- [-1129.325] (-1134.448) (-1131.210) (-1132.384) * (-1131.142) (-1134.251) [-1129.979] (-1131.998) -- 0:00:04
Average standard deviation of split frequencies: 0.009894
930500 -- [-1130.850] (-1132.380) (-1130.671) (-1130.932) * (-1132.792) (-1133.336) [-1128.669] (-1132.175) -- 0:00:04
931000 -- (-1129.603) (-1129.784) [-1129.156] (-1130.960) * (-1133.735) [-1129.025] (-1134.247) (-1130.616) -- 0:00:04
931500 -- (-1133.348) (-1130.472) [-1129.909] (-1130.633) * (-1132.884) [-1130.103] (-1130.129) (-1129.664) -- 0:00:04
932000 -- (-1135.469) (-1129.860) (-1131.185) [-1129.619] * (-1132.100) [-1131.667] (-1128.773) (-1136.243) -- 0:00:04
932500 -- (-1131.027) (-1129.255) [-1129.909] (-1130.472) * (-1130.617) [-1129.332] (-1127.838) (-1134.012) -- 0:00:04
933000 -- (-1132.157) (-1132.731) (-1130.875) [-1132.957] * (-1130.549) (-1132.498) [-1127.638] (-1133.116) -- 0:00:04
933500 -- (-1132.280) (-1132.085) (-1130.138) [-1130.862] * (-1128.673) (-1133.624) [-1130.907] (-1130.135) -- 0:00:04
934000 -- (-1134.379) [-1129.690] (-1132.202) (-1131.897) * [-1131.108] (-1129.773) (-1131.929) (-1130.452) -- 0:00:04
934500 -- (-1129.058) [-1131.365] (-1132.345) (-1133.825) * (-1132.146) (-1129.789) [-1128.204] (-1132.837) -- 0:00:04
935000 -- (-1134.041) (-1130.848) [-1131.000] (-1133.686) * (-1131.161) (-1130.545) [-1131.139] (-1130.555) -- 0:00:04
Average standard deviation of split frequencies: 0.009435
935500 -- (-1131.989) [-1130.119] (-1132.370) (-1134.969) * [-1131.802] (-1130.994) (-1130.207) (-1131.193) -- 0:00:04
936000 -- [-1130.557] (-1132.284) (-1131.814) (-1133.402) * (-1132.807) (-1128.806) [-1129.098] (-1131.401) -- 0:00:04
936500 -- (-1133.887) (-1132.108) [-1131.998] (-1132.296) * [-1134.321] (-1130.720) (-1129.037) (-1135.604) -- 0:00:04
937000 -- [-1129.525] (-1132.221) (-1131.882) (-1131.431) * (-1132.392) (-1133.228) [-1129.098] (-1132.235) -- 0:00:04
937500 -- (-1131.604) (-1132.369) [-1130.388] (-1131.841) * (-1132.538) (-1130.607) (-1134.671) [-1131.999] -- 0:00:04
938000 -- (-1131.680) (-1133.827) (-1129.371) [-1135.002] * (-1132.983) (-1129.660) [-1135.057] (-1131.114) -- 0:00:04
938500 -- (-1132.868) (-1135.335) [-1131.201] (-1131.629) * (-1135.280) (-1132.688) [-1130.282] (-1134.068) -- 0:00:04
939000 -- (-1131.409) (-1133.551) (-1130.086) [-1130.367] * [-1130.317] (-1130.895) (-1135.650) (-1132.311) -- 0:00:04
939500 -- [-1131.520] (-1132.147) (-1130.196) (-1133.342) * (-1131.339) (-1131.098) (-1132.590) [-1131.256] -- 0:00:03
940000 -- [-1131.544] (-1132.307) (-1132.296) (-1132.092) * (-1133.111) [-1128.037] (-1132.716) (-1131.977) -- 0:00:03
Average standard deviation of split frequencies: 0.009622
940500 -- (-1131.487) (-1132.516) (-1130.732) [-1130.886] * (-1128.913) (-1131.716) [-1131.914] (-1133.347) -- 0:00:03
941000 -- [-1129.054] (-1131.230) (-1130.650) (-1129.696) * (-1132.093) (-1134.086) (-1132.462) [-1130.241] -- 0:00:03
941500 -- [-1132.580] (-1130.563) (-1128.641) (-1129.516) * (-1131.788) (-1131.687) (-1132.868) [-1132.611] -- 0:00:03
942000 -- (-1133.322) (-1131.958) [-1129.496] (-1131.933) * (-1132.706) [-1132.578] (-1130.786) (-1133.615) -- 0:00:03
942500 -- (-1132.598) (-1129.220) [-1130.839] (-1132.165) * (-1131.457) (-1136.272) [-1131.080] (-1129.114) -- 0:00:03
943000 -- (-1129.262) [-1131.925] (-1133.861) (-1132.934) * (-1135.333) (-1132.690) (-1133.487) [-1128.811] -- 0:00:03
943500 -- [-1132.464] (-1131.919) (-1131.722) (-1132.873) * [-1133.163] (-1130.808) (-1130.231) (-1131.793) -- 0:00:03
944000 -- (-1131.069) [-1132.397] (-1129.626) (-1133.273) * [-1130.090] (-1131.591) (-1131.795) (-1132.328) -- 0:00:03
944500 -- (-1133.151) (-1131.586) [-1133.889] (-1131.488) * (-1131.400) [-1132.749] (-1133.656) (-1132.729) -- 0:00:03
945000 -- [-1129.929] (-1132.712) (-1130.431) (-1134.554) * (-1130.875) [-1131.451] (-1134.625) (-1131.349) -- 0:00:03
Average standard deviation of split frequencies: 0.010099
945500 -- [-1129.581] (-1130.332) (-1131.293) (-1135.262) * (-1130.647) (-1132.929) [-1131.402] (-1129.980) -- 0:00:03
946000 -- (-1129.523) [-1131.671] (-1133.928) (-1131.991) * (-1130.753) (-1135.895) (-1131.487) [-1132.131] -- 0:00:03
946500 -- (-1130.884) (-1129.722) (-1133.408) [-1130.862] * [-1129.915] (-1130.703) (-1133.925) (-1134.087) -- 0:00:03
947000 -- (-1129.957) (-1130.927) (-1130.519) [-1129.437] * (-1131.322) (-1131.364) [-1132.717] (-1130.572) -- 0:00:03
947500 -- (-1131.808) (-1130.839) (-1131.093) [-1129.834] * (-1131.241) (-1134.982) [-1132.825] (-1128.544) -- 0:00:03
948000 -- (-1134.662) (-1132.343) (-1137.030) [-1131.215] * (-1138.836) (-1130.477) (-1130.003) [-1130.155] -- 0:00:03
948500 -- (-1133.819) [-1133.648] (-1134.503) (-1129.420) * (-1132.570) (-1131.643) (-1131.444) [-1131.200] -- 0:00:03
949000 -- (-1132.167) [-1136.096] (-1132.647) (-1130.853) * [-1134.709] (-1133.949) (-1130.027) (-1128.710) -- 0:00:03
949500 -- (-1133.761) [-1131.455] (-1133.565) (-1133.470) * [-1131.958] (-1131.763) (-1134.437) (-1130.237) -- 0:00:03
950000 -- (-1129.415) [-1132.035] (-1130.109) (-1130.444) * (-1132.939) (-1133.830) [-1130.418] (-1130.864) -- 0:00:03
Average standard deviation of split frequencies: 0.010777
950500 -- [-1129.355] (-1136.830) (-1130.448) (-1134.411) * (-1135.245) (-1132.954) [-1131.050] (-1131.930) -- 0:00:03
951000 -- (-1131.570) (-1132.502) [-1133.293] (-1130.441) * (-1132.945) (-1131.988) (-1128.469) [-1128.112] -- 0:00:03
951500 -- (-1132.115) [-1131.271] (-1135.692) (-1137.993) * (-1131.376) [-1130.165] (-1134.120) (-1129.338) -- 0:00:03
952000 -- (-1131.035) [-1131.817] (-1135.525) (-1130.310) * [-1131.556] (-1131.143) (-1132.998) (-1130.546) -- 0:00:03
952500 -- (-1133.807) [-1128.943] (-1134.486) (-1129.879) * (-1132.030) [-1131.657] (-1134.339) (-1130.904) -- 0:00:03
953000 -- (-1133.042) [-1133.234] (-1132.469) (-1132.119) * (-1129.990) [-1131.155] (-1132.982) (-1138.507) -- 0:00:03
953500 -- (-1129.906) (-1134.527) (-1133.209) [-1129.079] * [-1129.991] (-1131.197) (-1133.761) (-1133.499) -- 0:00:03
954000 -- (-1133.639) [-1134.652] (-1134.332) (-1130.418) * [-1131.650] (-1132.173) (-1131.983) (-1139.337) -- 0:00:03
954500 -- [-1132.018] (-1131.529) (-1134.862) (-1134.012) * (-1130.825) (-1131.972) [-1136.013] (-1132.617) -- 0:00:03
955000 -- (-1132.427) [-1132.142] (-1132.709) (-1131.409) * (-1134.439) [-1131.340] (-1132.202) (-1130.409) -- 0:00:02
Average standard deviation of split frequencies: 0.010881
955500 -- (-1133.222) (-1130.722) (-1134.295) [-1131.707] * (-1132.375) (-1135.146) [-1133.383] (-1130.380) -- 0:00:02
956000 -- [-1130.142] (-1130.034) (-1132.854) (-1134.278) * (-1131.063) (-1134.780) [-1135.129] (-1136.150) -- 0:00:02
956500 -- (-1132.972) [-1129.651] (-1132.732) (-1130.471) * (-1132.007) (-1130.637) [-1133.103] (-1139.446) -- 0:00:02
957000 -- [-1134.431] (-1134.016) (-1131.813) (-1129.892) * [-1132.272] (-1129.410) (-1138.258) (-1133.193) -- 0:00:02
957500 -- (-1133.810) [-1131.030] (-1133.329) (-1131.346) * (-1131.549) [-1132.443] (-1131.608) (-1131.045) -- 0:00:02
958000 -- (-1134.423) [-1130.508] (-1129.742) (-1130.756) * (-1131.501) (-1129.992) (-1131.455) [-1132.742] -- 0:00:02
958500 -- [-1131.411] (-1132.153) (-1133.902) (-1134.408) * (-1136.866) [-1133.425] (-1129.559) (-1133.913) -- 0:00:02
959000 -- (-1131.964) (-1130.595) [-1131.568] (-1133.130) * (-1131.705) (-1132.223) (-1130.069) [-1131.375] -- 0:00:02
959500 -- (-1128.682) (-1130.726) [-1134.563] (-1131.073) * (-1132.177) (-1130.350) [-1131.627] (-1131.388) -- 0:00:02
960000 -- [-1130.683] (-1127.620) (-1131.762) (-1133.227) * (-1131.037) [-1132.624] (-1132.056) (-1131.927) -- 0:00:02
Average standard deviation of split frequencies: 0.010665
960500 -- (-1129.298) (-1131.113) [-1134.112] (-1130.300) * (-1130.880) [-1134.051] (-1134.094) (-1132.530) -- 0:00:02
961000 -- (-1131.531) (-1134.414) (-1130.484) [-1129.769] * (-1131.497) (-1132.421) [-1130.715] (-1132.153) -- 0:00:02
961500 -- (-1131.117) [-1131.585] (-1132.307) (-1130.883) * (-1131.639) (-1132.441) (-1131.477) [-1129.687] -- 0:00:02
962000 -- [-1129.568] (-1130.969) (-1132.237) (-1132.445) * (-1133.174) (-1130.107) [-1130.085] (-1129.573) -- 0:00:02
962500 -- (-1133.608) [-1129.185] (-1131.482) (-1130.218) * (-1132.635) (-1130.184) (-1127.597) [-1131.911] -- 0:00:02
963000 -- (-1132.483) (-1131.120) (-1134.617) [-1129.596] * (-1133.022) (-1128.205) [-1129.425] (-1132.600) -- 0:00:02
963500 -- (-1130.250) (-1131.463) (-1132.213) [-1129.854] * [-1132.870] (-1128.743) (-1130.789) (-1132.923) -- 0:00:02
964000 -- (-1130.922) (-1130.767) [-1133.293] (-1128.727) * (-1131.914) [-1131.182] (-1130.854) (-1130.416) -- 0:00:02
964500 -- (-1130.898) (-1130.739) (-1131.983) [-1128.020] * (-1132.330) [-1130.796] (-1130.753) (-1132.489) -- 0:00:02
965000 -- (-1131.192) [-1130.664] (-1132.921) (-1131.811) * (-1132.002) [-1131.952] (-1136.033) (-1132.068) -- 0:00:02
Average standard deviation of split frequencies: 0.010411
965500 -- (-1135.049) (-1132.693) [-1132.115] (-1129.461) * (-1133.800) (-1132.016) (-1133.114) [-1132.401] -- 0:00:02
966000 -- [-1130.904] (-1130.800) (-1133.661) (-1132.033) * (-1131.443) (-1130.559) (-1129.991) [-1129.552] -- 0:00:02
966500 -- (-1133.664) (-1130.044) [-1131.353] (-1131.914) * (-1134.136) [-1131.907] (-1132.686) (-1132.343) -- 0:00:02
967000 -- [-1130.074] (-1129.029) (-1132.469) (-1129.237) * (-1130.071) [-1131.985] (-1130.886) (-1131.414) -- 0:00:02
967500 -- (-1129.706) (-1131.842) [-1132.185] (-1129.128) * [-1131.003] (-1132.207) (-1129.629) (-1134.388) -- 0:00:02
968000 -- (-1132.280) (-1131.270) (-1131.206) [-1129.663] * [-1130.025] (-1130.996) (-1134.924) (-1131.405) -- 0:00:02
968500 -- (-1130.101) [-1130.763] (-1134.628) (-1136.640) * (-1131.989) [-1128.475] (-1137.621) (-1132.010) -- 0:00:02
969000 -- (-1134.494) (-1135.372) (-1131.300) [-1133.384] * (-1129.379) (-1128.520) [-1131.489] (-1132.253) -- 0:00:02
969500 -- [-1132.016] (-1141.948) (-1132.903) (-1131.317) * (-1129.876) [-1128.915] (-1129.170) (-1130.063) -- 0:00:02
970000 -- (-1130.129) [-1131.280] (-1137.305) (-1128.747) * (-1131.076) (-1129.541) [-1131.224] (-1130.079) -- 0:00:01
Average standard deviation of split frequencies: 0.010684
970500 -- (-1133.188) [-1131.490] (-1129.962) (-1131.300) * (-1131.624) (-1131.684) [-1128.850] (-1130.398) -- 0:00:01
971000 -- (-1131.127) (-1130.492) [-1131.813] (-1129.934) * [-1130.852] (-1134.037) (-1129.641) (-1134.598) -- 0:00:01
971500 -- (-1130.615) (-1129.287) (-1133.210) [-1131.458] * [-1130.087] (-1132.298) (-1130.924) (-1134.508) -- 0:00:01
972000 -- [-1129.695] (-1130.267) (-1131.472) (-1131.526) * (-1131.573) (-1135.291) [-1135.178] (-1130.431) -- 0:00:01
972500 -- (-1130.416) (-1132.073) (-1131.180) [-1131.037] * (-1131.256) (-1129.315) (-1133.655) [-1130.805] -- 0:00:01
973000 -- (-1134.950) (-1128.428) [-1134.488] (-1129.478) * (-1132.301) (-1131.248) (-1132.270) [-1130.082] -- 0:00:01
973500 -- [-1135.421] (-1129.713) (-1133.158) (-1131.044) * (-1130.952) (-1132.750) [-1131.413] (-1131.066) -- 0:00:01
974000 -- [-1132.753] (-1133.568) (-1131.614) (-1131.111) * (-1129.330) (-1138.775) (-1132.774) [-1131.718] -- 0:00:01
974500 -- (-1132.746) (-1132.176) [-1130.081] (-1131.904) * (-1130.734) (-1130.262) [-1137.490] (-1131.872) -- 0:00:01
975000 -- (-1130.835) [-1131.606] (-1129.753) (-1131.690) * (-1134.536) [-1132.120] (-1133.361) (-1130.352) -- 0:00:01
Average standard deviation of split frequencies: 0.010916
975500 -- (-1135.570) [-1128.033] (-1134.245) (-1132.302) * (-1131.017) [-1132.801] (-1134.580) (-1130.307) -- 0:00:01
976000 -- (-1133.562) (-1130.127) (-1129.432) [-1131.393] * (-1131.014) (-1134.649) [-1133.291] (-1131.207) -- 0:00:01
976500 -- [-1133.398] (-1130.367) (-1133.645) (-1130.754) * (-1131.138) (-1131.905) [-1131.916] (-1134.638) -- 0:00:01
977000 -- (-1132.481) (-1133.658) [-1130.931] (-1132.295) * (-1132.296) [-1132.505] (-1135.570) (-1131.193) -- 0:00:01
977500 -- (-1128.549) [-1132.059] (-1132.128) (-1131.448) * [-1130.440] (-1130.631) (-1134.437) (-1130.790) -- 0:00:01
978000 -- (-1130.125) (-1131.404) [-1129.200] (-1133.763) * (-1132.512) (-1133.173) (-1137.778) [-1130.036] -- 0:00:01
978500 -- (-1132.844) (-1131.561) [-1130.829] (-1130.373) * (-1130.951) [-1130.415] (-1135.087) (-1135.602) -- 0:00:01
979000 -- [-1129.994] (-1136.322) (-1130.324) (-1129.253) * (-1134.464) (-1132.927) (-1130.184) [-1131.409] -- 0:00:01
979500 -- (-1131.556) (-1131.890) (-1130.501) [-1131.688] * [-1130.196] (-1133.091) (-1135.725) (-1130.228) -- 0:00:01
980000 -- [-1131.611] (-1132.495) (-1130.168) (-1132.958) * (-1131.445) [-1132.615] (-1135.072) (-1131.433) -- 0:00:01
Average standard deviation of split frequencies: 0.011088
980500 -- (-1127.385) (-1131.461) (-1134.967) [-1129.425] * [-1131.710] (-1131.168) (-1131.509) (-1133.753) -- 0:00:01
981000 -- (-1130.749) (-1133.927) [-1131.611] (-1128.554) * (-1132.829) (-1130.463) [-1130.788] (-1135.511) -- 0:00:01
981500 -- (-1130.309) (-1133.441) (-1131.095) [-1131.666] * (-1131.474) [-1129.005] (-1131.213) (-1131.162) -- 0:00:01
982000 -- (-1130.305) [-1130.591] (-1130.785) (-1132.593) * (-1131.211) (-1130.352) (-1131.536) [-1132.450] -- 0:00:01
982500 -- [-1130.711] (-1130.201) (-1132.219) (-1129.412) * (-1133.724) [-1129.743] (-1134.383) (-1131.552) -- 0:00:01
983000 -- (-1133.557) [-1130.583] (-1133.880) (-1130.821) * (-1131.732) (-1131.720) [-1131.689] (-1131.403) -- 0:00:01
983500 -- (-1131.520) (-1130.628) [-1130.670] (-1130.589) * (-1132.862) (-1131.503) (-1131.646) [-1132.696] -- 0:00:01
984000 -- (-1128.674) (-1131.831) (-1133.405) [-1131.005] * [-1133.764] (-1132.013) (-1129.864) (-1133.395) -- 0:00:01
984500 -- (-1129.968) [-1130.688] (-1133.289) (-1130.196) * (-1130.204) (-1132.301) (-1130.373) [-1130.281] -- 0:00:01
985000 -- [-1131.048] (-1129.373) (-1131.658) (-1128.862) * (-1133.035) [-1134.108] (-1131.442) (-1135.250) -- 0:00:00
Average standard deviation of split frequencies: 0.011283
985500 -- (-1135.753) [-1129.166] (-1132.441) (-1128.992) * (-1132.752) [-1130.091] (-1128.712) (-1137.023) -- 0:00:00
986000 -- (-1129.963) [-1129.520] (-1129.369) (-1132.553) * (-1132.839) (-1130.361) (-1132.570) [-1130.586] -- 0:00:00
986500 -- (-1130.518) (-1130.362) (-1133.907) [-1127.517] * (-1132.935) (-1132.589) (-1129.992) [-1129.894] -- 0:00:00
987000 -- (-1131.667) (-1132.362) [-1134.413] (-1131.817) * (-1130.852) (-1135.490) (-1130.026) [-1131.168] -- 0:00:00
987500 -- (-1129.803) (-1130.750) (-1130.808) [-1130.618] * (-1132.527) (-1131.081) [-1131.288] (-1132.969) -- 0:00:00
988000 -- (-1130.549) [-1134.209] (-1131.158) (-1131.320) * (-1131.371) (-1133.264) (-1130.468) [-1130.742] -- 0:00:00
988500 -- (-1132.171) (-1133.509) (-1131.339) [-1132.400] * [-1130.770] (-1131.852) (-1130.635) (-1130.917) -- 0:00:00
989000 -- (-1130.478) (-1133.088) [-1130.746] (-1131.612) * (-1130.025) (-1130.398) [-1134.035] (-1134.466) -- 0:00:00
989500 -- [-1129.767] (-1130.295) (-1129.908) (-1127.635) * (-1133.220) [-1131.754] (-1134.318) (-1133.136) -- 0:00:00
990000 -- [-1130.371] (-1130.515) (-1132.458) (-1129.503) * [-1136.029] (-1133.581) (-1132.243) (-1133.384) -- 0:00:00
Average standard deviation of split frequencies: 0.011040
990500 -- (-1131.782) [-1129.756] (-1135.680) (-1132.713) * (-1131.901) [-1130.866] (-1131.622) (-1130.903) -- 0:00:00
991000 -- (-1132.649) (-1130.608) [-1131.295] (-1131.139) * (-1132.385) (-1131.614) (-1130.099) [-1134.032] -- 0:00:00
991500 -- (-1129.565) [-1130.066] (-1135.926) (-1132.861) * (-1132.769) [-1131.556] (-1131.016) (-1132.379) -- 0:00:00
992000 -- [-1133.005] (-1131.795) (-1131.970) (-1134.421) * (-1132.372) (-1129.841) (-1130.857) [-1130.160] -- 0:00:00
992500 -- (-1133.615) (-1130.588) [-1133.613] (-1131.342) * [-1132.262] (-1132.666) (-1130.948) (-1130.546) -- 0:00:00
993000 -- (-1132.652) [-1131.779] (-1130.356) (-1132.882) * (-1129.664) (-1128.919) (-1131.127) [-1131.963] -- 0:00:00
993500 -- (-1131.310) (-1131.825) (-1130.169) [-1131.256] * [-1130.909] (-1130.023) (-1132.171) (-1131.105) -- 0:00:00
994000 -- (-1130.873) [-1128.999] (-1132.843) (-1132.159) * (-1130.435) [-1132.263] (-1132.464) (-1132.498) -- 0:00:00
994500 -- (-1130.898) (-1129.763) [-1133.250] (-1131.175) * (-1131.449) (-1129.273) (-1136.938) [-1130.330] -- 0:00:00
995000 -- (-1130.768) (-1133.027) [-1131.021] (-1131.376) * [-1131.171] (-1130.563) (-1131.895) (-1130.462) -- 0:00:00
Average standard deviation of split frequencies: 0.011233
995500 -- (-1131.003) [-1129.535] (-1130.922) (-1129.927) * [-1130.583] (-1130.659) (-1132.288) (-1131.421) -- 0:00:00
996000 -- [-1131.034] (-1132.363) (-1131.088) (-1130.784) * (-1130.558) (-1131.066) (-1131.687) [-1130.978] -- 0:00:00
996500 -- (-1133.192) (-1129.724) (-1130.171) [-1129.426] * [-1134.645] (-1132.165) (-1132.968) (-1130.302) -- 0:00:00
997000 -- (-1131.506) [-1129.590] (-1133.622) (-1131.621) * (-1133.641) (-1129.298) (-1134.027) [-1132.588] -- 0:00:00
997500 -- (-1134.144) (-1128.392) [-1131.194] (-1132.580) * (-1131.689) [-1130.440] (-1131.348) (-1133.738) -- 0:00:00
998000 -- (-1132.867) (-1132.029) [-1130.774] (-1131.207) * (-1130.484) (-1131.730) (-1130.316) [-1131.762] -- 0:00:00
998500 -- (-1134.804) (-1129.493) (-1131.665) [-1130.905] * (-1131.404) (-1133.020) [-1135.885] (-1131.253) -- 0:00:00
999000 -- [-1132.474] (-1129.812) (-1133.811) (-1131.963) * [-1129.440] (-1130.664) (-1132.519) (-1131.591) -- 0:00:00
999500 -- (-1132.059) (-1133.656) (-1135.244) [-1131.241] * (-1130.784) (-1130.598) (-1132.097) [-1131.264] -- 0:00:00
1000000 -- [-1130.939] (-1133.217) (-1134.762) (-1131.746) * [-1130.825] (-1131.420) (-1133.829) (-1131.300) -- 0:00:00
Average standard deviation of split frequencies: 0.011275
Analysis completed in 1 mins 6 seconds
Analysis used 64.82 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1126.34
Likelihood of best state for "cold" chain of run 2 was -1126.47
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 74 %) Dirichlet(Revmat{all})
98.2 % ( 94 %) Slider(Revmat{all})
26.9 % ( 21 %) Dirichlet(Pi{all})
29.0 % ( 26 %) Slider(Pi{all})
68.2 % ( 35 %) Multiplier(Alpha{1,2})
79.3 % ( 58 %) Multiplier(Alpha{3})
24.5 % ( 19 %) Slider(Pinvar{all})
97.3 % ( 95 %) ExtSPR(Tau{all},V{all})
69.0 % ( 67 %) ExtTBR(Tau{all},V{all})
98.1 % ( 96 %) NNI(Tau{all},V{all})
87.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
95.2 % ( 95 %) Nodeslider(V{all})
30.7 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 68 %) Dirichlet(Revmat{all})
98.1 % ( 96 %) Slider(Revmat{all})
26.7 % ( 20 %) Dirichlet(Pi{all})
28.2 % ( 28 %) Slider(Pi{all})
68.5 % ( 42 %) Multiplier(Alpha{1,2})
79.5 % ( 43 %) Multiplier(Alpha{3})
25.8 % ( 31 %) Slider(Pinvar{all})
97.4 % ( 98 %) ExtSPR(Tau{all},V{all})
69.3 % ( 71 %) ExtTBR(Tau{all},V{all})
98.2 % ( 96 %) NNI(Tau{all},V{all})
88.0 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
95.1 % ( 99 %) Nodeslider(V{all})
30.5 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166779 0.82 0.66
3 | 166511 166894 0.83
4 | 166281 166904 166631
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166541 0.82 0.66
3 | 166703 166832 0.83
4 | 166600 166449 166875
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1130.29
| 1 2 |
| |
| * 1 1 |
| 1 1 2 2 |
| 1 1 2 1 |
| 1 1 2 1 1 2 2 21 |
| 2 1 1 2 1 2 2 2 2 2 |
|1 2 * 122 * 1* 2 ** 1 1 1 1|
| * 1 1 12 2 1 2 2 11 2 |
| 2 2 2 * 2 22 2 2 1 1 |
| 2 12 1 2 2 2 1 112 1 1 2 |
| 2 * 2 1 1 1 1 12 21 |
|2 2 1 2 2 |
| * 1 1 2 |
| 1 1 21 2|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1131.96
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1130.17 -1133.20
2 -1130.15 -1135.21
--------------------------------------
TOTAL -1130.16 -1134.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.880884 0.090030 0.333726 1.471695 0.841678 1381.20 1441.10 1.001
r(A<->C){all} 0.156950 0.018879 0.000143 0.434036 0.121697 269.47 272.92 1.000
r(A<->G){all} 0.219692 0.025750 0.000004 0.535514 0.187958 203.03 278.21 1.000
r(A<->T){all} 0.163635 0.019917 0.000152 0.451055 0.125939 157.36 208.44 1.010
r(C<->G){all} 0.138678 0.015283 0.000018 0.386072 0.104770 172.09 234.64 1.006
r(C<->T){all} 0.167294 0.019674 0.000118 0.444086 0.129491 197.21 213.07 1.000
r(G<->T){all} 0.153752 0.018463 0.000009 0.425846 0.115669 152.41 208.73 1.001
pi(A){all} 0.213645 0.000198 0.187920 0.242613 0.213465 1419.75 1460.37 1.000
pi(C){all} 0.279044 0.000247 0.247019 0.308589 0.278587 1121.47 1224.95 1.000
pi(G){all} 0.301160 0.000256 0.269018 0.331803 0.300805 1252.03 1376.51 1.000
pi(T){all} 0.206151 0.000195 0.178155 0.232452 0.205853 1198.29 1346.40 1.000
alpha{1,2} 0.321367 0.153263 0.001089 1.114004 0.193087 1204.66 1352.83 1.000
alpha{3} 0.405755 0.232830 0.000188 1.369902 0.232116 1038.69 1107.06 1.000
pinvar{all} 0.995775 0.000014 0.988866 0.999881 0.996723 1378.54 1387.28 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .*.***
9 -- .**.**
10 -- .***.*
11 -- ...*.*
12 -- ..*..*
13 -- .*.*..
14 -- ..*.*.
15 -- .*...*
16 -- .****.
17 -- ....**
18 -- .**...
19 -- ...**.
20 -- ..****
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.020728 0.136576 0.165889 2
8 444 0.147901 0.016959 0.135909 0.159893 2
9 443 0.147568 0.024968 0.129913 0.165223 2
10 442 0.147235 0.020728 0.132578 0.161892 2
11 442 0.147235 0.006595 0.142572 0.151899 2
12 437 0.145570 0.001413 0.144570 0.146569 2
13 437 0.145570 0.010835 0.137908 0.153231 2
14 436 0.145237 0.000000 0.145237 0.145237 2
15 430 0.143238 0.022612 0.127249 0.159227 2
16 428 0.142572 0.013191 0.133245 0.151899 2
17 426 0.141905 0.005653 0.137908 0.145903 2
18 425 0.141572 0.007066 0.136576 0.146569 2
19 417 0.138907 0.009893 0.131912 0.145903 2
20 405 0.134910 0.007066 0.129913 0.139907 2
21 385 0.128248 0.001413 0.127249 0.129247 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.094758 0.009223 0.000003 0.290498 0.065109 1.001 2
length{all}[2] 0.139734 0.015710 0.000209 0.385044 0.105151 1.000 2
length{all}[3] 0.090585 0.008736 0.000011 0.284874 0.060563 1.000 2
length{all}[4] 0.090062 0.008631 0.000079 0.277572 0.059891 1.000 2
length{all}[5] 0.094458 0.010084 0.000016 0.287881 0.062762 1.000 2
length{all}[6] 0.091522 0.008469 0.000007 0.281122 0.063339 1.000 2
length{all}[7] 0.096756 0.009937 0.000130 0.281910 0.069164 1.006 2
length{all}[8] 0.092599 0.008679 0.000196 0.281005 0.061589 0.999 2
length{all}[9] 0.103534 0.011956 0.000116 0.317052 0.069530 0.998 2
length{all}[10] 0.093155 0.009947 0.000378 0.292420 0.060458 0.998 2
length{all}[11] 0.095823 0.010411 0.000238 0.282911 0.065082 1.001 2
length{all}[12] 0.093975 0.008644 0.000048 0.274817 0.067175 0.999 2
length{all}[13] 0.099011 0.008773 0.000250 0.295988 0.066134 1.001 2
length{all}[14] 0.097528 0.009385 0.000230 0.294575 0.068677 0.998 2
length{all}[15] 0.094530 0.009371 0.000045 0.296350 0.064474 1.006 2
length{all}[16] 0.087591 0.008292 0.000366 0.260964 0.057502 0.999 2
length{all}[17] 0.088647 0.007947 0.000163 0.282762 0.061536 1.000 2
length{all}[18] 0.092996 0.008796 0.000306 0.280546 0.064765 0.998 2
length{all}[19] 0.088901 0.007560 0.000120 0.274599 0.056638 0.998 2
length{all}[20] 0.088384 0.008424 0.000715 0.250640 0.061431 0.999 2
length{all}[21] 0.082097 0.006295 0.000111 0.233243 0.058429 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.011275
Maximum standard deviation of split frequencies = 0.024968
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------- C3 (3)
+
|----------------------------------------- C4 (4)
|
|------------------------------------------- C5 (5)
|
\------------------------------------------- C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 813
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 271 / 271 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 271 / 271 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.098289 0.051670 0.017200 0.077649 0.043672 0.031035 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1173.296841
Iterating by ming2
Initial: fx= 1173.296841
x= 0.09829 0.05167 0.01720 0.07765 0.04367 0.03104 0.30000 1.30000
1 h-m-p 0.0000 0.0001 645.5140 ++ 1146.618886 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 10191.6156 ++ 1130.557811 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 1456702.7719 ++ 1119.262648 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0001 493.1770 ++ 1099.546303 m 0.0001 46 | 4/8
5 h-m-p 0.0000 0.0000 1116.8117 ++ 1093.393682 m 0.0000 57 | 5/8
6 h-m-p 0.0009 0.2408 2.9596 ++++YYCYC 1090.617351 4 0.1922 77 | 5/8
7 h-m-p 0.6123 8.0000 0.9292 YYCC 1090.514568 3 0.2350 92 | 5/8
8 h-m-p 0.3838 4.6844 0.5689 +YCYCCC 1090.039942 5 2.2968 115 | 5/8
9 h-m-p 1.6000 8.0000 0.5870 CYCC 1089.847749 3 1.7769 134 | 5/8
10 h-m-p 1.5542 8.0000 0.6711 +CYC 1089.564026 2 5.7664 152 | 5/8
11 h-m-p 1.6000 8.0000 1.0865 YYC 1089.473164 2 2.1524 168 | 5/8
12 h-m-p 1.4554 8.0000 1.6068 +CC 1089.345162 1 6.0635 182 | 5/8
13 h-m-p 1.6000 8.0000 2.6209 CYC 1089.302943 2 2.0456 196 | 5/8
14 h-m-p 1.4809 8.0000 3.6204 +YC 1089.248042 1 6.6960 209 | 5/8
15 h-m-p 1.6000 8.0000 6.2580 CYC 1089.229449 2 1.9690 223 | 5/8
16 h-m-p 1.4881 8.0000 8.2803 ++ 1089.206441 m 8.0000 234 | 5/8
17 h-m-p 1.6000 8.0000 13.4932 CY 1089.198259 1 1.6648 247 | 5/8
18 h-m-p 1.2432 8.0000 18.0694 ++ 1089.188129 m 8.0000 258 | 5/8
19 h-m-p 1.6000 8.0000 46.3991 YCC 1089.184962 2 2.6036 272 | 5/8
20 h-m-p 1.6000 8.0000 54.1551 +YC 1089.182047 1 4.2579 285 | 5/8
21 h-m-p 0.9518 4.7590 94.1507 +YC 1089.180383 1 2.9394 298 | 5/8
22 h-m-p 0.2516 1.2580 136.1851 ++ 1089.179631 m 1.2580 309 | 6/8
23 h-m-p 0.6801 5.3708 102.7529 YC 1089.179425 1 1.4468 321 | 6/8
24 h-m-p 1.6000 8.0000 45.9800 ++ 1089.179169 m 8.0000 332 | 6/8
25 h-m-p 0.0547 0.2736 129.2100 ++ 1089.179139 m 0.2736 343 | 7/8
26 h-m-p 0.2053 8.0000 0.0000 +C 1089.179107 0 0.9769 355 | 7/8
27 h-m-p 1.6000 8.0000 0.0000 --------N 1089.179107 0 0.0000 375
Out..
lnL = -1089.179107
376 lfun, 376 eigenQcodon, 2256 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.081629 0.056433 0.106184 0.041191 0.027889 0.076558 999.000000 0.884506 0.380494
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.029867
np = 9
lnL0 = -1186.592473
Iterating by ming2
Initial: fx= 1186.592473
x= 0.08163 0.05643 0.10618 0.04119 0.02789 0.07656 951.42857 0.88451 0.38049
1 h-m-p 0.0000 0.0001 610.0998 ++ 1145.842644 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 4480.2796 ++ 1127.312310 m 0.0000 26 | 2/9
3 h-m-p 0.0001 0.0003 343.0142 ++ 1099.177715 m 0.0003 38 | 3/9
4 h-m-p 0.0000 0.0002 186.5448 ++ 1096.065857 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0001 1127.8305 ++ 1089.883131 m 0.0001 62 | 5/9
6 h-m-p 0.0416 0.4280 1.2571 +YCCC 1089.798363 3 0.1103 80 | 5/9
7 h-m-p 0.4630 2.3152 0.2738 ++ 1089.560934 m 2.3152 92 | 6/9
8 h-m-p 0.3428 2.9980 0.2797 YCCC 1089.515289 3 0.7690 113 | 6/9
9 h-m-p 1.6000 8.0000 0.0003 Y 1089.515289 0 0.9371 128 | 6/9
10 h-m-p 1.6000 8.0000 0.0000 ---Y 1089.515289 0 0.0024 146
Out..
lnL = -1089.515289
147 lfun, 441 eigenQcodon, 1764 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.103439 0.056586 0.075214 0.082140 0.047251 0.098989 951.428579 1.360639 0.498498 0.388246 1030.532604
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000177
np = 11
lnL0 = -1128.368421
Iterating by ming2
Initial: fx= 1128.368421
x= 0.10344 0.05659 0.07521 0.08214 0.04725 0.09899 951.42858 1.36064 0.49850 0.38825 951.42857
1 h-m-p 0.0000 0.0016 61.7951 ++++ 1118.563360 m 0.0016 18 | 1/11
2 h-m-p 0.0029 0.0191 30.5950 ++ 1104.263465 m 0.0191 32 | 2/11
3 h-m-p 0.0000 0.0001 1260.2218 ++ 1102.786787 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0004 681.8853 ++ 1098.989759 m 0.0004 60 | 4/11
5 h-m-p 0.0000 0.0000 10403.2129 ++ 1098.585933 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0007 714.7299 ++YYCYYYYYCC 1089.231683 10 0.0007 103 | 5/11
7 h-m-p 0.0650 0.3252 0.0542 -CC 1089.231520 1 0.0061 120 | 5/11
8 h-m-p 0.0508 8.0000 0.0066 ++++ 1089.230014 m 8.0000 142 | 5/11
9 h-m-p 0.0570 6.4913 0.9190 ++YCC 1089.213379 2 1.4365 167 | 5/11
10 h-m-p 1.6000 8.0000 0.0094 ++ 1089.211867 m 8.0000 187 | 5/11
11 h-m-p 0.1885 8.0000 0.3973 ++CYC 1089.201690 2 2.6843 212 | 5/11
12 h-m-p 1.6000 8.0000 0.2881 YC 1089.186928 1 3.8998 233 | 5/11
13 h-m-p 0.5505 2.7524 0.5617 ++ 1089.181894 m 2.7524 253 | 6/11
14 h-m-p 1.6000 8.0000 0.7383 YYC 1089.180149 2 2.4144 275 | 6/11
15 h-m-p 1.6000 8.0000 0.4768 CY 1089.179619 1 2.0457 296 | 6/11
16 h-m-p 1.6000 8.0000 0.5030 YC 1089.179352 1 3.8999 316 | 6/11
17 h-m-p 1.6000 8.0000 0.4640 C 1089.179283 0 1.8508 335 | 6/11
18 h-m-p 1.6000 8.0000 0.4604 YC 1089.179247 1 3.9876 355 | 6/11
19 h-m-p 1.6000 8.0000 0.4927 C 1089.179237 0 1.8557 374 | 6/11
20 h-m-p 1.6000 8.0000 0.4787 +Y 1089.179231 0 4.0200 394 | 6/11
21 h-m-p 1.6000 8.0000 0.4733 C 1089.179230 0 1.7277 413 | 6/11
22 h-m-p 1.6000 8.0000 0.4957 +C 1089.179229 0 5.7399 433 | 6/11
23 h-m-p 1.6000 8.0000 0.3430 Y 1089.179229 0 1.1989 452 | 6/11
24 h-m-p 0.9707 8.0000 0.4237 +C 1089.179229 0 3.8123 472 | 6/11
25 h-m-p 1.6000 8.0000 0.5994 Y 1089.179229 0 2.9496 491 | 6/11
26 h-m-p 1.6000 8.0000 0.2727 Y 1089.179229 0 0.8694 510 | 6/11
27 h-m-p 0.2939 8.0000 0.8068 +Y 1089.179229 0 0.8288 530 | 6/11
28 h-m-p 0.6058 8.0000 1.1037 +C 1089.179229 0 2.4233 550 | 6/11
29 h-m-p 1.1874 8.0000 2.2526 C 1089.179229 0 0.3696 564 | 6/11
30 h-m-p 1.6000 8.0000 0.0201 Y 1089.179229 0 0.9141 578 | 6/11
31 h-m-p 0.3109 8.0000 0.0592 Y 1089.179229 0 0.1995 597 | 6/11
32 h-m-p 0.0422 8.0000 0.2797 Y 1089.179229 0 0.0695 616 | 6/11
33 h-m-p 0.0805 8.0000 0.2416 C 1089.179229 0 0.0201 635 | 6/11
34 h-m-p 0.0160 8.0000 2.6279 Y 1089.179229 0 0.0113 654 | 6/11
35 h-m-p 0.2366 8.0000 0.1255 ---Y 1089.179229 0 0.0009 671 | 6/11
36 h-m-p 0.0160 8.0000 0.3706 +C 1089.179229 0 0.0640 691 | 6/11
37 h-m-p 0.1500 8.0000 0.1581 -C 1089.179229 0 0.0094 711 | 6/11
38 h-m-p 0.0160 8.0000 0.5437 -------------.. | 6/11
39 h-m-p 0.0160 8.0000 0.0181 ----------N 1089.179229 0 0.0000 770 | 6/11
40 h-m-p 0.0160 8.0000 0.0000 ---------Y 1089.179229 0 0.0000 798
Out..
lnL = -1089.179229
799 lfun, 3196 eigenQcodon, 14382 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1094.118719 S = -1092.679861 -2.367414
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:05
did 20 / 57 patterns 0:05
did 30 / 57 patterns 0:05
did 40 / 57 patterns 0:05
did 50 / 57 patterns 0:05
did 57 / 57 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.062761 0.039968 0.100671 0.067977 0.097184 0.017895 951.446543 0.484715 1.972685
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.042461
np = 9
lnL0 = -1183.545695
Iterating by ming2
Initial: fx= 1183.545695
x= 0.06276 0.03997 0.10067 0.06798 0.09718 0.01790 951.44654 0.48471 1.97269
1 h-m-p 0.0000 0.0001 576.9533 ++ 1159.305767 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 3051.4198 +YCYYCCC 1146.433047 6 0.0000 37 | 1/9
3 h-m-p 0.0009 0.0140 35.3639 ++YYCYCCCC 1137.385816 7 0.0127 63 | 1/9
4 h-m-p 0.0583 0.2916 6.4062 --------------.. | 1/9
5 h-m-p 0.0000 0.0001 636.6241 ++ 1116.178899 m 0.0001 99 | 2/9
6 h-m-p 0.0000 0.0000 975.1525 ++ 1113.151357 m 0.0000 111 | 3/9
7 h-m-p 0.0001 0.0131 49.3025 ++++ 1099.681034 m 0.0131 125 | 4/9
8 h-m-p 0.0000 0.0000 146.4852 ++ 1099.258853 m 0.0000 137 | 5/9
9 h-m-p 0.0010 0.5104 1.3609 ++++CYYCYYCCC 1092.543642 8 0.4441 166 | 5/9
10 h-m-p 0.0546 0.2730 1.6882 --------------.. | 5/9
11 h-m-p 0.0000 0.0001 175.9897 +YYYCYCCC 1091.529113 7 0.0000 213 | 5/9
12 h-m-p 0.0024 1.2011 10.8342 ++++YCYC 1089.678974 3 0.3593 233 | 5/9
13 h-m-p 1.6000 8.0000 0.0779 YCCC 1089.627965 3 0.2175 250 | 5/9
14 h-m-p 0.2627 8.0000 0.0645 +++ 1089.593299 m 8.0000 267 | 5/9
15 h-m-p 0.0000 0.0000 99420.0749 +
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
+ 1089.515299 m 0.0000 283
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20928, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
16 h-m-p 1.6000 8.0000 0.0011
QuantileBeta(0.85, 4.20758, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20249, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
C 1089.515289 0 1.5791 295
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20777, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
17 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 4.20757, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20759, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
Y 1089.515289 0 0.0000 317
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1089.515289
318 lfun, 3498 eigenQcodon, 19080 P(t)
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.20760, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.050784 0.017230 0.099392 0.043417 0.096495 0.018594 951.446606 0.900000 0.874518 1.257424 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000271
np = 11
lnL0 = -1115.500195
Iterating by ming2
Initial: fx= 1115.500195
x= 0.05078 0.01723 0.09939 0.04342 0.09649 0.01859 951.44661 0.90000 0.87452 1.25742 951.42857
1 h-m-p 0.0000 0.0005 193.0809 ++CYYYCYCYCC 1097.757266 10 0.0005 33 | 0/11
2 h-m-p 0.0000 0.0002 47.5824 ++ 1097.367931 m 0.0002 47 | 1/11
3 h-m-p 0.0005 0.0075 16.7592 ++ 1091.532757 m 0.0075 61 | 2/11
4 h-m-p 0.0000 0.0000 13.7603 ++ 1091.523522 m 0.0000 75 | 3/11
5 h-m-p 0.0000 0.0001 75.4527 ++ 1090.704810 m 0.0001 89 | 4/11
6 h-m-p 0.0020 0.0105 1.8331 ++ 1090.627876 m 0.0105 103 | 5/11
7 h-m-p 0.0153 1.8719 1.2554 -------------.. | 5/11
8 h-m-p 0.0000 0.0002 55.0707 +YCYCYC 1090.416843 5 0.0001 151 | 5/11
9 h-m-p 0.0002 0.0011 28.6410 +YYYYCYYYYY 1089.783612 10 0.0010 176 | 5/11
10 h-m-p 0.0018 0.0089 0.5629 YCCCCC 1089.766093 5 0.0024 199 | 5/11
11 h-m-p 0.4212 4.7992 0.0031 +YYYYC 1089.623544 4 1.6137 224 | 5/11
12 h-m-p 0.0341 8.0000 0.1488 ++YYCCC 1089.437604 4 0.7966 252 | 5/11
13 h-m-p 1.6000 8.0000 0.0051 +CCC 1089.316774 2 6.6943 277 | 5/11
14 h-m-p 1.3439 8.0000 0.0253 YCCC 1089.285900 3 2.2238 302 | 5/11
15 h-m-p 1.6000 8.0000 0.0095 +YC 1089.237812 1 5.2567 324 | 5/11
16 h-m-p 1.3533 8.0000 0.0371 CYC 1089.222544 2 1.7260 347 | 5/11
17 h-m-p 1.6000 8.0000 0.0265 +YC 1089.202354 1 6.6829 369 | 5/11
18 h-m-p 1.6000 8.0000 0.0598 CYC 1089.195552 2 1.8059 392 | 5/11
19 h-m-p 1.6000 8.0000 0.0642 ++ 1089.187159 m 8.0000 412 | 5/11
20 h-m-p 1.2926 6.4628 0.1149 CYC 1089.184144 2 1.6262 435 | 5/11
21 h-m-p 0.7698 3.8488 0.1433 ++ 1089.181574 m 3.8488 455 | 6/11
22 h-m-p 0.5794 2.8968 0.3421
QuantileBeta(0.85, 2.20856, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.73550, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
+ 1089.179232 m 2.8968 475
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91128, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91100, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91114, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
23 h-m-p 0.2320 1.1600 2.5309
QuantileBeta(0.85, 2.32991, 0.00500) = 1.000000e+00 2000 rounds
Y 1089.179229 0 0.5772 494 | 7/11
24 h-m-p 1.6000 8.0000 0.0524 C 1089.179229 0 0.4413 508 | 7/11
25 h-m-p 1.2907 8.0000 0.0179 ++ 1089.179229 m 8.0000 526 | 7/11
26 h-m-p 0.4544 8.0000 0.3152
QuantileBeta(0.85, 2.19675, 0.00500) = 1.000000e+00 2000 rounds
Y 1089.179229 0 0.7874 544 | 7/11
27 h-m-p 0.8835 8.0000 0.2809
QuantileBeta(0.85, 2.85806, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
Y 1089.179229 0 1.4811 562
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28733, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28708, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28721, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
28 h-m-p 0.7164 8.0000 0.5807
QuantileBeta(0.85, 2.69905, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.93457, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 6.88618, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
C 1089.179229 0 3.6528 581
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38727, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.38710, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
29 h-m-p 1.0779 8.0000 1.9680
QuantileBeta(0.85, 6.48700, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.78668, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
+ 1089.179228 m 8.0000 599
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97233, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97232, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
30 h-m-p 0.4111 2.0848 38.2935
QuantileBeta(0.85, 35.55754, 0.00500) = 1.000000e+00 2000 rounds
++ 1089.179224 m 2.0848 613 | 7/11
31 h-m-p 0.0000 0.0000 346.3562
h-m-p: 0.00000000e+00 0.00000000e+00 3.46356242e+02 1089.179224
.. | 7/11
32 h-m-p 0.0000 0.0061 0.6115 C 1089.179222 0 0.0000 638 | 7/11
33 h-m-p 1.6000 8.0000 0.0000 -----C 1089.179222 0 0.0004 661
Out..
lnL = -1089.179222
662 lfun, 7944 eigenQcodon, 43692 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1093.872112 S = -1092.694422 -1.981208
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:23
did 20 / 57 patterns 0:23
did 30 / 57 patterns 0:23
did 40 / 57 patterns 0:24
did 50 / 57 patterns 0:24
did 57 / 57 patterns 0:24
Time used: 0:24
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=271
NC_011896_1_WP_012634420_1_595_MLBR_RS02810 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
NC_002677_1_NP_301481_1_353_ML0569 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA
**************************************************
NC_011896_1_WP_012634420_1_595_MLBR_RS02810 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
NC_002677_1_NP_301481_1_353_ML0569 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP
**************************************************
NC_011896_1_WP_012634420_1_595_MLBR_RS02810 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
NC_002677_1_NP_301481_1_353_ML0569 DRYWPEHSTIALTVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP
************:*************************************
NC_011896_1_WP_012634420_1_595_MLBR_RS02810 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
NC_002677_1_NP_301481_1_353_ML0569 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV
**************************************************
NC_011896_1_WP_012634420_1_595_MLBR_RS02810 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
NC_002677_1_NP_301481_1_353_ML0569 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS
**************************************************
NC_011896_1_WP_012634420_1_595_MLBR_RS02810 PADAEWYYNTVNIGDPVIVKE
NC_002677_1_NP_301481_1_353_ML0569 PADAEWYYNTVNIGDPVIVKE
NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 PADAEWYYNTVNIGDPVIVKE
NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 PADAEWYYNTVNIGDPVIVKE
NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 PADAEWYYNTVNIGDPVIVKE
NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 PADAEWYYNTVNIGDPVIVKE
*********************
>NC_011896_1_WP_012634420_1_595_MLBR_RS02810 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT AATCGTGAAGGAA >NC_002677_1_NP_301481_1_353_ML0569 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCACGGTGGGCAACCT GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT AATCGTGAAGGAA >NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT AATCGTGAAGGAA >NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT AATCGTGAAGGAA >NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT AATCGTGAAGGAA >NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 ATGGGAATTATGCGGGCAGCAATTCGAGGTGTTCTTGTGGTGATCGGGAT CGCGGCGACGGTGATCGCGGGACCGGTGCGTGTAAGCCTAGCGGCGGTGA ACCATGCGCATGGCTTCGCCATCACGTCAATTCTACCTACACGGGACGCG GTGGTGGGTGTGGCGCACCCCGTGGTAGTGACATTCGGCGCACCCGTCAC TAACCGTAAGGCGACCGAGCTTTCCCTTAAAGTGCGCTCGGCGCCAGCGA TGAACGGCAAGTTTGACTGGCTCGACAGCAAAGTTGTGCAGTGGGTTCCT GACCGCTATTGGCCAGAGCACAGCACGATCGCACTCGCGGTGGGCAACCT GTCCACCAACTTCAAAACGGGTCCTGCCATTCTCGGTATTGCGGATATCT CGAATCACACGTTCACGGTGACGATCGACGGAGTCGAGGCGGAGACACCC CCTCCACTGCCTTCACCCCACCATCGGCCCCACTGGGGAGAAGAAGGGGT GATGCCGGCCTCGATGGGTAAGACAGAATTCCCGACACCTACCGGTAAGT ATACCGTCATGTCCAAGGATCGCTCGGTGATTATGGATTCGAGTAGTGTC GGCATACCTGTCGACGATCCCGAGGGGTACAGGCTCTCGGTGGATTACGC CGTCCGTATCAGCAGCCGTGGCCTCTACATCCATTCGGCTCCGTGGGCGG TGCAGTCAATGGGTTTTGATAACACCAGCCACGGCTGCATTAGCTTAAGC CCTGCCGACGCAGAATGGTACTACAACACAGTTAACATTGGTGACCCGGT AATCGTGAAGGAA
>NC_011896_1_WP_012634420_1_595_MLBR_RS02810 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS PADAEWYYNTVNIGDPVIVKE >NC_002677_1_NP_301481_1_353_ML0569 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP DRYWPEHSTIALTVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS PADAEWYYNTVNIGDPVIVKE >NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS PADAEWYYNTVNIGDPVIVKE >NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS PADAEWYYNTVNIGDPVIVKE >NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS PADAEWYYNTVNIGDPVIVKE >NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195 MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDA VVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVP DRYWPEHSTIALAVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETP PPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSV GIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLS PADAEWYYNTVNIGDPVIVKE
#NEXUS
[ID: 0645164710]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_012634420_1_595_MLBR_RS02810
NC_002677_1_NP_301481_1_353_ML0569
NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325
NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500
NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105
NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634420_1_595_MLBR_RS02810,
2 NC_002677_1_NP_301481_1_353_ML0569,
3 NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325,
4 NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500,
5 NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105,
6 NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06510908,2:0.1051514,3:0.06056329,4:0.05989062,5:0.06276161,6:0.06333881);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06510908,2:0.1051514,3:0.06056329,4:0.05989062,5:0.06276161,6:0.06333881);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1130.17 -1133.20
2 -1130.15 -1135.21
--------------------------------------
TOTAL -1130.16 -1134.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0569/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.880884 0.090030 0.333726 1.471695 0.841678 1381.20 1441.10 1.001
r(A<->C){all} 0.156950 0.018879 0.000143 0.434036 0.121697 269.47 272.92 1.000
r(A<->G){all} 0.219692 0.025750 0.000004 0.535514 0.187958 203.03 278.21 1.000
r(A<->T){all} 0.163635 0.019917 0.000152 0.451055 0.125939 157.36 208.44 1.010
r(C<->G){all} 0.138678 0.015283 0.000018 0.386072 0.104770 172.09 234.64 1.006
r(C<->T){all} 0.167294 0.019674 0.000118 0.444086 0.129491 197.21 213.07 1.000
r(G<->T){all} 0.153752 0.018463 0.000009 0.425846 0.115669 152.41 208.73 1.001
pi(A){all} 0.213645 0.000198 0.187920 0.242613 0.213465 1419.75 1460.37 1.000
pi(C){all} 0.279044 0.000247 0.247019 0.308589 0.278587 1121.47 1224.95 1.000
pi(G){all} 0.301160 0.000256 0.269018 0.331803 0.300805 1252.03 1376.51 1.000
pi(T){all} 0.206151 0.000195 0.178155 0.232452 0.205853 1198.29 1346.40 1.000
alpha{1,2} 0.321367 0.153263 0.001089 1.114004 0.193087 1204.66 1352.83 1.000
alpha{3} 0.405755 0.232830 0.000188 1.369902 0.232116 1038.69 1107.06 1.000
pinvar{all} 0.995775 0.000014 0.988866 0.999881 0.996723 1378.54 1387.28 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0569/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 271
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 3 3 3 3 3 3 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 8 8 8 8 8 8 | His CAT 4 4 4 4 4 4 | Arg CGT 4 4 4 4 4 4
CTC 5 5 5 5 5 5 | CCC 6 6 6 6 6 6 | CAC 6 6 6 6 6 6 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 3 3 3 3 3 3 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 5 5 5 5 5 5 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 8 8 8 8 8 8 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 10 10 10 10 10 10 | ACC 5 5 5 5 5 5 | AAC 8 8 8 8 8 8 | AGC 8 8 8 8 8 8
ATA 1 1 1 1 1 1 | ACA 6 6 6 6 6 6 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 8 8 8 8 8 8 | ACG 7 8 7 7 7 7 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 6 6 | Gly GGT 8 8 8 8 8 8
GTC 6 6 6 6 6 6 | GCC 5 5 5 5 5 5 | GAC 8 8 8 8 8 8 | GGC 7 7 7 7 7 7
GTA 3 3 3 3 3 3 | GCA 5 5 5 5 5 5 | Glu GAA 5 5 5 5 5 5 | GGA 4 4 4 4 4 4
GTG 19 19 19 19 19 19 | GCG 15 14 15 15 15 15 | GAG 5 5 5 5 5 5 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634420_1_595_MLBR_RS02810
position 1: T:0.12915 C:0.21033 A:0.27675 G:0.38376
position 2: T:0.29151 C:0.29520 A:0.22509 G:0.18819
position 3: T:0.19926 C:0.33579 A:0.13653 G:0.32841
Average T:0.20664 C:0.28044 A:0.21279 G:0.30012
#2: NC_002677_1_NP_301481_1_353_ML0569
position 1: T:0.12915 C:0.21033 A:0.28044 G:0.38007
position 2: T:0.29151 C:0.29520 A:0.22509 G:0.18819
position 3: T:0.19926 C:0.33579 A:0.13653 G:0.32841
Average T:0.20664 C:0.28044 A:0.21402 G:0.29889
#3: NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325
position 1: T:0.12915 C:0.21033 A:0.27675 G:0.38376
position 2: T:0.29151 C:0.29520 A:0.22509 G:0.18819
position 3: T:0.19926 C:0.33579 A:0.13653 G:0.32841
Average T:0.20664 C:0.28044 A:0.21279 G:0.30012
#4: NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500
position 1: T:0.12915 C:0.21033 A:0.27675 G:0.38376
position 2: T:0.29151 C:0.29520 A:0.22509 G:0.18819
position 3: T:0.19926 C:0.33579 A:0.13653 G:0.32841
Average T:0.20664 C:0.28044 A:0.21279 G:0.30012
#5: NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105
position 1: T:0.12915 C:0.21033 A:0.27675 G:0.38376
position 2: T:0.29151 C:0.29520 A:0.22509 G:0.18819
position 3: T:0.19926 C:0.33579 A:0.13653 G:0.32841
Average T:0.20664 C:0.28044 A:0.21279 G:0.30012
#6: NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195
position 1: T:0.12915 C:0.21033 A:0.27675 G:0.38376
position 2: T:0.29151 C:0.29520 A:0.22509 G:0.18819
position 3: T:0.19926 C:0.33579 A:0.13653 G:0.32841
Average T:0.20664 C:0.28044 A:0.21279 G:0.30012
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 30 | TCC 18 | TAC 30 | TGC 6
Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 42 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 48 | His H CAT 24 | Arg R CGT 24
CTC 30 | CCC 36 | CAC 36 | CGC 18
CTA 12 | CCA 18 | Gln Q CAA 0 | CGA 6
CTG 12 | CCG 30 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 48 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 12
ATC 60 | ACC 30 | AAC 48 | AGC 48
ATA 6 | ACA 36 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 48 | ACG 43 | AAG 36 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 6 | Asp D GAT 36 | Gly G GGT 48
GTC 36 | GCC 30 | GAC 48 | GGC 42
GTA 18 | GCA 30 | Glu E GAA 30 | GGA 24
GTG 114 | GCG 89 | GAG 30 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12915 C:0.21033 A:0.27737 G:0.38315
position 2: T:0.29151 C:0.29520 A:0.22509 G:0.18819
position 3: T:0.19926 C:0.33579 A:0.13653 G:0.32841
Average T:0.20664 C:0.28044 A:0.21300 G:0.29992
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -1089.179107 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.003704 0.000004 0.000004 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003724
(1: 0.000004, 2: 0.003704, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634420_1_595_MLBR_RS02810: 0.000004, NC_002677_1_NP_301481_1_353_ML0569: 0.003704, NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325: 0.000004, NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500: 0.000004, NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105: 0.000004, NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 573.7 239.3 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.004 573.7 239.3 999.0000 0.0017 0.0000 1.0 0.0
7..3 0.000 573.7 239.3 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 573.7 239.3 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 573.7 239.3 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 573.7 239.3 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0018
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1089.515289 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.003748 0.000004 0.000004 0.000004 0.000004 951.428579 0.623249 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003768
(1: 0.000004, 2: 0.003748, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634420_1_595_MLBR_RS02810: 0.000004, NC_002677_1_NP_301481_1_353_ML0569: 0.003748, NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325: 0.000004, NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500: 0.000004, NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105: 0.000004, NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.62325 0.37675
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.004 573.7 239.3 1.0000 0.0012 0.0012 0.7 0.3
7..3 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1089.179229 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.003704 0.000004 0.000004 0.000004 0.000004 951.446543 0.000000 0.000000 1.000000 951.484359
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003724
(1: 0.000004, 2: 0.003704, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634420_1_595_MLBR_RS02810: 0.000004, NC_002677_1_NP_301481_1_353_ML0569: 0.003704, NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325: 0.000004, NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500: 0.000004, NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105: 0.000004, NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.44654
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 951.48436
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 573.7 239.3 951.4839 0.0000 0.0000 0.0 0.0
7..2 0.004 573.7 239.3 951.4839 0.0017 0.0000 1.0 0.0
7..3 0.000 573.7 239.3 951.4839 0.0000 0.0000 0.0 0.0
7..4 0.000 573.7 239.3 951.4839 0.0000 0.0000 0.0 0.0
7..5 0.000 573.7 239.3 951.4839 0.0000 0.0000 0.0 0.0
7..6 0.000 573.7 239.3 951.4839 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634420_1_595_MLBR_RS02810)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.484
2 G 1.000** 951.484
3 I 1.000** 951.484
4 M 1.000** 951.484
5 R 1.000** 951.484
6 A 1.000** 951.484
7 A 1.000** 951.484
8 I 1.000** 951.484
9 R 1.000** 951.484
10 G 1.000** 951.484
11 V 1.000** 951.484
12 L 1.000** 951.484
13 V 1.000** 951.484
14 V 1.000** 951.484
15 I 1.000** 951.484
16 G 1.000** 951.484
17 I 1.000** 951.484
18 A 1.000** 951.484
19 A 1.000** 951.484
20 T 1.000** 951.484
21 V 1.000** 951.484
22 I 1.000** 951.484
23 A 1.000** 951.484
24 G 1.000** 951.484
25 P 1.000** 951.484
26 V 1.000** 951.484
27 R 1.000** 951.484
28 V 1.000** 951.484
29 S 1.000** 951.484
30 L 1.000** 951.484
31 A 1.000** 951.484
32 A 1.000** 951.484
33 V 1.000** 951.484
34 N 1.000** 951.484
35 H 1.000** 951.484
36 A 1.000** 951.484
37 H 1.000** 951.484
38 G 1.000** 951.484
39 F 1.000** 951.484
40 A 1.000** 951.484
41 I 1.000** 951.484
42 T 1.000** 951.484
43 S 1.000** 951.484
44 I 1.000** 951.484
45 L 1.000** 951.484
46 P 1.000** 951.484
47 T 1.000** 951.484
48 R 1.000** 951.484
49 D 1.000** 951.484
50 A 1.000** 951.484
51 V 1.000** 951.484
52 V 1.000** 951.484
53 G 1.000** 951.484
54 V 1.000** 951.484
55 A 1.000** 951.484
56 H 1.000** 951.484
57 P 1.000** 951.484
58 V 1.000** 951.484
59 V 1.000** 951.484
60 V 1.000** 951.484
61 T 1.000** 951.484
62 F 1.000** 951.484
63 G 1.000** 951.484
64 A 1.000** 951.484
65 P 1.000** 951.484
66 V 1.000** 951.484
67 T 1.000** 951.484
68 N 1.000** 951.484
69 R 1.000** 951.484
70 K 1.000** 951.484
71 A 1.000** 951.484
72 T 1.000** 951.484
73 E 1.000** 951.484
74 L 1.000** 951.484
75 S 1.000** 951.484
76 L 1.000** 951.484
77 K 1.000** 951.484
78 V 1.000** 951.484
79 R 1.000** 951.484
80 S 1.000** 951.484
81 A 1.000** 951.484
82 P 1.000** 951.484
83 A 1.000** 951.484
84 M 1.000** 951.484
85 N 1.000** 951.484
86 G 1.000** 951.484
87 K 1.000** 951.484
88 F 1.000** 951.484
89 D 1.000** 951.484
90 W 1.000** 951.484
91 L 1.000** 951.484
92 D 1.000** 951.484
93 S 1.000** 951.484
94 K 1.000** 951.484
95 V 1.000** 951.484
96 V 1.000** 951.484
97 Q 1.000** 951.484
98 W 1.000** 951.484
99 V 1.000** 951.484
100 P 1.000** 951.484
101 D 1.000** 951.484
102 R 1.000** 951.484
103 Y 1.000** 951.484
104 W 1.000** 951.484
105 P 1.000** 951.484
106 E 1.000** 951.484
107 H 1.000** 951.484
108 S 1.000** 951.484
109 T 1.000** 951.484
110 I 1.000** 951.484
111 A 1.000** 951.484
112 L 1.000** 951.484
113 A 1.000** 951.484
114 V 1.000** 951.484
115 G 1.000** 951.484
116 N 1.000** 951.484
117 L 1.000** 951.484
118 S 1.000** 951.484
119 T 1.000** 951.484
120 N 1.000** 951.484
121 F 1.000** 951.484
122 K 1.000** 951.484
123 T 1.000** 951.484
124 G 1.000** 951.484
125 P 1.000** 951.484
126 A 1.000** 951.484
127 I 1.000** 951.484
128 L 1.000** 951.484
129 G 1.000** 951.484
130 I 1.000** 951.484
131 A 1.000** 951.484
132 D 1.000** 951.484
133 I 1.000** 951.484
134 S 1.000** 951.484
135 N 1.000** 951.484
136 H 1.000** 951.484
137 T 1.000** 951.484
138 F 1.000** 951.484
139 T 1.000** 951.484
140 V 1.000** 951.484
141 T 1.000** 951.484
142 I 1.000** 951.484
143 D 1.000** 951.484
144 G 1.000** 951.484
145 V 1.000** 951.484
146 E 1.000** 951.484
147 A 1.000** 951.484
148 E 1.000** 951.484
149 T 1.000** 951.484
150 P 1.000** 951.484
151 P 1.000** 951.484
152 P 1.000** 951.484
153 L 1.000** 951.484
154 P 1.000** 951.484
155 S 1.000** 951.484
156 P 1.000** 951.484
157 H 1.000** 951.484
158 H 1.000** 951.484
159 R 1.000** 951.484
160 P 1.000** 951.484
161 H 1.000** 951.484
162 W 1.000** 951.484
163 G 1.000** 951.484
164 E 1.000** 951.484
165 E 1.000** 951.484
166 G 1.000** 951.484
167 V 1.000** 951.484
168 M 1.000** 951.484
169 P 1.000** 951.484
170 A 1.000** 951.484
171 S 1.000** 951.484
172 M 1.000** 951.484
173 G 1.000** 951.484
174 K 1.000** 951.484
175 T 1.000** 951.484
176 E 1.000** 951.484
177 F 1.000** 951.484
178 P 1.000** 951.484
179 T 1.000** 951.484
180 P 1.000** 951.484
181 T 1.000** 951.484
182 G 1.000** 951.484
183 K 1.000** 951.484
184 Y 1.000** 951.484
185 T 1.000** 951.484
186 V 1.000** 951.484
187 M 1.000** 951.484
188 S 1.000** 951.484
189 K 1.000** 951.484
190 D 1.000** 951.484
191 R 1.000** 951.484
192 S 1.000** 951.484
193 V 1.000** 951.484
194 I 1.000** 951.484
195 M 1.000** 951.484
196 D 1.000** 951.484
197 S 1.000** 951.484
198 S 1.000** 951.484
199 S 1.000** 951.484
200 V 1.000** 951.484
201 G 1.000** 951.484
202 I 1.000** 951.484
203 P 1.000** 951.484
204 V 1.000** 951.484
205 D 1.000** 951.484
206 D 1.000** 951.484
207 P 1.000** 951.484
208 E 1.000** 951.484
209 G 1.000** 951.484
210 Y 1.000** 951.484
211 R 1.000** 951.484
212 L 1.000** 951.484
213 S 1.000** 951.484
214 V 1.000** 951.484
215 D 1.000** 951.484
216 Y 1.000** 951.484
217 A 1.000** 951.484
218 V 1.000** 951.484
219 R 1.000** 951.484
220 I 1.000** 951.484
221 S 1.000** 951.484
222 S 1.000** 951.484
223 R 1.000** 951.484
224 G 1.000** 951.484
225 L 1.000** 951.484
226 Y 1.000** 951.484
227 I 1.000** 951.484
228 H 1.000** 951.484
229 S 1.000** 951.484
230 A 1.000** 951.484
231 P 1.000** 951.484
232 W 1.000** 951.484
233 A 1.000** 951.484
234 V 1.000** 951.484
235 Q 1.000** 951.484
236 S 1.000** 951.484
237 M 1.000** 951.484
238 G 1.000** 951.484
239 F 1.000** 951.484
240 D 1.000** 951.484
241 N 1.000** 951.484
242 T 1.000** 951.484
243 S 1.000** 951.484
244 H 1.000** 951.484
245 G 1.000** 951.484
246 C 1.000** 951.484
247 I 1.000** 951.484
248 S 1.000** 951.484
249 L 1.000** 951.484
250 S 1.000** 951.484
251 P 1.000** 951.484
252 A 1.000** 951.484
253 D 1.000** 951.484
254 A 1.000** 951.484
255 E 1.000** 951.484
256 W 1.000** 951.484
257 Y 1.000** 951.484
258 Y 1.000** 951.484
259 N 1.000** 951.484
260 T 1.000** 951.484
261 V 1.000** 951.484
262 N 1.000** 951.484
263 I 1.000** 951.484
264 G 1.000** 951.484
265 D 1.000** 951.484
266 P 1.000** 951.484
267 V 1.000** 951.484
268 I 1.000** 951.484
269 V 1.000** 951.484
270 K 1.000** 951.484
271 E 1.000** 951.484
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634420_1_595_MLBR_RS02810)
Pr(w>1) post mean +- SE for w
113 A 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1089.515289 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.003748 0.000004 0.000004 0.000004 0.000004 951.446606 4.207602 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003768
(1: 0.000004, 2: 0.003748, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634420_1_595_MLBR_RS02810: 0.000004, NC_002677_1_NP_301481_1_353_ML0569: 0.003748, NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325: 0.000004, NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500: 0.000004, NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105: 0.000004, NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.44661
Parameters in M7 (beta):
p = 4.20760 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.004 573.7 239.3 1.0000 0.0012 0.0012 0.7 0.3
7..3 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 573.7 239.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1089.179222 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.003704 0.000004 0.000004 0.000004 0.000004 951.846861 0.000010 99.000000 0.005000 965.458850
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003724
(1: 0.000004, 2: 0.003704, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634420_1_595_MLBR_RS02810: 0.000004, NC_002677_1_NP_301481_1_353_ML0569: 0.003704, NZ_LVXE01000026_1_WP_012634420_1_1094_A3216_RS08325: 0.000004, NZ_LYPH01000029_1_WP_012634420_1_1146_A8144_RS05500: 0.000004, NZ_CP029543_1_WP_012634420_1_609_DIJ64_RS03105: 0.000004, NZ_AP014567_1_WP_012634420_1_627_JK2ML_RS03195: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.84686
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 99.00000 q = 0.00500
(p1 = 0.99999) w = 965.45885
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 965.45885
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 573.7 239.3 965.4492 0.0000 0.0000 0.0 0.0
7..2 0.004 573.7 239.3 965.4492 0.0017 0.0000 1.0 0.0
7..3 0.000 573.7 239.3 965.4492 0.0000 0.0000 0.0 0.0
7..4 0.000 573.7 239.3 965.4492 0.0000 0.0000 0.0 0.0
7..5 0.000 573.7 239.3 965.4492 0.0000 0.0000 0.0 0.0
7..6 0.000 573.7 239.3 965.4492 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634420_1_595_MLBR_RS02810)
Pr(w>1) post mean +- SE for w
1 M 1.000** 965.449
2 G 1.000** 965.449
3 I 1.000** 965.449
4 M 1.000** 965.449
5 R 1.000** 965.449
6 A 1.000** 965.449
7 A 1.000** 965.449
8 I 1.000** 965.449
9 R 1.000** 965.449
10 G 1.000** 965.449
11 V 1.000** 965.449
12 L 1.000** 965.449
13 V 1.000** 965.449
14 V 1.000** 965.449
15 I 1.000** 965.449
16 G 1.000** 965.449
17 I 1.000** 965.449
18 A 1.000** 965.449
19 A 1.000** 965.449
20 T 1.000** 965.449
21 V 1.000** 965.449
22 I 1.000** 965.449
23 A 1.000** 965.449
24 G 1.000** 965.449
25 P 1.000** 965.449
26 V 1.000** 965.449
27 R 1.000** 965.449
28 V 1.000** 965.449
29 S 1.000** 965.449
30 L 1.000** 965.449
31 A 1.000** 965.449
32 A 1.000** 965.449
33 V 1.000** 965.449
34 N 1.000** 965.449
35 H 1.000** 965.449
36 A 1.000** 965.449
37 H 1.000** 965.449
38 G 1.000** 965.449
39 F 1.000** 965.449
40 A 1.000** 965.449
41 I 1.000** 965.449
42 T 1.000** 965.449
43 S 1.000** 965.449
44 I 1.000** 965.449
45 L 1.000** 965.449
46 P 1.000** 965.449
47 T 1.000** 965.449
48 R 1.000** 965.449
49 D 1.000** 965.449
50 A 1.000** 965.449
51 V 1.000** 965.449
52 V 1.000** 965.449
53 G 1.000** 965.449
54 V 1.000** 965.449
55 A 1.000** 965.449
56 H 1.000** 965.449
57 P 1.000** 965.449
58 V 1.000** 965.449
59 V 1.000** 965.449
60 V 1.000** 965.449
61 T 1.000** 965.449
62 F 1.000** 965.449
63 G 1.000** 965.449
64 A 1.000** 965.449
65 P 1.000** 965.449
66 V 1.000** 965.449
67 T 1.000** 965.449
68 N 1.000** 965.449
69 R 1.000** 965.449
70 K 1.000** 965.449
71 A 1.000** 965.449
72 T 1.000** 965.449
73 E 1.000** 965.449
74 L 1.000** 965.449
75 S 1.000** 965.449
76 L 1.000** 965.449
77 K 1.000** 965.449
78 V 1.000** 965.449
79 R 1.000** 965.449
80 S 1.000** 965.449
81 A 1.000** 965.449
82 P 1.000** 965.449
83 A 1.000** 965.449
84 M 1.000** 965.449
85 N 1.000** 965.449
86 G 1.000** 965.449
87 K 1.000** 965.449
88 F 1.000** 965.449
89 D 1.000** 965.449
90 W 1.000** 965.449
91 L 1.000** 965.449
92 D 1.000** 965.449
93 S 1.000** 965.449
94 K 1.000** 965.449
95 V 1.000** 965.449
96 V 1.000** 965.449
97 Q 1.000** 965.449
98 W 1.000** 965.449
99 V 1.000** 965.449
100 P 1.000** 965.449
101 D 1.000** 965.449
102 R 1.000** 965.449
103 Y 1.000** 965.449
104 W 1.000** 965.449
105 P 1.000** 965.449
106 E 1.000** 965.449
107 H 1.000** 965.449
108 S 1.000** 965.449
109 T 1.000** 965.449
110 I 1.000** 965.449
111 A 1.000** 965.449
112 L 1.000** 965.449
113 A 1.000** 965.459
114 V 1.000** 965.449
115 G 1.000** 965.449
116 N 1.000** 965.449
117 L 1.000** 965.449
118 S 1.000** 965.449
119 T 1.000** 965.449
120 N 1.000** 965.449
121 F 1.000** 965.449
122 K 1.000** 965.449
123 T 1.000** 965.449
124 G 1.000** 965.449
125 P 1.000** 965.449
126 A 1.000** 965.449
127 I 1.000** 965.449
128 L 1.000** 965.449
129 G 1.000** 965.449
130 I 1.000** 965.449
131 A 1.000** 965.449
132 D 1.000** 965.449
133 I 1.000** 965.449
134 S 1.000** 965.449
135 N 1.000** 965.449
136 H 1.000** 965.449
137 T 1.000** 965.449
138 F 1.000** 965.449
139 T 1.000** 965.449
140 V 1.000** 965.449
141 T 1.000** 965.449
142 I 1.000** 965.449
143 D 1.000** 965.449
144 G 1.000** 965.449
145 V 1.000** 965.449
146 E 1.000** 965.449
147 A 1.000** 965.449
148 E 1.000** 965.449
149 T 1.000** 965.449
150 P 1.000** 965.449
151 P 1.000** 965.449
152 P 1.000** 965.449
153 L 1.000** 965.449
154 P 1.000** 965.449
155 S 1.000** 965.449
156 P 1.000** 965.449
157 H 1.000** 965.449
158 H 1.000** 965.449
159 R 1.000** 965.449
160 P 1.000** 965.449
161 H 1.000** 965.449
162 W 1.000** 965.449
163 G 1.000** 965.449
164 E 1.000** 965.449
165 E 1.000** 965.449
166 G 1.000** 965.449
167 V 1.000** 965.449
168 M 1.000** 965.449
169 P 1.000** 965.449
170 A 1.000** 965.449
171 S 1.000** 965.449
172 M 1.000** 965.449
173 G 1.000** 965.449
174 K 1.000** 965.449
175 T 1.000** 965.449
176 E 1.000** 965.449
177 F 1.000** 965.449
178 P 1.000** 965.449
179 T 1.000** 965.449
180 P 1.000** 965.449
181 T 1.000** 965.449
182 G 1.000** 965.449
183 K 1.000** 965.449
184 Y 1.000** 965.449
185 T 1.000** 965.449
186 V 1.000** 965.449
187 M 1.000** 965.449
188 S 1.000** 965.449
189 K 1.000** 965.449
190 D 1.000** 965.449
191 R 1.000** 965.449
192 S 1.000** 965.449
193 V 1.000** 965.449
194 I 1.000** 965.449
195 M 1.000** 965.449
196 D 1.000** 965.449
197 S 1.000** 965.449
198 S 1.000** 965.449
199 S 1.000** 965.449
200 V 1.000** 965.449
201 G 1.000** 965.449
202 I 1.000** 965.449
203 P 1.000** 965.449
204 V 1.000** 965.449
205 D 1.000** 965.449
206 D 1.000** 965.449
207 P 1.000** 965.449
208 E 1.000** 965.449
209 G 1.000** 965.449
210 Y 1.000** 965.449
211 R 1.000** 965.449
212 L 1.000** 965.449
213 S 1.000** 965.449
214 V 1.000** 965.449
215 D 1.000** 965.449
216 Y 1.000** 965.449
217 A 1.000** 965.449
218 V 1.000** 965.449
219 R 1.000** 965.449
220 I 1.000** 965.449
221 S 1.000** 965.449
222 S 1.000** 965.449
223 R 1.000** 965.449
224 G 1.000** 965.449
225 L 1.000** 965.449
226 Y 1.000** 965.449
227 I 1.000** 965.449
228 H 1.000** 965.449
229 S 1.000** 965.449
230 A 1.000** 965.449
231 P 1.000** 965.449
232 W 1.000** 965.449
233 A 1.000** 965.449
234 V 1.000** 965.449
235 Q 1.000** 965.449
236 S 1.000** 965.449
237 M 1.000** 965.449
238 G 1.000** 965.449
239 F 1.000** 965.449
240 D 1.000** 965.449
241 N 1.000** 965.449
242 T 1.000** 965.449
243 S 1.000** 965.449
244 H 1.000** 965.449
245 G 1.000** 965.449
246 C 1.000** 965.449
247 I 1.000** 965.449
248 S 1.000** 965.449
249 L 1.000** 965.449
250 S 1.000** 965.449
251 P 1.000** 965.449
252 A 1.000** 965.449
253 D 1.000** 965.449
254 A 1.000** 965.449
255 E 1.000** 965.449
256 W 1.000** 965.449
257 Y 1.000** 965.449
258 Y 1.000** 965.449
259 N 1.000** 965.449
260 T 1.000** 965.449
261 V 1.000** 965.449
262 N 1.000** 965.449
263 I 1.000** 965.449
264 G 1.000** 965.449
265 D 1.000** 965.449
266 P 1.000** 965.449
267 V 1.000** 965.449
268 I 1.000** 965.449
269 V 1.000** 965.449
270 K 1.000** 965.449
271 E 1.000** 965.449
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634420_1_595_MLBR_RS02810)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.857
2 G 0.639 4.860 +- 3.857
3 I 0.639 4.860 +- 3.857
4 M 0.639 4.860 +- 3.857
5 R 0.639 4.860 +- 3.857
6 A 0.639 4.860 +- 3.857
7 A 0.639 4.860 +- 3.857
8 I 0.639 4.860 +- 3.857
9 R 0.639 4.861 +- 3.857
10 G 0.639 4.860 +- 3.857
11 V 0.639 4.860 +- 3.857
12 L 0.639 4.860 +- 3.857
13 V 0.639 4.860 +- 3.857
14 V 0.639 4.860 +- 3.857
15 I 0.639 4.860 +- 3.857
16 G 0.639 4.860 +- 3.857
17 I 0.639 4.860 +- 3.857
18 A 0.639 4.860 +- 3.857
19 A 0.639 4.860 +- 3.857
20 T 0.639 4.860 +- 3.857
21 V 0.639 4.860 +- 3.857
22 I 0.639 4.860 +- 3.857
23 A 0.639 4.860 +- 3.857
24 G 0.639 4.860 +- 3.857
25 P 0.639 4.860 +- 3.857
26 V 0.639 4.860 +- 3.857
27 R 0.639 4.860 +- 3.857
28 V 0.639 4.860 +- 3.857
29 S 0.639 4.860 +- 3.857
30 L 0.639 4.861 +- 3.857
31 A 0.639 4.860 +- 3.857
32 A 0.639 4.860 +- 3.857
33 V 0.639 4.860 +- 3.857
34 N 0.639 4.860 +- 3.857
35 H 0.639 4.860 +- 3.857
36 A 0.639 4.860 +- 3.857
37 H 0.639 4.860 +- 3.857
38 G 0.639 4.860 +- 3.857
39 F 0.639 4.860 +- 3.857
40 A 0.639 4.860 +- 3.857
41 I 0.639 4.860 +- 3.857
42 T 0.639 4.860 +- 3.857
43 S 0.639 4.860 +- 3.857
44 I 0.639 4.860 +- 3.857
45 L 0.639 4.861 +- 3.857
46 P 0.639 4.860 +- 3.857
47 T 0.639 4.860 +- 3.857
48 R 0.639 4.860 +- 3.857
49 D 0.639 4.860 +- 3.857
50 A 0.639 4.860 +- 3.857
51 V 0.639 4.860 +- 3.857
52 V 0.639 4.860 +- 3.857
53 G 0.639 4.860 +- 3.857
54 V 0.639 4.860 +- 3.857
55 A 0.639 4.860 +- 3.857
56 H 0.639 4.860 +- 3.857
57 P 0.639 4.860 +- 3.857
58 V 0.639 4.860 +- 3.857
59 V 0.639 4.860 +- 3.857
60 V 0.639 4.860 +- 3.857
61 T 0.639 4.860 +- 3.857
62 F 0.639 4.860 +- 3.857
63 G 0.639 4.860 +- 3.857
64 A 0.639 4.860 +- 3.857
65 P 0.639 4.860 +- 3.857
66 V 0.639 4.860 +- 3.857
67 T 0.639 4.860 +- 3.857
68 N 0.639 4.860 +- 3.857
69 R 0.639 4.860 +- 3.857
70 K 0.639 4.860 +- 3.857
71 A 0.639 4.860 +- 3.857
72 T 0.639 4.860 +- 3.857
73 E 0.639 4.860 +- 3.857
74 L 0.639 4.860 +- 3.857
75 S 0.639 4.860 +- 3.857
76 L 0.639 4.860 +- 3.857
77 K 0.639 4.860 +- 3.857
78 V 0.639 4.860 +- 3.857
79 R 0.639 4.860 +- 3.857
80 S 0.639 4.860 +- 3.857
81 A 0.639 4.860 +- 3.857
82 P 0.639 4.860 +- 3.857
83 A 0.639 4.860 +- 3.857
84 M 0.639 4.860 +- 3.857
85 N 0.639 4.860 +- 3.857
86 G 0.639 4.860 +- 3.857
87 K 0.639 4.860 +- 3.857
88 F 0.639 4.860 +- 3.857
89 D 0.639 4.860 +- 3.857
90 W 0.639 4.861 +- 3.857
91 L 0.639 4.860 +- 3.857
92 D 0.639 4.860 +- 3.857
93 S 0.639 4.860 +- 3.857
94 K 0.639 4.860 +- 3.857
95 V 0.639 4.860 +- 3.857
96 V 0.639 4.860 +- 3.857
97 Q 0.639 4.861 +- 3.857
98 W 0.639 4.861 +- 3.857
99 V 0.639 4.860 +- 3.857
100 P 0.639 4.860 +- 3.857
101 D 0.639 4.860 +- 3.857
102 R 0.639 4.860 +- 3.857
103 Y 0.639 4.860 +- 3.857
104 W 0.639 4.861 +- 3.857
105 P 0.639 4.860 +- 3.857
106 E 0.639 4.860 +- 3.857
107 H 0.639 4.860 +- 3.857
108 S 0.639 4.860 +- 3.857
109 T 0.639 4.860 +- 3.857
110 I 0.639 4.860 +- 3.857
111 A 0.639 4.860 +- 3.857
112 L 0.639 4.860 +- 3.857
113 A 0.923 6.858 +- 3.003
114 V 0.639 4.860 +- 3.857
115 G 0.639 4.860 +- 3.857
116 N 0.639 4.860 +- 3.857
117 L 0.639 4.860 +- 3.857
118 S 0.639 4.860 +- 3.857
119 T 0.639 4.860 +- 3.857
120 N 0.639 4.860 +- 3.857
121 F 0.639 4.860 +- 3.857
122 K 0.639 4.860 +- 3.857
123 T 0.639 4.860 +- 3.857
124 G 0.639 4.860 +- 3.857
125 P 0.639 4.860 +- 3.857
126 A 0.639 4.860 +- 3.857
127 I 0.639 4.860 +- 3.857
128 L 0.639 4.860 +- 3.857
129 G 0.639 4.860 +- 3.857
130 I 0.639 4.860 +- 3.857
131 A 0.639 4.860 +- 3.857
132 D 0.639 4.860 +- 3.857
133 I 0.639 4.860 +- 3.857
134 S 0.639 4.860 +- 3.857
135 N 0.639 4.860 +- 3.857
136 H 0.639 4.860 +- 3.857
137 T 0.639 4.860 +- 3.857
138 F 0.639 4.860 +- 3.857
139 T 0.639 4.860 +- 3.857
140 V 0.639 4.860 +- 3.857
141 T 0.639 4.860 +- 3.857
142 I 0.639 4.860 +- 3.857
143 D 0.639 4.860 +- 3.857
144 G 0.639 4.860 +- 3.857
145 V 0.639 4.860 +- 3.857
146 E 0.639 4.860 +- 3.857
147 A 0.639 4.860 +- 3.857
148 E 0.639 4.860 +- 3.857
149 T 0.639 4.860 +- 3.857
150 P 0.639 4.860 +- 3.857
151 P 0.639 4.860 +- 3.857
152 P 0.639 4.860 +- 3.857
153 L 0.639 4.860 +- 3.857
154 P 0.639 4.860 +- 3.857
155 S 0.639 4.860 +- 3.857
156 P 0.639 4.860 +- 3.857
157 H 0.639 4.860 +- 3.857
158 H 0.639 4.860 +- 3.857
159 R 0.639 4.860 +- 3.857
160 P 0.639 4.860 +- 3.857
161 H 0.639 4.860 +- 3.857
162 W 0.639 4.861 +- 3.857
163 G 0.639 4.860 +- 3.857
164 E 0.639 4.860 +- 3.857
165 E 0.639 4.860 +- 3.857
166 G 0.639 4.860 +- 3.857
167 V 0.639 4.860 +- 3.857
168 M 0.639 4.860 +- 3.857
169 P 0.639 4.860 +- 3.857
170 A 0.639 4.860 +- 3.857
171 S 0.639 4.860 +- 3.857
172 M 0.639 4.860 +- 3.857
173 G 0.639 4.860 +- 3.857
174 K 0.639 4.860 +- 3.857
175 T 0.639 4.860 +- 3.857
176 E 0.639 4.860 +- 3.857
177 F 0.639 4.860 +- 3.857
178 P 0.639 4.860 +- 3.857
179 T 0.639 4.860 +- 3.857
180 P 0.639 4.860 +- 3.857
181 T 0.639 4.860 +- 3.857
182 G 0.639 4.860 +- 3.857
183 K 0.639 4.860 +- 3.857
184 Y 0.639 4.860 +- 3.857
185 T 0.639 4.860 +- 3.857
186 V 0.639 4.860 +- 3.857
187 M 0.639 4.860 +- 3.857
188 S 0.639 4.860 +- 3.857
189 K 0.639 4.860 +- 3.857
190 D 0.639 4.860 +- 3.857
191 R 0.639 4.860 +- 3.857
192 S 0.639 4.860 +- 3.857
193 V 0.639 4.860 +- 3.857
194 I 0.639 4.860 +- 3.857
195 M 0.639 4.860 +- 3.857
196 D 0.639 4.860 +- 3.857
197 S 0.639 4.860 +- 3.857
198 S 0.639 4.860 +- 3.857
199 S 0.639 4.860 +- 3.857
200 V 0.639 4.860 +- 3.857
201 G 0.639 4.860 +- 3.857
202 I 0.639 4.860 +- 3.857
203 P 0.639 4.860 +- 3.857
204 V 0.639 4.860 +- 3.857
205 D 0.639 4.860 +- 3.857
206 D 0.639 4.860 +- 3.857
207 P 0.639 4.860 +- 3.857
208 E 0.639 4.860 +- 3.857
209 G 0.639 4.860 +- 3.857
210 Y 0.639 4.860 +- 3.857
211 R 0.639 4.860 +- 3.857
212 L 0.639 4.860 +- 3.857
213 S 0.639 4.860 +- 3.857
214 V 0.639 4.860 +- 3.857
215 D 0.639 4.860 +- 3.857
216 Y 0.639 4.860 +- 3.857
217 A 0.639 4.860 +- 3.857
218 V 0.639 4.860 +- 3.857
219 R 0.639 4.860 +- 3.857
220 I 0.639 4.860 +- 3.857
221 S 0.639 4.860 +- 3.857
222 S 0.639 4.860 +- 3.857
223 R 0.639 4.860 +- 3.857
224 G 0.639 4.860 +- 3.857
225 L 0.639 4.860 +- 3.857
226 Y 0.639 4.860 +- 3.857
227 I 0.639 4.860 +- 3.857
228 H 0.639 4.860 +- 3.857
229 S 0.639 4.860 +- 3.857
230 A 0.639 4.860 +- 3.857
231 P 0.639 4.860 +- 3.857
232 W 0.639 4.861 +- 3.857
233 A 0.639 4.860 +- 3.857
234 V 0.639 4.860 +- 3.857
235 Q 0.639 4.861 +- 3.857
236 S 0.639 4.860 +- 3.857
237 M 0.639 4.860 +- 3.857
238 G 0.639 4.860 +- 3.857
239 F 0.639 4.860 +- 3.857
240 D 0.639 4.860 +- 3.857
241 N 0.639 4.860 +- 3.857
242 T 0.639 4.860 +- 3.857
243 S 0.639 4.860 +- 3.857
244 H 0.639 4.860 +- 3.857
245 G 0.639 4.860 +- 3.857
246 C 0.639 4.860 +- 3.857
247 I 0.639 4.860 +- 3.857
248 S 0.639 4.860 +- 3.857
249 L 0.639 4.861 +- 3.857
250 S 0.639 4.860 +- 3.857
251 P 0.639 4.860 +- 3.857
252 A 0.639 4.860 +- 3.857
253 D 0.639 4.860 +- 3.857
254 A 0.639 4.860 +- 3.857
255 E 0.639 4.860 +- 3.857
256 W 0.639 4.861 +- 3.857
257 Y 0.639 4.860 +- 3.857
258 Y 0.639 4.860 +- 3.857
259 N 0.639 4.860 +- 3.857
260 T 0.639 4.860 +- 3.857
261 V 0.639 4.860 +- 3.857
262 N 0.639 4.860 +- 3.857
263 I 0.639 4.860 +- 3.857
264 G 0.639 4.860 +- 3.857
265 D 0.639 4.860 +- 3.857
266 P 0.639 4.860 +- 3.857
267 V 0.639 4.860 +- 3.857
268 I 0.639 4.860 +- 3.857
269 V 0.639 4.860 +- 3.857
270 K 0.639 4.860 +- 3.857
271 E 0.639 4.860 +- 3.857
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:24
Model 1: NearlyNeutral -1089.515289 Model 2: PositiveSelection -1089.179229 Model 0: one-ratio -1089.179107 Model 7: beta -1089.515289 Model 8: beta&w>1 -1089.179222 Model 0 vs 1 0.672364000000016 Model 2 vs 1 0.6721199999997225 Model 8 vs 7 0.6721339999999145
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
