--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:13:49 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0574/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -428.88 -431.90
2 -428.86 -432.56
--------------------------------------
TOTAL -428.87 -432.29
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897289 0.093234 0.365363 1.539730 0.858834 1318.85 1409.92 1.000
r(A<->C){all} 0.175672 0.022000 0.000001 0.476734 0.136180 135.57 183.05 1.000
r(A<->G){all} 0.159723 0.018767 0.000190 0.431247 0.121672 300.88 347.58 1.000
r(A<->T){all} 0.173477 0.021108 0.000011 0.462552 0.134324 61.86 141.78 1.000
r(C<->G){all} 0.160700 0.019263 0.000238 0.444791 0.123407 131.84 251.29 1.000
r(C<->T){all} 0.169915 0.020909 0.000065 0.456736 0.133003 173.50 202.13 1.000
r(G<->T){all} 0.160514 0.019942 0.000270 0.454571 0.119585 94.23 94.98 1.000
pi(A){all} 0.163013 0.000413 0.122543 0.202146 0.162314 1380.90 1385.20 1.000
pi(C){all} 0.253946 0.000572 0.207974 0.300894 0.254140 1421.64 1430.02 1.000
pi(G){all} 0.332384 0.000719 0.280932 0.387324 0.332057 1230.27 1312.49 1.000
pi(T){all} 0.250657 0.000581 0.203485 0.298856 0.249963 1395.83 1405.89 1.000
alpha{1,2} 0.394327 0.201015 0.000134 1.325140 0.243095 1191.24 1198.72 1.000
alpha{3} 0.457530 0.235137 0.000166 1.450346 0.296808 1240.64 1288.42 1.001
pinvar{all} 0.994778 0.000039 0.982697 0.999996 0.996792 1104.44 1191.96 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -417.526764
Model 2: PositiveSelection -417.526847
Model 0: one-ratio -417.526885
Model 7: beta -417.526755
Model 8: beta&w>1 -417.526833
Model 0 vs 1 2.4199999995744292E-4
Model 2 vs 1 1.659999999219508E-4
Model 8 vs 7 1.560000000608852E-4
>C1
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C2
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C3
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C4
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C5
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C6
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=105
C1 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C2 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C3 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C4 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C5 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C6 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
**************************************************
C1 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C2 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C3 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C4 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C5 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C6 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
**************************************************
C1 IMRDA
C2 IMRDA
C3 IMRDA
C4 IMRDA
C5 IMRDA
C6 IMRDA
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3150]--->[3150]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.455 Mb, Max= 30.630 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C2 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C3 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C4 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C5 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
C6 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
**************************************************
C1 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C2 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C3 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C4 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C5 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
C6 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
**************************************************
C1 IMRDA
C2 IMRDA
C3 IMRDA
C4 IMRDA
C5 IMRDA
C6 IMRDA
*****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
C2 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
C3 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
C4 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
C5 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
C6 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
**************************************************
C1 GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
C2 GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
C3 GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
C4 GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
C5 GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
C6 GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
**************************************************
C1 TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
C2 TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
C3 TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
C4 TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
C5 TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
C6 TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
**************************************************
C1 GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
C2 GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
C3 GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
C4 GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
C5 GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
C6 GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
**************************************************
C1 GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
C2 GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
C3 GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
C4 GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
C5 GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
C6 GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
**************************************************
C1 CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
C2 CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
C3 CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
C4 CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
C5 CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
C6 CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
**************************************************
C1 ATTATGCGCGATGCG
C2 ATTATGCGCGATGCG
C3 ATTATGCGCGATGCG
C4 ATTATGCGCGATGCG
C5 ATTATGCGCGATGCG
C6 ATTATGCGCGATGCG
***************
>C1
GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
ATTATGCGCGATGCG
>C2
GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
ATTATGCGCGATGCG
>C3
GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
ATTATGCGCGATGCG
>C4
GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
ATTATGCGCGATGCG
>C5
GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
ATTATGCGCGATGCG
>C6
GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT
GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG
TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG
GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC
GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC
CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT
ATTATGCGCGATGCG
>C1
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C2
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C3
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C4
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C5
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
>C6
VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
IMRDA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 315 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579795945
Setting output file names to "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 968574118
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0305269938
Seed = 443925884
Swapseed = 1579795945
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -704.985098 -- -24.965149
Chain 2 -- -704.985057 -- -24.965149
Chain 3 -- -704.984991 -- -24.965149
Chain 4 -- -704.985098 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -704.985098 -- -24.965149
Chain 2 -- -704.985098 -- -24.965149
Chain 3 -- -704.985057 -- -24.965149
Chain 4 -- -704.985098 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-704.985] (-704.985) (-704.985) (-704.985) * [-704.985] (-704.985) (-704.985) (-704.985)
500 -- (-437.506) [-436.785] (-446.822) (-439.316) * (-447.880) (-434.276) [-447.013] (-439.037) -- 0:00:00
1000 -- (-439.148) [-435.457] (-442.010) (-439.382) * (-454.423) [-443.912] (-442.150) (-435.493) -- 0:00:00
1500 -- (-438.147) (-444.900) (-445.058) [-433.217] * (-433.595) (-434.669) [-438.388] (-441.183) -- 0:00:00
2000 -- (-433.900) (-439.597) (-442.412) [-432.715] * (-435.311) (-432.619) (-436.272) [-435.917] -- 0:00:00
2500 -- [-440.318] (-440.159) (-435.880) (-442.968) * (-447.493) (-440.131) [-440.528] (-443.180) -- 0:00:00
3000 -- [-434.151] (-437.208) (-431.972) (-439.978) * (-437.928) [-440.770] (-437.168) (-437.603) -- 0:00:00
3500 -- [-437.645] (-440.798) (-435.978) (-440.805) * (-441.767) (-435.539) (-432.174) [-447.667] -- 0:00:00
4000 -- (-445.474) (-444.937) [-437.906] (-436.720) * (-438.201) (-436.203) [-434.795] (-436.724) -- 0:00:00
4500 -- (-437.479) (-437.437) [-435.365] (-436.799) * (-438.900) [-435.605] (-436.055) (-443.087) -- 0:00:00
5000 -- (-446.012) (-435.311) [-432.588] (-436.185) * [-440.167] (-439.174) (-443.173) (-444.368) -- 0:00:00
Average standard deviation of split frequencies: 0.122975
5500 -- (-440.931) (-439.940) (-441.090) [-442.212] * (-432.010) (-431.743) (-436.536) [-433.121] -- 0:00:00
6000 -- (-439.435) (-448.995) [-432.769] (-442.698) * [-437.179] (-435.373) (-438.856) (-437.004) -- 0:00:00
6500 -- (-442.051) [-435.998] (-441.650) (-441.639) * (-438.019) (-442.702) [-434.874] (-448.228) -- 0:00:00
7000 -- (-433.992) [-439.865] (-446.457) (-437.754) * (-440.925) (-443.741) (-437.999) [-439.351] -- 0:00:00
7500 -- (-438.018) (-434.725) [-439.528] (-446.760) * (-445.584) [-437.116] (-439.818) (-435.356) -- 0:00:00
8000 -- (-448.492) (-437.632) (-437.756) [-440.976] * (-439.168) (-434.807) [-438.242] (-457.191) -- 0:00:00
8500 -- (-440.407) (-440.328) (-440.115) [-437.364] * (-437.407) [-441.991] (-446.691) (-436.438) -- 0:00:00
9000 -- (-445.556) (-436.838) [-436.358] (-442.539) * [-437.145] (-438.668) (-440.353) (-430.795) -- 0:00:00
9500 -- (-446.615) (-441.722) [-441.585] (-439.153) * (-444.502) [-441.293] (-437.723) (-429.887) -- 0:00:00
10000 -- (-440.747) [-436.289] (-439.170) (-438.517) * (-441.034) (-437.303) (-436.717) [-431.463] -- 0:00:00
Average standard deviation of split frequencies: 0.092597
10500 -- (-440.989) (-439.848) [-434.010] (-440.635) * [-443.800] (-441.860) (-443.269) (-432.679) -- 0:00:00
11000 -- (-434.022) [-440.103] (-436.635) (-436.340) * [-439.347] (-442.111) (-435.103) (-430.590) -- 0:00:00
11500 -- (-440.432) (-439.548) (-435.674) [-434.316] * (-436.008) (-439.358) [-433.455] (-429.303) -- 0:00:00
12000 -- (-442.660) (-441.319) (-437.968) [-437.253] * (-447.729) [-435.220] (-436.735) (-429.177) -- 0:00:00
12500 -- (-437.943) (-429.429) [-436.540] (-439.820) * (-435.076) (-438.233) (-440.945) [-429.761] -- 0:01:19
13000 -- (-436.032) [-428.723] (-438.929) (-438.950) * (-440.063) (-435.936) [-437.939] (-428.070) -- 0:01:15
13500 -- (-444.455) (-429.165) [-434.535] (-434.099) * [-434.332] (-434.870) (-439.085) (-427.807) -- 0:01:13
14000 -- (-443.086) (-429.271) (-433.621) [-436.934] * (-441.973) (-432.108) [-435.695] (-428.862) -- 0:01:10
14500 -- [-443.793] (-428.343) (-444.210) (-439.015) * (-441.633) (-431.921) (-454.041) [-431.471] -- 0:01:07
15000 -- (-440.499) [-428.795] (-444.980) (-440.453) * [-439.794] (-430.499) (-436.430) (-429.712) -- 0:01:05
Average standard deviation of split frequencies: 0.075130
15500 -- (-458.319) (-429.699) [-439.524] (-441.979) * (-451.512) (-428.233) (-436.404) [-429.307] -- 0:01:03
16000 -- (-437.802) [-430.424] (-437.267) (-435.008) * (-439.502) (-429.241) [-441.911] (-428.638) -- 0:01:01
16500 -- (-431.160) (-430.679) (-441.781) [-434.621] * (-446.024) (-429.382) (-451.666) [-432.030] -- 0:00:59
17000 -- (-428.013) (-429.886) (-437.816) [-440.470] * (-428.550) (-428.239) (-429.737) [-427.928] -- 0:00:57
17500 -- [-428.684] (-427.813) (-433.602) (-444.077) * (-429.100) [-429.575] (-430.765) (-430.645) -- 0:00:56
18000 -- [-432.474] (-429.037) (-444.496) (-442.759) * (-431.648) (-428.619) (-431.632) [-429.406] -- 0:00:54
18500 -- (-430.749) [-429.201] (-445.015) (-443.971) * (-430.551) (-428.743) [-429.021] (-428.115) -- 0:00:53
19000 -- (-434.624) [-428.023] (-443.998) (-443.841) * (-432.746) (-427.423) (-429.895) [-430.791] -- 0:00:51
19500 -- (-430.740) (-428.191) [-436.108] (-438.803) * (-427.967) (-432.840) [-429.120] (-429.761) -- 0:00:50
20000 -- (-431.068) (-430.371) (-433.457) [-434.056] * (-428.668) (-437.659) (-431.122) [-428.975] -- 0:00:49
Average standard deviation of split frequencies: 0.059306
20500 -- (-428.621) (-430.032) (-428.963) [-436.926] * (-429.116) (-429.692) [-432.840] (-429.702) -- 0:00:47
21000 -- (-428.816) [-429.121] (-427.332) (-442.622) * (-430.146) [-429.037] (-429.391) (-429.165) -- 0:00:46
21500 -- (-429.604) (-428.140) (-428.524) [-433.257] * [-428.143] (-427.834) (-429.263) (-429.023) -- 0:00:45
22000 -- (-429.856) (-428.363) (-428.791) [-436.196] * (-431.040) (-428.357) (-428.549) [-428.536] -- 0:00:44
22500 -- (-430.763) [-428.172] (-429.069) (-447.153) * (-429.430) [-427.978] (-428.782) (-429.263) -- 0:00:43
23000 -- [-427.649] (-428.579) (-428.879) (-447.570) * (-431.166) (-428.948) (-434.050) [-430.240] -- 0:00:42
23500 -- [-427.794] (-428.552) (-429.855) (-438.778) * (-432.734) (-429.739) (-428.598) [-427.878] -- 0:00:41
24000 -- [-427.510] (-432.230) (-428.561) (-441.826) * (-430.038) [-429.160] (-428.877) (-435.918) -- 0:00:40
24500 -- [-429.715] (-430.370) (-429.259) (-447.959) * (-429.086) [-428.552] (-431.575) (-430.543) -- 0:00:39
25000 -- [-432.525] (-429.599) (-428.549) (-441.202) * (-430.078) (-427.994) [-428.355] (-429.783) -- 0:00:39
Average standard deviation of split frequencies: 0.038852
25500 -- (-434.083) (-428.326) [-427.609] (-446.625) * [-429.518] (-430.138) (-430.103) (-429.757) -- 0:00:38
26000 -- [-427.613] (-429.378) (-427.931) (-454.015) * (-433.481) (-432.946) [-429.582] (-431.050) -- 0:00:37
26500 -- [-428.179] (-428.932) (-429.660) (-428.869) * (-430.763) (-428.745) [-428.968] (-428.561) -- 0:00:36
27000 -- (-431.737) (-428.115) [-428.204] (-428.660) * (-430.548) [-431.688] (-429.501) (-429.738) -- 0:00:36
27500 -- (-428.444) [-428.313] (-429.955) (-427.627) * (-428.233) [-433.049] (-430.754) (-433.857) -- 0:00:35
28000 -- (-432.578) (-430.441) [-428.421] (-427.739) * (-428.524) (-428.350) [-429.980] (-429.222) -- 0:00:34
28500 -- (-431.829) (-431.852) [-428.650] (-429.364) * (-427.965) (-428.270) [-428.271] (-432.192) -- 0:01:08
29000 -- [-430.145] (-431.547) (-430.472) (-427.734) * (-429.977) [-429.501] (-430.347) (-429.042) -- 0:01:06
29500 -- [-428.437] (-430.181) (-429.757) (-428.186) * (-431.576) [-429.107] (-431.087) (-429.435) -- 0:01:05
30000 -- (-428.769) (-431.054) (-432.564) [-429.599] * (-430.727) (-430.420) (-429.392) [-433.586] -- 0:01:04
Average standard deviation of split frequencies: 0.037576
30500 -- [-428.604] (-427.911) (-427.601) (-430.206) * (-430.975) (-428.966) (-429.773) [-428.866] -- 0:01:03
31000 -- (-430.318) [-428.283] (-427.330) (-434.766) * (-431.727) [-429.819] (-428.515) (-430.600) -- 0:01:02
31500 -- (-433.481) (-427.963) (-428.053) [-431.062] * (-429.686) [-428.545] (-428.957) (-429.499) -- 0:01:01
32000 -- [-429.292] (-427.483) (-428.963) (-432.739) * (-430.134) [-428.613] (-436.799) (-430.253) -- 0:01:00
32500 -- (-427.567) (-427.719) [-428.387] (-429.950) * (-429.446) (-430.007) (-429.008) [-428.467] -- 0:00:59
33000 -- [-431.059] (-427.669) (-429.733) (-428.847) * (-429.141) (-428.921) (-427.961) [-430.244] -- 0:00:58
33500 -- (-431.483) (-429.751) (-428.376) [-429.210] * (-429.962) (-432.331) (-434.046) [-432.821] -- 0:00:57
34000 -- (-429.928) [-429.450] (-429.352) (-429.463) * (-432.221) (-430.632) [-430.752] (-428.450) -- 0:00:56
34500 -- (-429.365) (-427.995) [-430.190] (-427.944) * (-441.472) (-429.343) (-429.150) [-430.911] -- 0:00:55
35000 -- (-429.970) [-428.769] (-427.896) (-434.211) * (-433.667) [-428.348] (-431.018) (-430.117) -- 0:00:55
Average standard deviation of split frequencies: 0.024880
35500 -- [-428.670] (-430.848) (-428.313) (-432.978) * (-429.380) [-434.018] (-431.709) (-428.390) -- 0:00:54
36000 -- (-430.462) (-429.653) [-428.335] (-427.783) * (-428.310) (-428.195) [-429.753] (-428.342) -- 0:00:53
36500 -- (-428.654) [-427.649] (-430.908) (-428.879) * (-430.998) [-429.722] (-432.935) (-433.200) -- 0:00:52
37000 -- [-428.351] (-428.187) (-430.372) (-428.035) * (-431.761) [-429.030] (-428.700) (-428.876) -- 0:00:52
37500 -- (-428.686) [-428.722] (-429.512) (-427.831) * [-427.635] (-428.554) (-428.273) (-432.132) -- 0:00:51
38000 -- (-429.673) [-428.062] (-428.083) (-431.164) * [-427.876] (-428.328) (-428.440) (-429.454) -- 0:00:50
38500 -- (-429.419) [-428.096] (-428.835) (-428.175) * [-429.632] (-431.622) (-431.097) (-429.832) -- 0:00:49
39000 -- (-428.580) (-429.542) (-429.323) [-428.544] * (-430.093) (-432.841) (-434.569) [-428.258] -- 0:00:49
39500 -- (-428.612) (-434.156) (-430.741) [-428.381] * (-428.730) [-432.485] (-431.178) (-427.837) -- 0:00:48
40000 -- (-429.312) [-431.397] (-431.030) (-428.936) * (-428.600) (-431.455) [-431.119] (-431.739) -- 0:00:48
Average standard deviation of split frequencies: 0.021354
40500 -- (-428.479) (-432.134) [-430.213] (-428.231) * (-429.403) (-431.596) [-430.103] (-428.606) -- 0:00:47
41000 -- (-430.184) (-429.795) (-429.061) [-428.783] * (-434.435) [-429.196] (-429.861) (-430.697) -- 0:00:46
41500 -- (-431.281) (-438.104) [-428.669] (-427.800) * (-432.471) [-430.245] (-430.478) (-431.810) -- 0:00:46
42000 -- (-431.059) (-430.787) (-428.668) [-432.769] * (-428.773) (-427.535) (-428.888) [-429.796] -- 0:00:45
42500 -- [-429.361] (-429.262) (-431.626) (-428.158) * (-429.874) (-430.954) (-428.889) [-429.859] -- 0:00:45
43000 -- [-430.671] (-428.894) (-431.499) (-433.293) * (-432.718) (-428.795) [-429.582] (-429.460) -- 0:00:44
43500 -- (-430.684) (-429.238) [-427.726] (-429.042) * (-432.967) (-428.529) [-428.937] (-429.836) -- 0:00:43
44000 -- (-429.055) (-429.437) (-428.359) [-427.808] * (-429.814) (-430.484) (-428.513) [-429.461] -- 0:00:43
44500 -- (-428.713) (-429.872) [-428.053] (-428.990) * (-432.846) [-429.205] (-431.585) (-430.206) -- 0:00:42
45000 -- (-428.704) (-432.960) (-432.311) [-429.175] * (-432.197) [-427.867] (-431.575) (-430.122) -- 0:00:42
Average standard deviation of split frequencies: 0.022545
45500 -- (-431.560) (-432.623) [-428.532] (-432.507) * (-430.569) [-429.202] (-431.644) (-428.513) -- 0:01:02
46000 -- (-428.591) (-430.065) (-436.429) [-427.662] * (-429.803) (-431.821) (-430.746) [-428.823] -- 0:01:02
46500 -- (-428.156) (-429.006) (-434.963) [-428.881] * [-430.490] (-429.607) (-429.710) (-429.006) -- 0:01:01
47000 -- (-430.665) (-429.535) [-428.833] (-428.484) * (-432.315) (-428.946) [-428.553] (-427.780) -- 0:01:00
47500 -- (-433.299) [-427.851] (-430.201) (-430.668) * (-432.787) [-430.706] (-431.895) (-431.181) -- 0:01:00
48000 -- (-429.878) (-429.670) [-428.861] (-428.268) * (-428.725) [-428.436] (-429.090) (-430.757) -- 0:00:59
48500 -- (-429.497) [-428.356] (-431.198) (-428.024) * [-428.990] (-430.610) (-430.040) (-430.896) -- 0:00:58
49000 -- (-429.249) (-431.516) [-429.176] (-429.202) * (-427.446) (-429.179) (-430.125) [-430.953] -- 0:00:58
49500 -- (-428.638) [-429.570] (-428.989) (-430.528) * (-429.028) [-428.731] (-430.065) (-428.358) -- 0:00:57
50000 -- [-428.177] (-428.461) (-431.204) (-431.700) * (-429.601) [-428.886] (-428.016) (-431.470) -- 0:00:57
Average standard deviation of split frequencies: 0.022330
50500 -- (-429.747) [-427.439] (-430.114) (-429.356) * (-429.976) (-430.707) [-427.828] (-434.439) -- 0:00:56
51000 -- (-430.053) (-427.727) (-428.390) [-430.351] * (-427.924) (-431.063) (-429.577) [-431.363] -- 0:00:55
51500 -- (-436.438) (-428.601) (-429.291) [-429.717] * [-428.628] (-430.119) (-431.223) (-430.508) -- 0:00:55
52000 -- [-428.521] (-428.634) (-429.594) (-432.648) * [-429.803] (-431.238) (-433.087) (-429.359) -- 0:00:54
52500 -- (-430.723) (-430.712) [-432.293] (-428.223) * [-429.669] (-429.358) (-430.077) (-430.637) -- 0:00:54
53000 -- [-427.933] (-430.751) (-432.782) (-429.416) * (-430.518) [-428.922] (-429.118) (-433.509) -- 0:00:53
53500 -- [-428.648] (-430.237) (-431.510) (-430.055) * (-427.903) (-428.491) (-429.155) [-432.424] -- 0:00:53
54000 -- [-430.721] (-431.860) (-429.843) (-435.156) * (-428.066) [-432.407] (-428.774) (-431.070) -- 0:00:52
54500 -- (-429.992) [-429.127] (-427.796) (-434.686) * [-429.030] (-428.220) (-428.603) (-428.530) -- 0:00:52
55000 -- (-431.406) [-428.642] (-427.713) (-428.860) * (-429.146) (-429.906) (-428.102) [-430.953] -- 0:00:51
Average standard deviation of split frequencies: 0.018519
55500 -- (-429.641) (-428.223) [-430.998] (-428.480) * (-429.728) (-429.941) (-428.465) [-429.737] -- 0:00:51
56000 -- (-429.580) (-427.421) [-430.294] (-431.819) * (-430.012) (-430.696) (-428.109) [-428.143] -- 0:00:50
56500 -- (-428.992) [-427.198] (-430.984) (-428.978) * (-435.358) (-428.243) [-428.996] (-430.148) -- 0:00:50
57000 -- (-428.238) [-430.239] (-428.721) (-429.654) * (-429.699) [-427.991] (-428.879) (-430.436) -- 0:00:49
57500 -- (-429.392) (-428.005) [-427.794] (-431.556) * (-428.742) (-433.960) (-430.152) [-428.350] -- 0:00:49
58000 -- (-430.424) [-432.547] (-428.548) (-431.049) * [-427.784] (-427.819) (-428.570) (-429.743) -- 0:00:48
58500 -- [-429.343] (-427.763) (-429.348) (-429.638) * (-429.190) (-429.957) [-430.191] (-428.299) -- 0:00:48
59000 -- (-427.262) [-430.862] (-430.266) (-429.123) * [-428.067] (-430.997) (-430.756) (-432.776) -- 0:00:47
59500 -- (-428.753) (-429.403) (-431.426) [-428.780] * (-428.049) (-433.477) (-431.346) [-429.444] -- 0:00:47
60000 -- (-427.871) (-427.477) [-429.001] (-429.554) * (-428.941) (-427.653) [-436.080] (-427.665) -- 0:00:47
Average standard deviation of split frequencies: 0.022016
60500 -- [-431.154] (-428.767) (-428.445) (-437.370) * (-431.639) [-430.224] (-432.934) (-427.905) -- 0:00:46
61000 -- (-429.737) (-431.431) (-429.769) [-430.584] * (-428.570) (-434.839) [-428.862] (-430.817) -- 0:00:46
61500 -- (-431.052) [-428.390] (-427.751) (-432.260) * (-433.378) [-433.745] (-430.354) (-434.107) -- 0:01:01
62000 -- (-429.335) (-428.552) [-428.870] (-431.284) * (-428.917) (-435.082) (-431.928) [-428.918] -- 0:01:00
62500 -- (-430.800) (-429.111) [-428.526] (-428.470) * [-427.858] (-428.515) (-429.923) (-436.947) -- 0:01:00
63000 -- [-428.009] (-428.679) (-429.333) (-428.187) * [-428.041] (-429.196) (-428.730) (-431.084) -- 0:00:59
63500 -- (-429.051) [-429.323] (-429.165) (-428.377) * (-432.787) (-430.828) [-428.533] (-431.759) -- 0:00:58
64000 -- (-432.024) [-428.169] (-429.592) (-431.510) * (-431.204) (-431.294) [-428.208] (-432.404) -- 0:00:58
64500 -- (-431.544) (-427.826) (-430.574) [-429.463] * (-428.760) (-429.727) [-430.013] (-428.324) -- 0:00:58
65000 -- [-431.080] (-428.504) (-429.810) (-427.579) * (-434.297) [-429.475] (-429.104) (-430.895) -- 0:00:57
Average standard deviation of split frequencies: 0.019924
65500 -- [-429.961] (-428.402) (-427.795) (-429.898) * (-431.418) [-428.130] (-428.725) (-429.949) -- 0:00:57
66000 -- [-429.467] (-429.678) (-429.115) (-429.787) * (-430.750) [-428.389] (-428.567) (-428.309) -- 0:00:56
66500 -- (-429.110) (-430.628) [-428.072] (-429.880) * (-430.653) (-430.339) [-430.402] (-427.800) -- 0:00:56
67000 -- (-431.833) (-427.960) [-428.938] (-430.935) * [-430.051] (-430.478) (-428.189) (-428.131) -- 0:00:55
67500 -- (-433.690) (-428.844) [-427.807] (-432.031) * [-428.419] (-433.117) (-429.415) (-433.507) -- 0:00:55
68000 -- [-430.533] (-431.248) (-429.340) (-427.822) * (-427.865) [-430.431] (-433.462) (-427.974) -- 0:00:54
68500 -- (-428.943) (-430.957) (-433.136) [-427.923] * (-428.708) (-431.013) (-429.913) [-430.100] -- 0:00:54
69000 -- (-432.681) (-431.607) (-432.217) [-429.845] * [-433.654] (-430.509) (-431.212) (-431.457) -- 0:00:53
69500 -- (-427.813) (-428.040) [-429.778] (-428.517) * [-431.274] (-429.430) (-429.517) (-429.773) -- 0:00:53
70000 -- [-428.763] (-430.685) (-428.745) (-434.045) * (-429.095) (-428.666) (-429.074) [-429.603] -- 0:00:53
Average standard deviation of split frequencies: 0.017906
70500 -- (-430.204) (-430.410) [-428.444] (-431.671) * (-430.960) (-431.556) [-428.219] (-431.129) -- 0:00:52
71000 -- [-430.994] (-429.316) (-429.040) (-429.946) * (-429.900) (-428.885) [-428.329] (-429.557) -- 0:00:52
71500 -- (-428.990) (-428.370) (-428.459) [-427.709] * (-431.993) [-429.935] (-430.016) (-429.972) -- 0:00:51
72000 -- (-431.385) (-428.252) [-432.154] (-429.930) * (-433.631) [-427.786] (-429.890) (-428.853) -- 0:00:51
72500 -- (-433.368) [-429.570] (-431.615) (-430.525) * [-430.232] (-433.494) (-432.698) (-428.740) -- 0:00:51
73000 -- (-431.018) [-431.224] (-429.255) (-430.532) * [-428.082] (-434.246) (-432.012) (-428.366) -- 0:00:50
73500 -- (-430.074) (-431.366) [-431.046] (-429.828) * (-429.475) (-436.482) (-431.551) [-431.567] -- 0:00:50
74000 -- (-429.459) [-428.528] (-427.382) (-430.640) * (-430.336) (-435.731) (-431.620) [-431.579] -- 0:00:50
74500 -- (-431.646) (-428.889) (-429.021) [-430.412] * [-430.358] (-432.001) (-429.117) (-429.928) -- 0:00:49
75000 -- [-427.985] (-427.957) (-428.916) (-429.597) * (-429.354) (-429.845) [-428.259] (-430.302) -- 0:00:49
Average standard deviation of split frequencies: 0.018918
75500 -- [-428.471] (-431.830) (-430.951) (-427.641) * (-429.322) [-433.434] (-430.087) (-427.748) -- 0:00:48
76000 -- [-428.802] (-428.937) (-428.829) (-427.944) * (-429.349) [-430.371] (-430.751) (-428.328) -- 0:00:48
76500 -- (-430.121) [-429.638] (-430.513) (-430.064) * [-429.795] (-432.309) (-432.530) (-428.697) -- 0:00:48
77000 -- (-431.271) (-428.609) (-435.836) [-429.281] * (-428.020) [-433.704] (-430.504) (-432.461) -- 0:00:47
77500 -- [-433.301] (-429.258) (-428.403) (-427.821) * (-433.860) (-430.505) (-429.043) [-428.931] -- 0:00:47
78000 -- (-430.367) (-433.413) [-429.892] (-432.025) * (-436.562) (-429.340) (-433.255) [-428.583] -- 0:00:59
78500 -- (-432.693) (-429.901) (-428.144) [-430.681] * (-430.649) (-427.702) (-428.046) [-427.767] -- 0:00:58
79000 -- (-428.407) [-428.034] (-432.841) (-430.148) * [-428.950] (-432.535) (-430.235) (-434.479) -- 0:00:58
79500 -- (-428.384) [-428.390] (-428.687) (-428.102) * (-428.318) [-429.656] (-429.942) (-431.423) -- 0:00:57
80000 -- (-430.203) [-428.306] (-429.512) (-429.620) * (-432.089) (-428.711) [-428.310] (-432.255) -- 0:00:57
Average standard deviation of split frequencies: 0.018993
80500 -- [-431.258] (-428.850) (-429.405) (-432.119) * (-430.283) (-427.692) [-429.949] (-432.921) -- 0:00:57
81000 -- (-429.310) (-427.990) [-430.064] (-430.207) * (-432.019) [-429.085] (-430.830) (-428.664) -- 0:00:56
81500 -- (-432.128) (-430.761) [-428.483] (-431.731) * (-431.757) (-431.097) (-429.254) [-429.230] -- 0:00:56
82000 -- [-430.875] (-429.126) (-433.298) (-428.739) * (-429.578) [-429.866] (-433.639) (-436.210) -- 0:00:55
82500 -- [-432.743] (-430.225) (-430.887) (-427.909) * (-431.346) [-428.250] (-431.211) (-432.905) -- 0:00:55
83000 -- (-429.413) [-428.606] (-429.918) (-429.534) * [-431.237] (-431.060) (-428.357) (-430.583) -- 0:00:55
83500 -- (-432.555) (-429.193) (-429.985) [-430.733] * (-430.709) (-428.140) (-430.000) [-430.592] -- 0:00:54
84000 -- (-428.346) (-427.715) (-427.718) [-428.888] * (-431.916) (-429.665) (-429.257) [-427.774] -- 0:00:54
84500 -- (-428.659) (-429.131) [-428.077] (-429.915) * [-428.188] (-433.455) (-429.309) (-430.141) -- 0:00:54
85000 -- (-428.894) (-433.524) (-431.155) [-429.013] * (-434.586) [-428.670] (-428.262) (-432.877) -- 0:00:53
Average standard deviation of split frequencies: 0.021378
85500 -- (-429.398) (-430.896) (-430.429) [-427.621] * (-433.132) (-433.364) (-431.306) [-431.853] -- 0:00:53
86000 -- (-429.598) (-431.140) (-429.605) [-430.738] * (-430.107) (-428.930) (-431.362) [-429.190] -- 0:00:53
86500 -- (-432.902) (-437.336) (-431.933) [-428.679] * (-430.696) (-430.026) [-429.408] (-430.093) -- 0:00:52
87000 -- (-430.175) (-429.351) (-428.982) [-428.933] * [-428.504] (-432.592) (-432.776) (-429.067) -- 0:00:52
87500 -- [-428.488] (-427.865) (-428.717) (-434.514) * (-429.629) (-432.403) [-430.256] (-427.399) -- 0:00:52
88000 -- (-431.482) (-428.196) (-431.193) [-429.687] * [-429.405] (-428.836) (-429.110) (-429.474) -- 0:00:51
88500 -- (-434.077) (-427.551) (-428.503) [-429.288] * (-429.719) (-432.791) [-428.995] (-428.275) -- 0:00:51
89000 -- (-429.288) (-431.406) (-429.097) [-431.451] * (-433.563) [-432.331] (-428.324) (-427.995) -- 0:00:51
89500 -- (-427.954) (-432.170) [-431.727] (-431.691) * [-430.076] (-433.778) (-429.814) (-428.811) -- 0:00:50
90000 -- (-432.385) (-427.832) (-428.768) [-428.754] * [-428.228] (-434.030) (-431.888) (-427.447) -- 0:00:50
Average standard deviation of split frequencies: 0.020797
90500 -- (-431.781) (-428.225) (-433.558) [-429.521] * (-429.387) (-433.208) [-429.279] (-435.309) -- 0:00:50
91000 -- [-430.532] (-434.035) (-427.754) (-428.627) * (-430.257) (-432.667) [-429.548] (-430.268) -- 0:00:49
91500 -- (-430.333) (-430.791) [-430.187] (-429.598) * (-427.977) [-431.896] (-429.330) (-427.568) -- 0:00:49
92000 -- (-429.774) (-427.567) (-429.367) [-429.555] * (-429.032) [-429.341] (-429.144) (-431.441) -- 0:00:49
92500 -- (-432.250) [-429.853] (-431.577) (-432.121) * (-428.406) (-428.708) [-427.489] (-432.774) -- 0:00:49
93000 -- [-429.371] (-431.908) (-430.954) (-427.787) * (-430.827) [-429.546] (-429.118) (-435.892) -- 0:00:48
93500 -- (-432.035) (-429.491) [-427.603] (-429.299) * [-428.113] (-429.352) (-427.509) (-432.022) -- 0:00:48
94000 -- (-431.180) (-429.546) [-427.644] (-429.431) * (-429.400) (-430.233) [-427.768] (-428.755) -- 0:00:48
94500 -- (-429.550) (-432.061) (-430.256) [-427.582] * (-427.796) (-431.867) (-427.312) [-429.027] -- 0:00:57
95000 -- [-428.253] (-430.083) (-430.069) (-431.872) * (-427.907) (-431.524) (-428.834) [-429.651] -- 0:00:57
Average standard deviation of split frequencies: 0.014977
95500 -- (-433.425) [-429.213] (-429.219) (-430.749) * (-428.693) (-428.170) [-428.514] (-428.474) -- 0:00:56
96000 -- [-429.825] (-429.346) (-430.909) (-430.497) * (-430.155) (-428.479) (-433.812) [-429.070] -- 0:00:56
96500 -- (-429.673) (-431.901) [-429.545] (-430.579) * [-429.575] (-432.622) (-428.631) (-430.796) -- 0:00:56
97000 -- (-428.146) (-429.976) (-427.956) [-429.232] * (-430.594) (-429.505) (-430.331) [-428.210] -- 0:00:55
97500 -- (-428.144) (-432.104) [-427.895] (-429.195) * (-428.440) (-427.846) (-428.771) [-428.718] -- 0:00:55
98000 -- [-428.810] (-436.185) (-429.214) (-429.181) * (-429.845) (-429.262) [-429.732] (-429.293) -- 0:00:55
98500 -- [-429.415] (-431.596) (-429.124) (-428.314) * (-429.929) (-429.015) [-429.967] (-430.223) -- 0:00:54
99000 -- (-430.146) (-429.246) (-429.673) [-432.076] * [-431.322] (-429.395) (-430.073) (-433.621) -- 0:00:54
99500 -- (-429.506) (-429.723) [-428.000] (-432.318) * (-435.831) (-428.409) (-433.849) [-429.580] -- 0:00:54
100000 -- (-427.732) (-431.327) (-430.220) [-429.585] * [-428.414] (-430.139) (-432.555) (-430.613) -- 0:00:54
Average standard deviation of split frequencies: 0.014048
100500 -- (-428.847) [-429.003] (-430.310) (-430.482) * [-429.011] (-430.175) (-432.303) (-434.753) -- 0:00:53
101000 -- (-427.831) [-431.670] (-429.225) (-428.779) * (-427.681) (-431.148) [-429.057] (-429.542) -- 0:00:53
101500 -- (-428.003) [-427.528] (-435.978) (-428.050) * (-432.431) (-428.245) [-435.060] (-428.557) -- 0:00:53
102000 -- (-435.911) (-428.485) (-428.781) [-428.254] * (-430.472) (-429.383) [-428.580] (-430.044) -- 0:00:52
102500 -- [-431.475] (-427.814) (-427.831) (-427.567) * [-427.395] (-438.216) (-427.888) (-429.106) -- 0:00:52
103000 -- (-430.849) (-430.671) (-429.233) [-428.492] * (-430.226) (-434.696) [-428.662] (-430.417) -- 0:00:52
103500 -- [-428.490] (-429.961) (-429.504) (-432.083) * (-429.112) (-434.277) [-428.206] (-431.999) -- 0:00:51
104000 -- (-429.490) (-428.915) (-433.709) [-432.958] * [-432.486] (-432.215) (-429.232) (-431.600) -- 0:00:51
104500 -- (-428.853) [-431.112] (-431.561) (-431.275) * [-431.542] (-432.147) (-430.720) (-432.777) -- 0:00:51
105000 -- (-429.081) (-429.373) [-429.511] (-431.603) * (-429.130) (-428.098) (-430.247) [-428.192] -- 0:00:51
Average standard deviation of split frequencies: 0.012675
105500 -- (-427.534) (-433.128) (-429.991) [-431.502] * (-430.496) (-428.979) [-430.855] (-430.167) -- 0:00:50
106000 -- [-427.684] (-429.030) (-431.775) (-433.237) * (-432.225) [-428.937] (-429.260) (-432.475) -- 0:00:50
106500 -- [-428.399] (-431.881) (-430.394) (-429.490) * (-430.098) (-427.719) [-430.407] (-431.244) -- 0:00:50
107000 -- (-428.410) (-431.529) [-429.371] (-431.771) * (-429.832) [-428.037] (-429.306) (-428.897) -- 0:00:50
107500 -- (-429.226) (-429.297) [-431.305] (-432.403) * [-430.902] (-432.380) (-427.336) (-431.468) -- 0:00:49
108000 -- (-429.407) (-428.910) [-432.681] (-428.911) * [-428.180] (-430.824) (-429.110) (-431.652) -- 0:00:49
108500 -- (-428.528) [-429.371] (-429.049) (-428.184) * (-430.503) [-428.440] (-430.920) (-433.214) -- 0:00:49
109000 -- (-427.740) (-428.901) (-428.754) [-432.970] * [-429.147] (-431.870) (-432.524) (-432.589) -- 0:00:49
109500 -- (-427.393) (-430.413) [-429.443] (-429.874) * [-428.090] (-429.091) (-428.310) (-429.037) -- 0:00:48
110000 -- (-429.869) (-431.686) (-428.416) [-430.786] * (-429.117) (-428.722) [-429.349] (-430.477) -- 0:00:56
Average standard deviation of split frequencies: 0.013227
110500 -- (-427.402) (-428.162) [-429.093] (-431.963) * [-432.776] (-427.501) (-428.709) (-430.084) -- 0:00:56
111000 -- [-427.977] (-432.133) (-431.322) (-430.317) * (-431.738) (-429.000) (-427.842) [-430.692] -- 0:00:56
111500 -- (-429.473) [-429.242] (-428.784) (-434.468) * [-427.672] (-431.601) (-428.878) (-434.003) -- 0:00:55
112000 -- (-428.006) (-429.759) [-428.808] (-430.369) * [-427.193] (-431.997) (-429.002) (-428.306) -- 0:00:55
112500 -- (-428.040) (-428.684) [-429.284] (-429.199) * (-427.959) [-429.234] (-428.513) (-428.451) -- 0:00:55
113000 -- (-430.972) (-429.432) [-428.159] (-431.182) * (-429.011) [-428.257] (-428.993) (-430.153) -- 0:00:54
113500 -- (-430.057) (-428.211) (-430.652) [-427.926] * (-429.328) (-428.029) (-428.518) [-428.193] -- 0:00:54
114000 -- (-428.756) (-428.806) [-428.502] (-429.376) * (-430.132) [-428.136] (-430.108) (-428.227) -- 0:00:54
114500 -- (-428.476) (-431.651) (-430.564) [-429.651] * (-431.333) (-433.296) (-432.145) [-431.137] -- 0:00:54
115000 -- (-431.798) (-432.119) (-433.441) [-430.235] * (-432.022) (-430.878) [-429.394] (-429.880) -- 0:00:53
Average standard deviation of split frequencies: 0.015804
115500 -- (-428.971) (-433.442) (-431.358) [-427.789] * (-430.936) (-427.782) [-428.567] (-434.638) -- 0:00:53
116000 -- (-428.726) (-433.421) [-428.966] (-428.741) * (-427.983) [-429.232] (-430.108) (-430.472) -- 0:00:53
116500 -- (-428.513) (-428.646) [-431.348] (-427.676) * (-427.809) [-431.396] (-428.617) (-431.145) -- 0:00:53
117000 -- (-432.290) (-427.833) (-432.438) [-430.664] * (-429.772) (-432.416) [-430.733] (-429.807) -- 0:00:52
117500 -- (-428.018) (-429.702) [-428.606] (-431.084) * (-428.619) [-430.270] (-427.981) (-430.418) -- 0:00:52
118000 -- [-427.986] (-430.607) (-428.958) (-430.817) * (-429.899) [-428.028] (-429.470) (-431.877) -- 0:00:52
118500 -- (-427.893) (-427.210) [-427.780] (-431.214) * (-433.079) (-429.965) (-432.407) [-429.174] -- 0:00:52
119000 -- (-431.486) (-429.837) (-436.413) [-429.578] * (-428.223) (-429.444) (-430.664) [-429.371] -- 0:00:51
119500 -- (-429.154) (-432.078) [-432.431] (-427.512) * [-433.648] (-430.448) (-432.979) (-428.966) -- 0:00:51
120000 -- (-430.006) (-430.270) (-429.900) [-428.034] * [-429.174] (-434.166) (-434.264) (-431.850) -- 0:00:51
Average standard deviation of split frequencies: 0.012131
120500 -- (-430.157) (-430.502) (-428.289) [-429.248] * (-427.685) [-431.640] (-429.781) (-429.402) -- 0:00:51
121000 -- (-428.314) (-429.179) (-430.209) [-428.353] * (-429.228) [-429.373] (-431.078) (-429.604) -- 0:00:50
121500 -- (-430.708) (-428.511) [-428.052] (-432.161) * (-428.715) [-430.255] (-429.276) (-429.336) -- 0:00:50
122000 -- (-429.121) (-428.827) [-427.682] (-431.769) * (-429.164) [-429.803] (-434.603) (-430.363) -- 0:00:50
122500 -- (-428.901) (-428.041) [-428.277] (-429.513) * (-428.894) (-432.903) [-432.913] (-429.948) -- 0:00:50
123000 -- (-429.466) (-428.034) (-428.996) [-429.797] * (-433.059) (-429.541) (-431.563) [-429.003] -- 0:00:49
123500 -- (-430.921) (-428.861) (-429.102) [-428.575] * (-434.955) [-428.860] (-430.434) (-429.560) -- 0:00:49
124000 -- (-430.999) (-432.054) [-429.647] (-429.124) * (-431.491) [-429.154] (-429.158) (-430.018) -- 0:00:49
124500 -- [-428.388] (-427.571) (-429.881) (-428.796) * (-430.218) (-427.640) (-427.873) [-430.662] -- 0:00:49
125000 -- [-428.987] (-430.359) (-428.932) (-433.196) * (-430.680) [-428.499] (-428.935) (-430.058) -- 0:00:49
Average standard deviation of split frequencies: 0.013390
125500 -- [-428.413] (-429.472) (-428.055) (-430.996) * (-434.887) [-429.872] (-427.348) (-428.725) -- 0:00:48
126000 -- (-428.944) [-427.601] (-429.555) (-430.916) * (-433.552) (-427.940) [-427.554] (-428.478) -- 0:00:48
126500 -- [-427.304] (-430.320) (-431.109) (-429.117) * [-429.060] (-429.382) (-430.407) (-428.360) -- 0:00:55
127000 -- (-428.724) [-427.971] (-429.354) (-433.531) * (-433.051) [-430.050] (-428.461) (-428.963) -- 0:00:54
127500 -- [-428.340] (-427.461) (-430.483) (-432.674) * (-429.520) (-432.105) (-430.740) [-429.294] -- 0:00:54
128000 -- (-434.387) (-428.995) (-430.893) [-432.612] * (-428.757) (-430.057) [-427.884] (-429.256) -- 0:00:54
128500 -- [-430.244] (-428.895) (-431.410) (-428.220) * (-428.812) (-432.131) (-427.831) [-429.657] -- 0:00:54
129000 -- (-431.610) [-430.857] (-428.908) (-431.434) * (-431.722) (-428.547) [-427.666] (-429.182) -- 0:00:54
129500 -- (-429.240) [-430.982] (-429.870) (-431.248) * (-432.645) [-429.222] (-430.029) (-428.389) -- 0:00:53
130000 -- [-430.052] (-429.588) (-427.669) (-430.108) * (-429.454) (-431.990) [-429.621] (-427.850) -- 0:00:53
Average standard deviation of split frequencies: 0.015633
130500 -- [-428.813] (-436.654) (-430.190) (-427.920) * [-427.754] (-428.713) (-428.364) (-429.240) -- 0:00:53
131000 -- [-429.813] (-431.080) (-433.677) (-429.811) * (-427.796) (-428.765) [-427.728] (-427.951) -- 0:00:53
131500 -- (-427.734) (-428.966) [-432.886] (-429.718) * (-429.432) (-427.712) (-428.558) [-427.689] -- 0:00:52
132000 -- [-428.799] (-428.630) (-431.036) (-433.940) * (-430.470) (-431.028) (-429.732) [-430.191] -- 0:00:52
132500 -- (-432.019) (-429.923) (-430.956) [-430.343] * (-429.277) [-427.703] (-427.847) (-432.198) -- 0:00:52
133000 -- [-431.404] (-429.693) (-430.620) (-428.729) * (-429.398) [-427.308] (-428.135) (-430.211) -- 0:00:52
133500 -- [-429.790] (-428.342) (-429.554) (-433.312) * [-431.057] (-427.640) (-432.163) (-429.721) -- 0:00:51
134000 -- (-431.440) [-428.687] (-436.362) (-428.734) * [-429.857] (-430.078) (-436.693) (-433.417) -- 0:00:51
134500 -- (-429.343) (-427.504) (-431.232) [-429.350] * (-434.997) [-429.451] (-429.046) (-430.375) -- 0:00:51
135000 -- (-428.825) [-431.930] (-434.195) (-429.636) * (-434.858) (-430.466) [-429.740] (-432.362) -- 0:00:51
Average standard deviation of split frequencies: 0.014828
135500 -- (-428.962) [-434.537] (-429.871) (-430.203) * (-430.001) [-428.279] (-429.863) (-430.457) -- 0:00:51
136000 -- (-429.961) (-428.532) [-427.912] (-428.975) * (-429.723) (-430.074) [-430.069] (-432.538) -- 0:00:50
136500 -- (-431.302) (-429.752) [-428.734] (-430.699) * (-431.291) [-427.572] (-427.559) (-430.705) -- 0:00:50
137000 -- [-429.837] (-430.225) (-428.524) (-434.155) * (-430.328) (-431.055) (-429.225) [-431.089] -- 0:00:50
137500 -- [-428.368] (-429.451) (-431.635) (-431.890) * (-429.136) [-428.498] (-431.735) (-428.703) -- 0:00:50
138000 -- (-428.999) (-430.767) (-431.878) [-429.663] * (-430.553) [-428.294] (-433.204) (-428.247) -- 0:00:49
138500 -- [-430.003] (-428.396) (-430.301) (-430.848) * (-431.296) [-427.733] (-430.843) (-431.918) -- 0:00:49
139000 -- [-429.702] (-427.884) (-428.717) (-429.287) * (-429.521) [-427.474] (-428.169) (-429.316) -- 0:00:49
139500 -- (-430.495) (-429.356) [-433.311] (-428.924) * (-431.263) [-428.481] (-428.091) (-429.847) -- 0:00:49
140000 -- (-429.682) [-429.364] (-428.374) (-428.416) * (-428.865) [-430.505] (-429.796) (-433.701) -- 0:00:49
Average standard deviation of split frequencies: 0.014336
140500 -- (-430.407) [-429.167] (-429.100) (-428.512) * (-431.474) (-431.108) (-428.379) [-431.507] -- 0:00:48
141000 -- [-429.188] (-430.180) (-428.288) (-428.290) * [-429.703] (-428.815) (-430.000) (-428.682) -- 0:00:48
141500 -- (-430.800) (-428.069) (-435.140) [-429.227] * (-429.500) (-429.997) (-433.586) [-429.860] -- 0:00:48
142000 -- (-429.930) [-427.585] (-429.369) (-427.702) * (-437.800) (-430.178) [-429.852] (-428.581) -- 0:00:48
142500 -- [-430.843] (-428.233) (-427.741) (-429.833) * [-430.178] (-429.713) (-432.752) (-429.605) -- 0:00:54
143000 -- (-428.943) [-428.526] (-427.948) (-429.494) * [-431.277] (-429.073) (-437.684) (-428.597) -- 0:00:53
143500 -- (-429.036) (-428.283) [-432.882] (-429.911) * (-432.365) (-429.156) (-430.816) [-434.356] -- 0:00:53
144000 -- (-430.504) (-428.036) [-429.384] (-427.958) * (-427.765) (-428.684) (-433.775) [-432.853] -- 0:00:53
144500 -- [-429.924] (-427.424) (-430.780) (-428.260) * [-428.599] (-428.346) (-431.023) (-432.124) -- 0:00:53
145000 -- [-427.923] (-427.896) (-430.535) (-432.075) * (-428.699) (-428.639) [-430.920] (-429.593) -- 0:00:53
Average standard deviation of split frequencies: 0.012736
145500 -- (-427.918) (-428.111) [-428.479] (-433.336) * (-428.426) (-435.331) (-430.081) [-427.487] -- 0:00:52
146000 -- (-431.207) [-427.196] (-429.766) (-432.447) * [-427.551] (-428.219) (-432.448) (-429.362) -- 0:00:52
146500 -- (-428.127) (-431.447) [-430.469] (-429.940) * (-430.969) (-429.475) [-432.734] (-432.648) -- 0:00:52
147000 -- (-427.667) [-428.988] (-429.754) (-428.598) * (-428.206) (-427.842) [-431.604] (-429.444) -- 0:00:52
147500 -- [-427.541] (-429.181) (-428.745) (-428.044) * (-430.745) [-428.180] (-429.182) (-430.111) -- 0:00:52
148000 -- (-427.809) (-433.866) [-429.253] (-429.117) * (-428.608) (-427.338) [-428.115] (-430.769) -- 0:00:51
148500 -- (-435.206) [-430.351] (-428.385) (-432.487) * (-428.987) (-428.822) (-432.512) [-431.716] -- 0:00:51
149000 -- [-433.927] (-436.889) (-431.216) (-434.301) * [-428.287] (-432.648) (-431.965) (-428.085) -- 0:00:51
149500 -- [-429.396] (-430.440) (-430.101) (-429.196) * (-429.694) [-429.098] (-429.973) (-427.747) -- 0:00:51
150000 -- (-428.161) (-430.677) [-429.456] (-429.688) * (-429.251) (-430.973) [-435.286] (-428.613) -- 0:00:51
Average standard deviation of split frequencies: 0.012699
150500 -- (-429.078) (-428.917) (-430.123) [-428.293] * (-432.054) (-431.449) [-433.930] (-433.074) -- 0:00:50
151000 -- (-433.274) (-430.902) (-430.414) [-427.901] * (-432.355) (-427.802) [-430.265] (-428.412) -- 0:00:50
151500 -- (-432.207) (-432.736) [-428.377] (-428.555) * [-428.671] (-430.271) (-428.457) (-431.434) -- 0:00:50
152000 -- (-429.281) (-431.735) (-431.386) [-429.207] * (-428.225) (-428.989) (-428.981) [-429.479] -- 0:00:50
152500 -- [-428.704] (-432.734) (-428.388) (-431.174) * [-429.182] (-432.528) (-427.750) (-432.176) -- 0:00:50
153000 -- (-434.304) (-430.616) [-428.886] (-428.632) * (-427.990) [-427.811] (-431.558) (-428.348) -- 0:00:49
153500 -- (-431.999) (-428.972) (-429.664) [-429.165] * (-428.228) [-429.940] (-429.666) (-428.365) -- 0:00:49
154000 -- (-432.402) [-430.091] (-430.030) (-429.481) * (-429.772) (-428.848) [-429.102] (-434.702) -- 0:00:49
154500 -- (-428.701) [-431.697] (-429.120) (-431.584) * (-429.610) (-431.986) [-428.018] (-428.261) -- 0:00:49
155000 -- (-433.143) (-431.306) (-427.458) [-431.867] * (-428.879) [-431.685] (-428.342) (-433.052) -- 0:00:49
Average standard deviation of split frequencies: 0.013598
155500 -- [-429.602] (-427.846) (-430.323) (-433.684) * (-429.892) [-428.523] (-430.455) (-431.160) -- 0:00:48
156000 -- (-430.413) (-432.020) (-430.385) [-428.489] * (-429.365) (-428.163) [-429.380] (-428.969) -- 0:00:48
156500 -- (-429.523) [-428.532] (-432.837) (-429.425) * (-429.426) (-431.397) [-430.010] (-429.519) -- 0:00:48
157000 -- (-427.549) (-432.669) [-429.525] (-427.905) * (-430.033) (-431.953) (-429.395) [-430.733] -- 0:00:48
157500 -- (-429.680) (-429.425) [-430.490] (-429.965) * [-429.112] (-434.512) (-431.964) (-427.942) -- 0:00:48
158000 -- (-434.932) (-429.498) (-430.106) [-428.557] * [-429.865] (-435.288) (-428.189) (-427.283) -- 0:00:47
158500 -- [-430.151] (-431.581) (-431.088) (-427.845) * [-428.949] (-431.230) (-428.554) (-427.774) -- 0:00:53
159000 -- [-427.919] (-428.799) (-429.133) (-428.625) * (-428.720) (-434.164) [-429.866] (-428.303) -- 0:00:52
159500 -- (-431.876) (-431.870) [-429.035] (-429.400) * (-432.949) (-430.720) [-430.586] (-430.161) -- 0:00:52
160000 -- [-428.070] (-428.077) (-428.838) (-428.955) * (-428.590) [-428.950] (-431.287) (-429.004) -- 0:00:52
Average standard deviation of split frequencies: 0.014670
160500 -- (-430.348) (-430.944) (-430.229) [-428.437] * (-435.067) (-428.730) (-427.710) [-434.042] -- 0:00:52
161000 -- (-430.456) (-427.374) (-428.736) [-429.888] * (-437.891) (-429.301) [-428.331] (-431.098) -- 0:00:52
161500 -- (-428.684) (-428.515) (-429.022) [-430.087] * [-429.817] (-428.576) (-428.965) (-430.321) -- 0:00:51
162000 -- [-428.884] (-429.405) (-432.620) (-429.703) * (-427.939) (-429.263) [-428.936] (-431.323) -- 0:00:51
162500 -- (-428.790) [-431.508] (-430.551) (-427.698) * [-427.617] (-432.745) (-429.279) (-431.592) -- 0:00:51
163000 -- (-428.098) [-436.684] (-429.369) (-428.480) * (-427.702) (-430.239) [-429.140] (-429.107) -- 0:00:51
163500 -- (-428.340) (-431.505) [-430.570] (-429.958) * [-427.855] (-428.745) (-430.527) (-429.295) -- 0:00:51
164000 -- (-430.490) (-428.846) [-430.952] (-429.701) * [-429.707] (-435.806) (-427.524) (-429.846) -- 0:00:50
164500 -- [-428.725] (-428.784) (-431.579) (-430.818) * (-428.902) (-433.841) (-431.525) [-429.341] -- 0:00:50
165000 -- (-431.582) (-430.275) (-429.099) [-428.719] * (-428.054) (-428.789) [-429.501] (-432.945) -- 0:00:50
Average standard deviation of split frequencies: 0.013568
165500 -- [-428.094] (-433.059) (-431.800) (-428.540) * (-427.710) (-429.937) (-428.084) [-428.891] -- 0:00:50
166000 -- [-429.932] (-431.933) (-431.299) (-429.769) * (-431.637) (-429.073) [-428.875] (-429.247) -- 0:00:50
166500 -- [-428.070] (-430.676) (-432.255) (-427.319) * (-428.986) (-427.978) [-430.772] (-428.629) -- 0:00:50
167000 -- [-432.376] (-430.648) (-433.893) (-427.569) * (-428.603) (-428.043) (-429.250) [-429.099] -- 0:00:49
167500 -- (-430.278) (-431.689) (-430.691) [-428.290] * (-430.844) (-428.877) [-429.079] (-429.596) -- 0:00:49
168000 -- (-428.996) (-429.737) (-428.082) [-429.121] * (-433.080) (-427.830) [-428.064] (-428.726) -- 0:00:49
168500 -- [-429.195] (-429.676) (-431.113) (-429.319) * [-429.879] (-435.729) (-430.781) (-428.751) -- 0:00:49
169000 -- (-428.875) (-430.256) (-427.815) [-429.511] * (-428.770) (-427.795) (-429.154) [-429.306] -- 0:00:49
169500 -- (-429.469) (-428.515) (-428.670) [-427.775] * [-429.988] (-431.065) (-429.913) (-428.039) -- 0:00:48
170000 -- [-431.078] (-429.077) (-428.310) (-427.563) * (-427.968) (-429.722) (-430.234) [-429.671] -- 0:00:48
Average standard deviation of split frequencies: 0.012583
170500 -- (-429.155) (-430.758) (-430.047) [-428.079] * (-429.778) [-428.881] (-428.001) (-432.154) -- 0:00:48
171000 -- (-430.332) [-430.666] (-429.708) (-430.299) * (-428.418) [-431.036] (-429.336) (-429.741) -- 0:00:48
171500 -- [-428.311] (-429.598) (-430.339) (-431.483) * (-430.867) [-429.596] (-429.134) (-430.291) -- 0:00:48
172000 -- (-432.864) [-429.546] (-428.143) (-430.251) * (-429.071) [-428.312] (-429.904) (-428.540) -- 0:00:48
172500 -- (-436.075) [-427.397] (-432.014) (-429.047) * (-430.825) (-427.994) (-428.715) [-430.969] -- 0:00:47
173000 -- (-431.143) (-428.416) [-428.802] (-430.048) * (-431.891) (-428.169) (-427.949) [-428.283] -- 0:00:47
173500 -- (-429.168) [-429.161] (-428.948) (-429.109) * (-429.388) (-430.897) (-428.069) [-428.658] -- 0:00:47
174000 -- [-428.606] (-429.017) (-429.101) (-427.700) * (-431.981) [-429.496] (-427.624) (-428.301) -- 0:00:47
174500 -- (-427.451) (-430.461) (-432.115) [-427.284] * [-427.697] (-429.979) (-429.577) (-428.097) -- 0:00:47
175000 -- [-429.282] (-431.661) (-428.560) (-428.665) * [-429.530] (-428.659) (-428.453) (-429.460) -- 0:00:51
Average standard deviation of split frequencies: 0.012687
175500 -- (-429.354) [-431.661] (-432.339) (-430.577) * (-428.963) (-430.058) (-428.833) [-433.140] -- 0:00:51
176000 -- (-435.165) [-428.390] (-429.573) (-429.153) * [-429.297] (-429.405) (-431.027) (-430.551) -- 0:00:51
176500 -- (-430.837) [-428.491] (-430.470) (-428.522) * (-427.573) (-427.864) [-429.265] (-428.067) -- 0:00:51
177000 -- [-429.262] (-429.287) (-431.209) (-431.277) * (-428.821) (-429.005) (-428.328) [-431.194] -- 0:00:51
177500 -- [-429.995] (-432.994) (-428.607) (-430.828) * (-430.969) (-429.665) [-428.499] (-430.097) -- 0:00:50
178000 -- (-430.448) (-429.920) (-428.394) [-430.031] * (-429.878) (-432.400) (-429.338) [-429.257] -- 0:00:50
178500 -- (-428.848) [-430.762] (-431.971) (-430.922) * (-430.119) (-429.373) (-430.192) [-429.137] -- 0:00:50
179000 -- (-432.669) (-430.579) (-430.711) [-428.152] * (-432.394) (-430.649) (-429.601) [-432.641] -- 0:00:50
179500 -- (-429.592) [-430.309] (-427.804) (-428.792) * (-429.005) (-430.006) (-428.814) [-433.072] -- 0:00:50
180000 -- (-428.638) (-431.987) (-428.129) [-431.857] * [-429.857] (-429.155) (-430.321) (-429.702) -- 0:00:50
Average standard deviation of split frequencies: 0.013507
180500 -- (-434.246) (-429.569) (-428.714) [-430.121] * (-430.504) (-431.046) (-431.842) [-429.861] -- 0:00:49
181000 -- [-427.755] (-432.354) (-432.842) (-428.965) * (-429.849) [-429.206] (-431.187) (-430.713) -- 0:00:49
181500 -- (-432.406) (-428.981) [-431.512] (-427.839) * [-431.970] (-430.305) (-428.780) (-431.090) -- 0:00:49
182000 -- (-428.215) (-431.415) (-433.050) [-428.413] * [-429.822] (-431.014) (-432.314) (-430.655) -- 0:00:49
182500 -- (-432.414) (-429.605) (-428.210) [-432.367] * (-432.908) (-429.791) (-430.839) [-428.676] -- 0:00:49
183000 -- (-429.142) (-428.945) (-430.276) [-429.462] * (-427.973) (-427.795) [-431.189] (-427.588) -- 0:00:49
183500 -- [-428.938] (-428.256) (-429.521) (-429.516) * (-427.618) (-429.430) [-429.169] (-430.549) -- 0:00:48
184000 -- (-428.749) (-428.816) [-429.634] (-430.137) * (-430.998) (-431.592) (-427.831) [-428.367] -- 0:00:48
184500 -- (-429.338) (-430.577) [-429.748] (-428.263) * (-428.223) [-428.749] (-429.572) (-430.403) -- 0:00:48
185000 -- [-428.479] (-431.641) (-427.893) (-431.536) * (-428.730) [-428.215] (-428.726) (-432.182) -- 0:00:48
Average standard deviation of split frequencies: 0.013873
185500 -- (-433.748) (-430.520) (-429.733) [-429.159] * (-428.470) [-428.818] (-428.751) (-430.951) -- 0:00:48
186000 -- [-430.186] (-427.449) (-429.411) (-427.901) * (-428.375) [-428.870] (-428.709) (-427.839) -- 0:00:48
186500 -- (-432.290) (-430.084) (-429.811) [-429.216] * (-431.265) (-429.578) (-432.769) [-429.665] -- 0:00:47
187000 -- (-429.833) (-430.286) (-429.602) [-428.644] * (-428.014) [-427.714] (-430.301) (-428.024) -- 0:00:47
187500 -- (-429.316) (-430.429) [-428.840] (-430.173) * [-428.530] (-432.633) (-429.485) (-429.511) -- 0:00:47
188000 -- [-427.379] (-427.760) (-427.640) (-430.679) * [-428.472] (-428.598) (-429.957) (-430.274) -- 0:00:47
188500 -- (-429.853) (-431.592) (-428.445) [-428.572] * (-428.540) (-429.643) (-430.143) [-431.214] -- 0:00:47
189000 -- (-429.499) (-439.528) (-428.859) [-428.110] * [-429.793] (-428.134) (-430.129) (-430.055) -- 0:00:47
189500 -- [-427.852] (-436.857) (-429.955) (-432.682) * [-428.224] (-427.750) (-428.510) (-427.766) -- 0:00:47
190000 -- (-434.977) [-429.420] (-430.219) (-438.267) * [-428.681] (-430.658) (-431.445) (-429.806) -- 0:00:46
Average standard deviation of split frequencies: 0.013049
190500 -- [-428.656] (-428.187) (-428.212) (-430.678) * (-428.810) (-430.788) [-432.244] (-430.266) -- 0:00:50
191000 -- (-430.792) (-431.978) [-430.879] (-428.525) * (-431.159) [-429.154] (-429.584) (-428.047) -- 0:00:50
191500 -- (-432.403) [-428.585] (-428.616) (-428.129) * (-429.537) (-429.985) [-430.159] (-428.212) -- 0:00:50
192000 -- [-430.743] (-432.310) (-431.782) (-429.659) * (-429.459) [-430.116] (-427.991) (-429.051) -- 0:00:50
192500 -- (-438.345) [-428.155] (-431.303) (-428.642) * (-427.834) (-428.075) (-427.617) [-430.698] -- 0:00:50
193000 -- (-428.707) [-431.075] (-428.369) (-434.243) * (-431.437) (-430.484) [-431.042] (-430.112) -- 0:00:50
193500 -- (-429.960) (-433.985) [-427.563] (-432.249) * [-428.682] (-432.142) (-431.497) (-428.034) -- 0:00:50
194000 -- [-430.091] (-430.003) (-429.406) (-427.780) * [-428.725] (-428.901) (-431.237) (-429.847) -- 0:00:49
194500 -- (-430.615) (-428.160) [-430.781] (-432.269) * (-428.375) (-427.462) [-428.116] (-430.840) -- 0:00:49
195000 -- (-429.520) (-429.703) [-428.850] (-430.955) * (-428.445) (-427.578) [-428.239] (-428.469) -- 0:00:49
Average standard deviation of split frequencies: 0.013299
195500 -- (-429.382) [-429.105] (-428.730) (-428.254) * (-427.946) [-430.139] (-428.339) (-429.249) -- 0:00:49
196000 -- (-428.442) (-428.595) [-431.184] (-428.875) * (-431.181) (-431.697) [-430.934] (-428.275) -- 0:00:49
196500 -- (-428.431) (-432.717) (-430.723) [-428.517] * (-428.633) (-429.846) [-429.080] (-429.700) -- 0:00:49
197000 -- (-433.813) (-430.159) [-429.941] (-430.443) * (-430.832) (-428.358) (-427.703) [-429.052] -- 0:00:48
197500 -- (-429.555) (-430.294) (-427.917) [-429.057] * (-429.201) (-428.830) [-429.985] (-427.589) -- 0:00:48
198000 -- [-428.551] (-436.970) (-429.494) (-432.885) * (-428.241) (-430.157) (-428.227) [-427.292] -- 0:00:48
198500 -- (-429.193) (-429.177) (-429.058) [-428.973] * (-434.851) (-432.196) [-430.463] (-429.527) -- 0:00:48
199000 -- (-427.727) [-428.390] (-427.624) (-427.899) * (-432.591) (-431.719) (-428.532) [-430.671] -- 0:00:48
199500 -- (-429.389) (-430.410) (-428.452) [-431.670] * (-429.089) [-428.047] (-431.893) (-430.973) -- 0:00:48
200000 -- (-428.213) (-430.213) [-427.531] (-430.783) * (-429.386) (-427.563) [-431.164] (-428.350) -- 0:00:48
Average standard deviation of split frequencies: 0.013508
200500 -- (-430.508) (-431.630) [-429.207] (-432.736) * (-433.671) (-428.254) [-429.406] (-429.934) -- 0:00:47
201000 -- (-429.775) (-431.534) [-428.143] (-431.797) * (-430.652) (-429.986) [-429.178] (-428.445) -- 0:00:47
201500 -- (-429.895) (-430.655) [-427.826] (-428.770) * (-427.904) (-429.644) (-427.773) [-428.363] -- 0:00:47
202000 -- [-428.922] (-430.117) (-431.566) (-429.859) * (-428.899) (-432.553) [-428.658] (-428.405) -- 0:00:47
202500 -- (-429.917) (-427.920) (-428.006) [-427.793] * [-430.130] (-428.393) (-429.920) (-430.200) -- 0:00:47
203000 -- (-435.124) [-431.577] (-430.150) (-428.442) * (-431.282) (-431.151) [-429.187] (-429.681) -- 0:00:47
203500 -- [-431.258] (-434.047) (-429.956) (-429.326) * (-429.549) (-428.823) [-429.027] (-428.866) -- 0:00:46
204000 -- [-429.491] (-429.950) (-431.519) (-429.400) * (-434.988) [-430.446] (-430.611) (-429.581) -- 0:00:46
204500 -- (-429.840) (-429.240) (-431.349) [-431.657] * (-428.568) (-428.800) [-430.452] (-428.529) -- 0:00:46
205000 -- [-428.773] (-428.215) (-430.255) (-430.537) * (-430.048) (-427.557) (-431.317) [-431.176] -- 0:00:46
Average standard deviation of split frequencies: 0.012788
205500 -- (-430.515) (-430.544) [-429.061] (-430.099) * (-429.043) [-427.760] (-429.695) (-432.191) -- 0:00:46
206000 -- (-429.649) [-429.495] (-427.997) (-428.320) * [-429.157] (-429.072) (-428.732) (-430.009) -- 0:00:46
206500 -- (-431.115) (-430.433) [-427.920] (-430.951) * (-433.322) (-429.071) (-433.828) [-430.326] -- 0:00:46
207000 -- (-428.010) (-431.372) (-428.189) [-431.097] * (-431.373) (-429.297) [-430.947] (-433.406) -- 0:00:49
207500 -- [-429.295] (-429.344) (-428.690) (-429.443) * (-429.241) (-428.432) (-430.029) [-428.667] -- 0:00:49
208000 -- (-430.321) (-428.074) (-428.974) [-427.836] * (-429.209) [-429.028] (-430.180) (-430.090) -- 0:00:49
208500 -- [-429.219] (-429.854) (-428.614) (-429.791) * (-428.320) [-429.718] (-429.790) (-430.223) -- 0:00:49
209000 -- (-429.377) [-429.040] (-431.832) (-431.483) * (-430.486) [-428.517] (-430.678) (-430.919) -- 0:00:49
209500 -- (-429.649) (-428.562) (-431.532) [-427.755] * (-430.594) (-428.140) [-430.250] (-429.191) -- 0:00:49
210000 -- [-427.483] (-430.933) (-434.756) (-429.034) * (-433.380) (-429.874) [-428.966] (-430.800) -- 0:00:48
Average standard deviation of split frequencies: 0.013846
210500 -- (-427.456) [-433.392] (-431.291) (-430.456) * (-430.261) (-429.011) [-428.290] (-431.774) -- 0:00:48
211000 -- (-431.702) [-429.045] (-431.293) (-429.367) * (-431.281) [-429.005] (-434.295) (-428.854) -- 0:00:48
211500 -- (-431.684) [-428.988] (-430.278) (-430.071) * (-429.391) (-429.440) (-430.526) [-431.949] -- 0:00:48
212000 -- [-430.038] (-429.152) (-431.325) (-428.188) * [-427.870] (-429.219) (-430.184) (-433.473) -- 0:00:48
212500 -- (-431.972) [-429.129] (-431.219) (-428.283) * (-429.999) [-429.160] (-428.986) (-429.341) -- 0:00:48
213000 -- (-429.396) (-428.262) [-429.135] (-429.388) * (-429.713) [-428.852] (-432.979) (-430.942) -- 0:00:48
213500 -- (-428.664) [-430.083] (-428.929) (-428.066) * (-428.743) (-429.590) [-429.848] (-435.383) -- 0:00:47
214000 -- (-430.098) (-430.055) (-430.980) [-428.442] * [-429.143] (-432.174) (-428.683) (-429.960) -- 0:00:47
214500 -- [-428.796] (-430.809) (-430.225) (-430.413) * (-428.119) [-428.316] (-427.740) (-429.940) -- 0:00:47
215000 -- [-429.421] (-432.859) (-430.785) (-429.106) * (-431.543) (-430.086) [-430.477] (-428.679) -- 0:00:47
Average standard deviation of split frequencies: 0.012413
215500 -- [-430.373] (-429.177) (-430.636) (-428.174) * [-429.201] (-430.648) (-427.527) (-430.410) -- 0:00:47
216000 -- [-429.191] (-432.637) (-429.910) (-433.206) * [-428.324] (-430.420) (-431.221) (-428.516) -- 0:00:47
216500 -- (-430.366) [-432.352] (-431.676) (-431.455) * (-430.859) (-429.080) (-429.211) [-428.754] -- 0:00:47
217000 -- (-428.606) [-428.711] (-431.959) (-429.852) * (-429.406) [-430.268] (-429.289) (-427.753) -- 0:00:46
217500 -- (-430.296) (-427.962) (-432.046) [-430.227] * (-429.768) (-428.204) [-427.859] (-429.442) -- 0:00:46
218000 -- (-427.908) (-432.497) (-428.966) [-431.573] * (-429.474) (-428.818) [-428.825] (-430.343) -- 0:00:46
218500 -- (-428.312) [-429.095] (-428.873) (-427.663) * (-429.124) (-429.909) [-428.986] (-427.976) -- 0:00:46
219000 -- (-427.796) (-430.752) [-430.812] (-430.386) * (-428.526) (-431.719) (-427.922) [-427.476] -- 0:00:46
219500 -- (-432.047) (-430.244) (-431.470) [-429.931] * (-430.593) (-429.232) [-429.096] (-429.686) -- 0:00:46
220000 -- (-429.171) (-429.180) (-429.827) [-431.943] * [-430.826] (-429.309) (-431.441) (-427.940) -- 0:00:46
Average standard deviation of split frequencies: 0.013085
220500 -- (-432.677) (-429.620) [-429.446] (-428.611) * (-429.761) [-427.395] (-434.404) (-428.977) -- 0:00:45
221000 -- (-432.708) (-429.690) [-429.321] (-428.316) * (-429.432) (-428.848) (-433.140) [-429.120] -- 0:00:45
221500 -- (-429.862) (-431.079) (-430.549) [-429.715] * (-428.965) [-428.189] (-431.013) (-429.652) -- 0:00:45
222000 -- (-429.129) (-434.012) [-428.323] (-429.284) * (-433.181) (-428.732) (-429.358) [-429.316] -- 0:00:45
222500 -- (-430.490) (-429.862) [-428.928] (-428.050) * (-436.511) (-430.338) (-430.620) [-431.089] -- 0:00:48
223000 -- (-429.236) (-429.871) [-429.140] (-428.773) * [-430.836] (-428.307) (-430.636) (-433.564) -- 0:00:48
223500 -- (-433.006) (-432.225) (-430.331) [-429.486] * (-430.088) (-428.873) [-429.885] (-431.849) -- 0:00:48
224000 -- [-432.674] (-433.822) (-430.322) (-429.585) * (-432.086) (-427.816) (-429.863) [-434.326] -- 0:00:48
224500 -- (-428.316) [-428.417] (-429.374) (-429.063) * [-428.863] (-427.888) (-430.679) (-434.891) -- 0:00:48
225000 -- (-430.476) (-429.668) [-431.223] (-430.604) * (-435.169) [-428.648] (-435.231) (-429.509) -- 0:00:48
Average standard deviation of split frequencies: 0.012761
225500 -- (-429.705) (-429.617) (-428.386) [-427.785] * (-429.506) (-431.216) (-430.710) [-428.615] -- 0:00:48
226000 -- (-429.545) [-428.417] (-431.172) (-429.258) * [-429.397] (-431.773) (-433.945) (-428.728) -- 0:00:47
226500 -- [-428.324] (-428.066) (-433.521) (-431.563) * [-432.536] (-428.553) (-432.236) (-430.724) -- 0:00:47
227000 -- [-429.688] (-430.094) (-428.877) (-429.799) * [-429.640] (-428.564) (-430.801) (-428.157) -- 0:00:47
227500 -- (-431.324) (-430.670) (-431.775) [-431.136] * [-427.900] (-427.942) (-436.512) (-428.296) -- 0:00:47
228000 -- (-434.748) (-429.117) [-429.672] (-428.012) * (-428.156) [-430.258] (-429.283) (-429.197) -- 0:00:47
228500 -- (-435.932) [-427.369] (-430.271) (-429.065) * (-429.283) [-430.603] (-428.631) (-436.337) -- 0:00:47
229000 -- [-428.399] (-428.516) (-430.696) (-428.266) * [-429.149] (-430.561) (-433.141) (-429.579) -- 0:00:47
229500 -- [-429.010] (-430.507) (-428.996) (-428.664) * (-430.288) (-428.214) (-430.185) [-430.851] -- 0:00:47
230000 -- (-429.476) [-428.852] (-430.524) (-430.357) * (-427.838) (-427.566) (-430.631) [-431.369] -- 0:00:46
Average standard deviation of split frequencies: 0.012743
230500 -- (-430.018) (-427.839) (-431.776) [-428.950] * (-428.610) [-429.289] (-430.766) (-433.059) -- 0:00:46
231000 -- (-430.849) (-428.447) [-430.102] (-431.107) * [-430.759] (-429.097) (-429.475) (-430.578) -- 0:00:46
231500 -- [-430.039] (-429.589) (-429.865) (-432.397) * (-430.405) [-428.876] (-431.665) (-429.873) -- 0:00:46
232000 -- [-428.644] (-429.945) (-429.737) (-431.715) * (-429.075) (-427.820) (-429.433) [-428.730] -- 0:00:46
232500 -- [-429.900] (-430.471) (-428.823) (-435.556) * (-437.573) (-429.661) [-427.743] (-429.364) -- 0:00:46
233000 -- (-430.019) (-433.320) [-429.408] (-431.034) * [-430.632] (-428.019) (-430.535) (-429.363) -- 0:00:46
233500 -- (-431.816) (-427.691) [-428.088] (-431.476) * (-429.835) [-428.090] (-429.571) (-430.009) -- 0:00:45
234000 -- [-428.722] (-434.727) (-428.598) (-427.663) * [-429.344] (-429.734) (-427.323) (-429.001) -- 0:00:45
234500 -- (-427.428) (-430.725) (-428.725) [-427.828] * (-430.002) (-428.101) [-432.675] (-431.641) -- 0:00:45
235000 -- (-428.714) (-428.159) (-432.755) [-428.191] * (-431.878) (-428.924) (-432.897) [-427.302] -- 0:00:45
Average standard deviation of split frequencies: 0.012651
235500 -- (-433.242) (-429.333) (-429.757) [-427.844] * [-429.523] (-429.555) (-431.668) (-427.323) -- 0:00:45
236000 -- [-428.499] (-428.949) (-430.708) (-433.021) * (-429.185) (-427.380) [-431.485] (-427.421) -- 0:00:45
236500 -- (-430.926) (-427.794) [-429.604] (-428.170) * (-431.872) (-428.915) [-428.907] (-428.203) -- 0:00:45
237000 -- (-432.629) (-428.002) [-427.595] (-428.443) * (-429.605) [-428.453] (-431.318) (-433.455) -- 0:00:45
237500 -- [-430.067] (-430.458) (-428.004) (-435.108) * [-430.149] (-434.710) (-433.649) (-429.305) -- 0:00:44
238000 -- (-429.152) (-429.875) (-430.041) [-429.688] * (-429.759) (-430.781) (-432.861) [-434.637] -- 0:00:44
238500 -- [-429.621] (-429.213) (-429.231) (-428.521) * (-432.907) (-429.604) [-428.584] (-431.671) -- 0:00:47
239000 -- (-431.820) [-429.533] (-429.197) (-427.730) * (-428.562) [-434.013] (-428.789) (-435.317) -- 0:00:47
239500 -- (-431.405) [-430.463] (-431.620) (-430.981) * (-428.809) (-427.748) (-429.493) [-428.450] -- 0:00:47
240000 -- (-427.737) (-431.472) [-429.345] (-430.639) * (-430.586) (-430.663) (-428.762) [-428.770] -- 0:00:47
Average standard deviation of split frequencies: 0.011491
240500 -- (-428.762) [-430.981] (-431.247) (-429.650) * (-430.960) (-429.817) [-428.838] (-428.809) -- 0:00:47
241000 -- (-431.575) [-428.959] (-431.891) (-429.190) * [-429.070] (-429.653) (-430.401) (-429.823) -- 0:00:47
241500 -- [-428.806] (-431.040) (-427.977) (-431.942) * (-428.879) [-429.314] (-434.003) (-430.572) -- 0:00:47
242000 -- (-432.766) [-431.593] (-429.828) (-431.743) * (-429.084) [-427.327] (-434.391) (-429.739) -- 0:00:46
242500 -- (-432.932) (-433.575) [-430.532] (-429.650) * [-429.310] (-429.394) (-428.871) (-435.001) -- 0:00:46
243000 -- (-429.316) (-432.977) (-428.260) [-430.788] * (-430.381) (-429.533) [-428.436] (-429.989) -- 0:00:46
243500 -- (-429.481) (-430.373) [-428.781] (-427.695) * (-430.333) (-431.331) [-429.585] (-430.097) -- 0:00:46
244000 -- (-430.313) (-430.390) (-428.374) [-429.417] * (-428.214) [-427.855] (-433.306) (-428.429) -- 0:00:46
244500 -- (-429.713) [-430.635] (-430.885) (-430.301) * (-428.506) (-428.628) (-430.018) [-430.008] -- 0:00:46
245000 -- (-429.270) (-435.129) (-433.264) [-431.641] * (-431.081) [-432.084] (-431.253) (-429.243) -- 0:00:46
Average standard deviation of split frequencies: 0.011857
245500 -- [-428.262] (-428.117) (-432.834) (-431.287) * (-429.377) (-428.852) (-430.448) [-428.413] -- 0:00:46
246000 -- (-428.770) (-428.606) [-429.261] (-431.301) * (-428.459) (-429.048) (-431.028) [-431.220] -- 0:00:45
246500 -- (-428.629) (-434.052) (-428.747) [-429.588] * (-430.549) (-428.166) (-432.731) [-429.394] -- 0:00:45
247000 -- (-428.063) [-429.140] (-429.191) (-427.690) * (-429.796) (-432.061) [-428.516] (-436.696) -- 0:00:45
247500 -- (-432.748) [-430.022] (-428.978) (-428.727) * (-428.529) (-427.941) [-428.623] (-428.535) -- 0:00:45
248000 -- (-431.442) [-430.381] (-429.358) (-428.773) * (-428.208) (-428.875) [-428.961] (-430.871) -- 0:00:45
248500 -- (-430.751) (-429.571) (-430.036) [-428.357] * (-428.473) (-431.229) [-428.973] (-432.461) -- 0:00:45
249000 -- [-430.196] (-429.076) (-429.816) (-430.169) * (-430.553) (-431.166) (-433.527) [-430.927] -- 0:00:45
249500 -- (-430.095) (-429.040) [-433.161] (-430.762) * [-430.495] (-432.469) (-432.327) (-432.762) -- 0:00:45
250000 -- [-429.782] (-427.492) (-431.790) (-429.324) * [-428.752] (-429.635) (-432.522) (-428.270) -- 0:00:45
Average standard deviation of split frequencies: 0.011401
250500 -- (-429.349) [-427.983] (-427.882) (-430.427) * (-429.831) (-429.027) [-428.574] (-428.949) -- 0:00:44
251000 -- (-429.685) [-435.099] (-428.406) (-431.657) * [-434.616] (-427.836) (-428.440) (-428.820) -- 0:00:44
251500 -- (-428.262) (-433.745) [-429.175] (-429.811) * [-429.936] (-430.286) (-431.743) (-429.552) -- 0:00:44
252000 -- (-431.168) [-432.049] (-429.068) (-429.757) * [-431.289] (-430.630) (-430.437) (-430.138) -- 0:00:44
252500 -- [-429.827] (-427.389) (-430.250) (-432.410) * (-429.046) (-431.056) (-429.137) [-428.713] -- 0:00:44
253000 -- (-430.403) (-431.857) (-429.146) [-428.673] * (-429.271) [-431.435] (-428.117) (-429.341) -- 0:00:44
253500 -- (-430.470) [-431.189] (-432.524) (-429.287) * (-430.270) (-432.413) [-428.847] (-430.023) -- 0:00:44
254000 -- [-432.057] (-428.341) (-430.422) (-427.871) * [-431.545] (-430.860) (-428.299) (-430.524) -- 0:00:44
254500 -- (-431.910) (-428.606) (-428.597) [-431.612] * [-430.775] (-430.493) (-434.293) (-431.009) -- 0:00:43
255000 -- (-431.647) [-428.053] (-429.595) (-429.888) * (-427.685) (-431.274) (-431.633) [-429.500] -- 0:00:46
Average standard deviation of split frequencies: 0.011482
255500 -- (-429.090) (-429.531) [-429.046] (-428.984) * [-427.592] (-428.841) (-431.932) (-429.511) -- 0:00:46
256000 -- [-429.336] (-430.685) (-428.736) (-429.466) * (-430.596) [-428.286] (-428.973) (-427.786) -- 0:00:46
256500 -- (-427.943) (-428.001) (-435.371) [-427.852] * (-428.840) [-428.113] (-428.503) (-428.300) -- 0:00:46
257000 -- (-431.993) (-428.773) (-430.722) [-430.136] * [-431.054] (-432.464) (-431.249) (-429.262) -- 0:00:46
257500 -- (-432.346) [-427.950] (-430.613) (-428.140) * (-432.222) (-432.511) [-430.442] (-430.628) -- 0:00:46
258000 -- (-431.638) (-433.359) [-427.630] (-427.530) * (-429.790) (-430.602) [-432.197] (-429.794) -- 0:00:46
258500 -- (-428.375) [-432.344] (-429.517) (-431.052) * (-428.511) (-429.537) (-431.084) [-429.461] -- 0:00:45
259000 -- (-429.852) (-429.507) (-431.073) [-431.470] * (-429.453) (-428.629) (-431.982) [-428.259] -- 0:00:45
259500 -- (-427.388) [-428.682] (-429.143) (-429.933) * (-429.364) (-428.945) (-430.032) [-433.010] -- 0:00:45
260000 -- (-430.608) (-429.940) (-431.319) [-431.024] * (-428.421) (-427.993) (-429.586) [-427.966] -- 0:00:45
Average standard deviation of split frequencies: 0.011642
260500 -- (-429.271) (-428.218) (-429.922) [-428.602] * [-430.182] (-431.988) (-430.175) (-428.490) -- 0:00:45
261000 -- (-434.066) [-430.301] (-428.893) (-428.357) * (-428.710) (-428.668) (-428.671) [-431.925] -- 0:00:45
261500 -- (-427.498) [-430.333] (-430.988) (-431.150) * (-427.695) (-427.428) [-427.476] (-431.688) -- 0:00:45
262000 -- (-430.432) [-432.873] (-433.317) (-432.531) * (-429.850) (-428.325) (-428.678) [-428.609] -- 0:00:45
262500 -- (-431.243) [-431.005] (-432.475) (-429.407) * (-430.444) (-429.690) (-434.154) [-427.473] -- 0:00:44
263000 -- (-432.032) (-432.513) [-429.147] (-428.003) * (-429.803) [-428.506] (-430.666) (-429.196) -- 0:00:44
263500 -- [-428.574] (-432.340) (-428.378) (-427.836) * (-429.434) (-429.183) [-428.950] (-429.512) -- 0:00:44
264000 -- (-430.374) (-430.372) [-431.020] (-430.759) * (-428.168) (-432.428) (-431.768) [-428.528] -- 0:00:44
264500 -- (-428.466) (-428.787) (-433.854) [-430.760] * (-430.845) (-430.924) (-428.577) [-428.821] -- 0:00:44
265000 -- (-430.194) (-428.509) (-432.078) [-432.359] * (-429.160) (-429.627) (-431.571) [-432.332] -- 0:00:44
Average standard deviation of split frequencies: 0.010737
265500 -- (-430.702) (-430.208) (-429.264) [-428.589] * (-427.422) (-428.872) [-427.857] (-429.620) -- 0:00:44
266000 -- (-430.245) (-430.804) [-432.477] (-428.772) * (-428.171) [-428.689] (-429.911) (-431.856) -- 0:00:44
266500 -- [-429.711] (-430.189) (-428.377) (-429.392) * (-431.689) [-428.900] (-428.168) (-432.473) -- 0:00:44
267000 -- [-428.514] (-430.342) (-428.468) (-430.004) * [-433.317] (-428.114) (-428.299) (-431.626) -- 0:00:43
267500 -- (-431.412) [-432.110] (-428.779) (-430.769) * (-433.469) [-428.645] (-430.387) (-431.733) -- 0:00:43
268000 -- (-430.938) (-431.597) [-432.031] (-430.237) * (-427.791) [-428.419] (-429.064) (-429.966) -- 0:00:43
268500 -- (-431.520) [-429.850] (-427.867) (-432.072) * [-428.800] (-429.333) (-428.847) (-428.709) -- 0:00:43
269000 -- (-432.644) [-427.394] (-429.170) (-430.072) * [-429.747] (-431.160) (-429.040) (-430.253) -- 0:00:43
269500 -- [-427.614] (-431.458) (-428.541) (-428.444) * [-429.008] (-429.563) (-427.781) (-429.956) -- 0:00:43
270000 -- (-428.349) (-428.815) [-429.102] (-430.281) * (-429.750) (-435.468) [-430.131] (-429.250) -- 0:00:43
Average standard deviation of split frequencies: 0.011167
270500 -- (-427.755) [-433.395] (-429.754) (-429.743) * (-431.122) (-433.263) [-432.808] (-429.416) -- 0:00:43
271000 -- (-430.408) [-433.732] (-427.288) (-431.598) * (-428.979) (-427.764) (-430.116) [-431.216] -- 0:00:43
271500 -- (-428.770) (-430.414) [-429.036] (-427.967) * (-430.462) (-430.566) (-427.857) [-428.035] -- 0:00:45
272000 -- [-430.506] (-429.027) (-432.082) (-427.813) * (-433.046) (-428.979) (-429.259) [-429.340] -- 0:00:45
272500 -- [-428.870] (-428.840) (-431.686) (-428.149) * (-429.518) [-428.235] (-428.494) (-428.734) -- 0:00:45
273000 -- (-428.446) (-429.797) [-431.853] (-428.544) * [-428.830] (-427.685) (-429.471) (-431.210) -- 0:00:45
273500 -- [-427.933] (-429.661) (-427.917) (-435.006) * (-429.896) [-427.627] (-430.260) (-437.266) -- 0:00:45
274000 -- (-428.664) (-429.464) (-427.711) [-429.900] * (-430.643) (-430.709) [-429.722] (-429.249) -- 0:00:45
274500 -- (-431.220) (-427.694) [-428.499] (-430.063) * (-428.118) (-433.950) [-428.324] (-428.847) -- 0:00:44
275000 -- (-429.049) (-427.817) [-429.415] (-428.905) * (-427.981) (-431.605) (-428.570) [-429.057] -- 0:00:44
Average standard deviation of split frequencies: 0.012596
275500 -- (-429.477) [-428.799] (-431.499) (-427.995) * [-428.804] (-430.973) (-430.492) (-429.151) -- 0:00:44
276000 -- [-427.977] (-428.540) (-431.717) (-429.555) * (-428.402) (-428.748) (-429.996) [-431.048] -- 0:00:44
276500 -- [-431.027] (-427.840) (-429.839) (-430.096) * (-428.543) (-429.664) (-430.814) [-428.421] -- 0:00:44
277000 -- (-431.840) (-428.364) (-430.172) [-430.957] * (-430.321) (-427.797) (-429.544) [-427.604] -- 0:00:44
277500 -- (-430.972) [-428.401] (-428.944) (-429.187) * (-429.735) [-429.307] (-428.273) (-429.484) -- 0:00:44
278000 -- (-432.917) (-429.147) [-429.610] (-432.912) * [-432.817] (-429.757) (-434.590) (-430.829) -- 0:00:44
278500 -- (-429.152) (-432.695) (-430.528) [-429.512] * (-429.742) (-428.526) [-432.812] (-430.217) -- 0:00:44
279000 -- (-428.966) (-432.729) [-431.652] (-431.356) * (-427.357) [-427.957] (-429.660) (-431.082) -- 0:00:43
279500 -- (-433.095) (-430.946) [-428.731] (-432.145) * (-429.202) [-428.574] (-434.359) (-429.451) -- 0:00:43
280000 -- (-430.915) [-429.710] (-431.639) (-429.098) * (-431.167) (-428.829) [-428.699] (-428.575) -- 0:00:43
Average standard deviation of split frequencies: 0.012943
280500 -- (-428.475) [-428.834] (-428.766) (-431.527) * [-431.218] (-430.939) (-431.536) (-429.408) -- 0:00:43
281000 -- (-428.093) (-428.804) [-427.924] (-427.837) * (-431.255) (-428.009) (-430.200) [-428.940] -- 0:00:43
281500 -- [-433.354] (-431.386) (-428.892) (-429.367) * (-431.734) (-430.173) [-431.034] (-432.822) -- 0:00:43
282000 -- (-431.426) [-429.918] (-429.336) (-429.228) * [-433.789] (-432.361) (-430.982) (-427.783) -- 0:00:43
282500 -- (-432.926) (-431.752) [-427.254] (-430.894) * [-430.977] (-428.734) (-427.699) (-428.125) -- 0:00:43
283000 -- [-430.136] (-428.325) (-428.228) (-428.766) * [-430.751] (-430.854) (-427.244) (-427.399) -- 0:00:43
283500 -- (-429.313) [-432.758] (-429.143) (-429.858) * (-429.956) (-429.224) [-428.607] (-428.562) -- 0:00:42
284000 -- [-428.444] (-432.006) (-432.197) (-430.003) * (-431.877) (-428.076) (-427.528) [-429.399] -- 0:00:42
284500 -- (-437.045) (-430.594) (-429.785) [-428.706] * (-427.901) (-428.207) [-429.966] (-428.593) -- 0:00:42
285000 -- [-429.270] (-430.633) (-427.736) (-428.450) * (-430.802) (-431.602) [-430.427] (-428.731) -- 0:00:42
Average standard deviation of split frequencies: 0.013003
285500 -- [-434.404] (-430.162) (-430.885) (-428.969) * (-428.741) (-430.002) [-428.616] (-427.628) -- 0:00:42
286000 -- (-428.865) (-431.641) [-429.076] (-428.687) * (-434.425) [-429.161] (-433.643) (-427.797) -- 0:00:42
286500 -- (-430.210) (-431.385) [-429.078] (-428.439) * (-431.472) (-428.582) [-433.067] (-430.956) -- 0:00:42
287000 -- (-429.612) (-431.369) [-429.131] (-427.724) * [-431.176] (-428.025) (-429.082) (-435.704) -- 0:00:42
287500 -- (-430.719) (-432.975) [-429.193] (-429.227) * [-428.790] (-427.687) (-428.614) (-429.861) -- 0:00:42
288000 -- (-434.360) [-428.378] (-431.240) (-431.990) * (-429.218) (-427.802) [-430.529] (-428.368) -- 0:00:44
288500 -- (-429.943) (-428.965) (-428.582) [-430.206] * (-432.114) (-428.392) (-429.982) [-431.235] -- 0:00:44
289000 -- [-429.968] (-430.354) (-429.320) (-435.120) * (-435.472) (-428.888) (-428.630) [-429.332] -- 0:00:44
289500 -- (-431.281) [-429.333] (-433.666) (-429.331) * (-428.279) (-428.593) [-427.534] (-428.845) -- 0:00:44
290000 -- (-433.120) (-428.612) [-427.845] (-430.928) * [-427.751] (-431.552) (-429.454) (-429.043) -- 0:00:44
Average standard deviation of split frequencies: 0.013642
290500 -- (-429.100) (-427.552) (-430.320) [-428.723] * (-427.664) (-433.424) (-431.401) [-428.665] -- 0:00:43
291000 -- [-431.676] (-428.285) (-433.634) (-430.581) * (-429.715) [-432.510] (-428.439) (-427.875) -- 0:00:43
291500 -- (-430.722) (-427.481) [-428.021] (-430.469) * (-433.109) [-431.671] (-428.182) (-428.271) -- 0:00:43
292000 -- (-431.505) (-431.000) [-428.526] (-430.740) * [-428.594] (-428.348) (-427.891) (-428.304) -- 0:00:43
292500 -- [-434.083] (-431.816) (-429.080) (-431.336) * [-428.083] (-429.241) (-429.648) (-429.462) -- 0:00:43
293000 -- (-432.047) [-430.171] (-430.275) (-428.578) * (-427.520) (-428.961) (-430.030) [-430.097] -- 0:00:43
293500 -- (-433.298) (-429.203) (-429.677) [-428.863] * (-430.824) (-428.365) [-427.923] (-433.450) -- 0:00:43
294000 -- (-430.110) (-428.783) [-428.238] (-429.240) * (-428.861) [-428.281] (-429.720) (-429.613) -- 0:00:43
294500 -- [-431.946] (-429.537) (-428.931) (-427.778) * (-431.240) (-428.802) (-430.311) [-430.164] -- 0:00:43
295000 -- [-428.033] (-428.982) (-428.772) (-428.667) * (-430.478) [-429.620] (-431.873) (-430.606) -- 0:00:43
Average standard deviation of split frequencies: 0.013396
295500 -- (-430.274) [-427.641] (-435.408) (-430.187) * (-428.100) (-430.708) [-432.770] (-429.562) -- 0:00:42
296000 -- (-432.358) (-427.887) (-434.125) [-431.705] * (-429.813) (-430.877) [-428.611] (-429.169) -- 0:00:42
296500 -- (-428.640) (-429.955) (-429.280) [-429.046] * (-430.452) (-431.702) (-428.631) [-428.477] -- 0:00:42
297000 -- [-429.387] (-428.432) (-433.967) (-429.139) * [-429.293] (-431.133) (-429.743) (-428.611) -- 0:00:42
297500 -- (-427.825) (-431.637) [-428.029] (-430.260) * [-431.374] (-429.599) (-430.403) (-434.169) -- 0:00:42
298000 -- (-427.242) (-428.723) (-428.284) [-434.999] * [-428.107] (-432.199) (-429.365) (-430.556) -- 0:00:42
298500 -- [-428.906] (-430.599) (-432.451) (-431.346) * (-434.790) (-428.720) (-430.401) [-428.447] -- 0:00:42
299000 -- [-429.593] (-429.456) (-430.781) (-428.573) * (-428.447) (-428.454) [-428.384] (-430.379) -- 0:00:42
299500 -- (-428.476) (-429.489) (-431.722) [-429.108] * [-428.250] (-429.345) (-429.895) (-430.296) -- 0:00:42
300000 -- (-429.596) (-430.284) (-432.228) [-428.357] * (-431.770) (-428.063) (-428.933) [-427.951] -- 0:00:42
Average standard deviation of split frequencies: 0.011857
300500 -- (-428.514) (-429.110) (-430.281) [-430.222] * (-432.496) (-428.637) [-431.096] (-429.291) -- 0:00:41
301000 -- (-428.787) (-430.449) (-429.474) [-430.548] * (-428.351) (-428.798) (-428.642) [-429.041] -- 0:00:41
301500 -- (-428.421) (-434.399) [-429.841] (-431.852) * (-429.776) (-430.281) (-430.319) [-432.904] -- 0:00:41
302000 -- [-432.247] (-429.231) (-429.412) (-431.014) * (-430.859) (-430.011) [-428.203] (-430.411) -- 0:00:41
302500 -- (-433.599) (-431.583) [-431.101] (-429.159) * (-432.294) (-430.644) [-430.125] (-428.775) -- 0:00:41
303000 -- (-430.126) [-428.309] (-433.099) (-429.512) * (-431.487) (-430.874) [-428.371] (-428.838) -- 0:00:41
303500 -- [-429.649] (-428.671) (-431.652) (-430.319) * (-431.594) [-429.971] (-431.225) (-431.858) -- 0:00:41
304000 -- (-434.925) [-428.153] (-430.324) (-428.018) * [-428.265] (-428.336) (-433.735) (-430.344) -- 0:00:41
304500 -- (-433.156) (-428.616) (-428.154) [-427.733] * (-430.629) (-428.590) (-430.506) [-427.618] -- 0:00:43
305000 -- [-432.721] (-430.051) (-429.676) (-431.040) * (-429.391) (-428.582) (-430.833) [-428.275] -- 0:00:43
Average standard deviation of split frequencies: 0.011599
305500 -- (-432.227) (-428.733) (-428.508) [-428.671] * (-427.766) [-429.518] (-429.292) (-428.070) -- 0:00:43
306000 -- (-428.929) [-427.659] (-428.821) (-436.547) * (-427.764) [-431.197] (-431.587) (-429.759) -- 0:00:43
306500 -- (-429.602) (-427.821) (-428.456) [-433.195] * [-429.264] (-427.660) (-432.788) (-428.029) -- 0:00:42
307000 -- (-430.175) (-430.708) [-428.417] (-428.734) * (-429.242) [-428.539] (-429.321) (-434.247) -- 0:00:42
307500 -- (-431.345) (-428.803) [-430.665] (-428.579) * (-429.521) (-430.956) [-430.811] (-428.525) -- 0:00:42
308000 -- (-430.926) [-431.930] (-434.925) (-430.975) * (-429.397) (-430.356) [-433.635] (-436.908) -- 0:00:42
308500 -- (-430.231) (-429.121) (-428.280) [-430.530] * (-429.086) [-429.032] (-428.758) (-430.144) -- 0:00:42
309000 -- [-432.627] (-428.046) (-430.891) (-429.161) * (-428.026) (-429.260) [-430.221] (-428.498) -- 0:00:42
309500 -- (-431.847) (-428.747) (-427.351) [-429.075] * [-431.890] (-430.425) (-427.997) (-429.484) -- 0:00:42
310000 -- (-429.568) [-429.153] (-429.016) (-432.966) * (-428.915) (-429.788) (-429.645) [-428.721] -- 0:00:42
Average standard deviation of split frequencies: 0.011961
310500 -- (-428.715) [-432.567] (-431.149) (-429.258) * (-432.211) (-428.682) [-430.295] (-428.573) -- 0:00:42
311000 -- (-429.258) (-433.430) [-429.403] (-428.893) * (-431.990) (-430.957) (-429.585) [-428.932] -- 0:00:42
311500 -- (-429.171) (-429.896) [-430.094] (-431.648) * (-430.552) (-430.582) (-429.276) [-428.696] -- 0:00:41
312000 -- (-433.275) (-431.373) [-432.394] (-427.641) * (-430.598) [-427.294] (-435.042) (-429.881) -- 0:00:41
312500 -- (-434.076) [-430.313] (-430.016) (-429.586) * (-429.964) [-428.589] (-428.398) (-429.645) -- 0:00:41
313000 -- [-428.648] (-427.583) (-428.340) (-429.454) * (-428.505) (-431.221) (-429.095) [-429.669] -- 0:00:41
313500 -- (-428.612) (-429.353) (-431.784) [-430.792] * (-428.411) (-431.686) [-433.731] (-431.519) -- 0:00:41
314000 -- (-428.700) (-428.309) (-428.956) [-427.854] * [-427.605] (-430.829) (-431.396) (-432.710) -- 0:00:41
314500 -- (-433.285) (-428.437) (-432.616) [-432.109] * (-430.013) [-430.086] (-428.649) (-428.320) -- 0:00:41
315000 -- (-428.251) (-431.353) (-430.345) [-428.123] * (-431.303) [-433.190] (-429.777) (-434.758) -- 0:00:41
Average standard deviation of split frequencies: 0.010881
315500 -- (-429.950) (-433.085) [-431.338] (-432.521) * (-431.791) [-428.803] (-431.648) (-428.154) -- 0:00:41
316000 -- (-430.244) (-431.978) [-428.095] (-428.929) * [-430.260] (-431.429) (-430.201) (-433.780) -- 0:00:41
316500 -- (-429.907) (-429.805) [-428.798] (-428.934) * [-428.408] (-430.790) (-428.847) (-434.550) -- 0:00:41
317000 -- (-430.163) (-427.685) [-427.841] (-430.226) * [-429.652] (-434.217) (-430.851) (-431.164) -- 0:00:40
317500 -- (-428.815) (-428.921) [-431.330] (-430.058) * [-432.360] (-428.801) (-429.958) (-431.123) -- 0:00:40
318000 -- (-430.725) (-429.717) [-429.380] (-429.403) * (-429.507) (-430.908) (-430.318) [-430.495] -- 0:00:40
318500 -- [-430.833] (-427.615) (-427.706) (-430.084) * (-428.113) (-427.443) (-430.076) [-428.664] -- 0:00:40
319000 -- (-428.949) (-428.641) (-427.979) [-428.376] * [-427.854] (-430.325) (-429.019) (-429.509) -- 0:00:40
319500 -- (-428.769) [-428.905] (-428.633) (-428.189) * [-428.210] (-428.448) (-429.095) (-428.448) -- 0:00:40
320000 -- (-429.508) (-428.756) (-429.705) [-430.687] * (-429.064) (-431.396) [-429.126] (-428.359) -- 0:00:40
Average standard deviation of split frequencies: 0.011271
320500 -- (-429.453) (-431.393) (-431.366) [-427.598] * [-429.643] (-429.037) (-430.319) (-430.957) -- 0:00:40
321000 -- (-429.273) (-428.820) (-429.561) [-430.493] * (-428.781) (-429.603) (-431.465) [-430.341] -- 0:00:40
321500 -- (-430.970) (-434.739) [-429.763] (-433.150) * (-431.236) (-428.444) (-429.413) [-428.662] -- 0:00:42
322000 -- (-429.880) (-430.759) (-434.853) [-430.010] * (-430.727) (-428.794) (-429.426) [-432.952] -- 0:00:42
322500 -- (-432.369) (-428.902) [-428.332] (-429.053) * (-427.480) (-429.130) (-429.798) [-431.303] -- 0:00:42
323000 -- (-434.209) (-428.439) (-431.546) [-428.406] * (-427.552) (-429.139) (-429.335) [-428.870] -- 0:00:41
323500 -- (-431.020) (-427.590) (-429.005) [-429.521] * (-430.626) (-430.315) (-429.839) [-430.347] -- 0:00:41
324000 -- (-433.496) (-427.618) (-429.252) [-430.404] * (-432.995) [-429.595] (-429.515) (-427.314) -- 0:00:41
324500 -- [-432.100] (-427.680) (-428.507) (-430.404) * (-430.493) [-431.001] (-428.834) (-435.475) -- 0:00:41
325000 -- (-428.731) (-428.787) [-430.159] (-427.810) * (-429.511) [-433.645] (-431.512) (-428.561) -- 0:00:41
Average standard deviation of split frequencies: 0.011086
325500 -- (-427.726) [-428.181] (-431.216) (-432.278) * (-429.331) [-431.678] (-429.350) (-430.404) -- 0:00:41
326000 -- (-429.617) [-428.335] (-430.202) (-429.431) * (-430.690) (-430.354) (-434.771) [-428.066] -- 0:00:41
326500 -- (-433.538) (-427.350) [-428.030] (-429.670) * (-428.286) (-430.120) (-432.067) [-428.131] -- 0:00:41
327000 -- (-429.691) [-427.600] (-431.360) (-429.267) * (-433.579) (-430.446) (-429.876) [-427.849] -- 0:00:41
327500 -- [-428.569] (-428.612) (-429.336) (-436.056) * [-428.461] (-430.836) (-428.817) (-431.510) -- 0:00:41
328000 -- (-430.414) [-427.923] (-435.063) (-435.669) * (-435.230) [-429.427] (-429.939) (-428.194) -- 0:00:40
328500 -- (-431.767) (-428.565) [-428.640] (-431.355) * (-435.968) (-429.335) [-429.549] (-428.655) -- 0:00:40
329000 -- (-428.276) [-428.565] (-428.317) (-427.986) * [-428.995] (-429.349) (-432.326) (-429.145) -- 0:00:40
329500 -- [-428.625] (-430.686) (-432.107) (-433.333) * (-428.615) [-428.590] (-431.047) (-430.336) -- 0:00:40
330000 -- (-431.345) (-429.777) [-432.854] (-431.728) * (-428.946) [-429.617] (-428.351) (-433.556) -- 0:00:40
Average standard deviation of split frequencies: 0.009812
330500 -- (-430.320) [-429.937] (-429.310) (-429.252) * (-431.685) [-431.757] (-428.048) (-431.283) -- 0:00:40
331000 -- (-429.150) [-429.985] (-429.914) (-429.773) * [-429.014] (-431.610) (-427.891) (-429.876) -- 0:00:40
331500 -- (-434.195) (-428.758) [-428.284] (-432.062) * (-430.016) [-427.944] (-431.859) (-429.404) -- 0:00:40
332000 -- (-430.390) [-429.645] (-427.893) (-428.323) * (-429.794) (-428.374) (-430.684) [-429.247] -- 0:00:40
332500 -- (-430.841) (-428.740) [-432.299] (-430.632) * (-429.190) (-428.847) [-430.865] (-429.822) -- 0:00:40
333000 -- (-431.791) (-430.164) (-430.042) [-429.182] * (-428.249) (-429.874) [-428.197] (-429.425) -- 0:00:40
333500 -- (-430.841) (-429.390) [-431.761] (-429.535) * (-431.726) (-428.358) [-429.395] (-431.048) -- 0:00:39
334000 -- (-430.052) [-430.516] (-433.306) (-429.163) * (-428.819) (-430.977) (-431.241) [-427.964] -- 0:00:39
334500 -- (-430.058) (-432.338) [-430.763] (-432.639) * (-428.803) (-429.000) [-428.886] (-433.110) -- 0:00:39
335000 -- (-430.823) (-427.836) (-432.568) [-428.298] * (-427.753) (-428.741) (-427.755) [-430.975] -- 0:00:39
Average standard deviation of split frequencies: 0.009903
335500 -- (-428.701) [-430.801] (-428.394) (-428.003) * (-429.140) (-433.073) (-428.382) [-427.879] -- 0:00:39
336000 -- (-433.286) (-429.767) [-429.741] (-430.178) * (-431.285) [-431.676] (-428.123) (-428.571) -- 0:00:39
336500 -- (-433.049) (-429.340) [-429.280] (-429.830) * (-432.511) (-429.509) (-428.006) [-428.612] -- 0:00:39
337000 -- [-430.457] (-427.647) (-428.366) (-427.848) * (-430.451) (-431.922) [-431.011] (-432.021) -- 0:00:39
337500 -- (-428.784) (-427.787) [-428.704] (-427.682) * (-431.287) (-431.651) [-427.665] (-429.646) -- 0:00:41
338000 -- (-431.573) [-427.665] (-430.327) (-430.651) * [-429.600] (-431.681) (-427.716) (-428.258) -- 0:00:41
338500 -- (-430.795) (-430.815) [-429.722] (-429.633) * (-432.017) (-431.348) [-428.100] (-431.754) -- 0:00:41
339000 -- [-429.670] (-431.522) (-434.008) (-429.480) * (-429.742) [-429.498] (-431.697) (-429.142) -- 0:00:40
339500 -- (-428.432) (-428.886) [-431.513] (-428.077) * (-429.353) (-428.505) (-430.291) [-427.802] -- 0:00:40
340000 -- (-429.274) (-429.280) [-431.231] (-432.532) * (-430.133) (-430.135) (-430.338) [-428.185] -- 0:00:40
Average standard deviation of split frequencies: 0.010663
340500 -- [-429.193] (-432.444) (-430.046) (-429.574) * (-427.703) [-432.521] (-432.562) (-429.178) -- 0:00:40
341000 -- [-429.533] (-430.441) (-433.986) (-429.267) * (-431.711) [-432.368] (-429.334) (-430.275) -- 0:00:40
341500 -- [-430.261] (-429.118) (-431.758) (-428.332) * (-432.911) (-431.329) (-431.319) [-427.691] -- 0:00:40
342000 -- (-438.161) (-428.006) (-431.558) [-429.501] * [-428.037] (-430.009) (-432.093) (-428.448) -- 0:00:40
342500 -- (-430.536) (-429.195) [-431.438] (-431.820) * (-428.187) [-429.418] (-429.587) (-429.024) -- 0:00:40
343000 -- (-427.918) (-428.740) (-431.413) [-429.465] * (-434.242) (-433.618) [-428.717] (-430.964) -- 0:00:40
343500 -- (-430.477) [-429.085] (-430.688) (-430.452) * [-428.566] (-432.860) (-428.172) (-430.876) -- 0:00:40
344000 -- (-428.600) (-429.078) (-432.954) [-429.325] * (-429.847) (-429.643) [-428.806] (-429.877) -- 0:00:40
344500 -- (-428.228) (-427.398) [-430.146] (-430.502) * (-429.122) (-429.258) [-428.520] (-429.432) -- 0:00:39
345000 -- (-431.367) [-428.135] (-428.779) (-432.593) * (-429.004) (-429.892) [-427.896] (-431.248) -- 0:00:39
Average standard deviation of split frequencies: 0.010659
345500 -- (-428.840) (-429.975) [-430.280] (-427.560) * (-429.902) (-428.992) [-430.702] (-433.062) -- 0:00:39
346000 -- (-429.492) (-428.322) [-429.397] (-427.578) * (-428.818) [-429.917] (-429.357) (-430.373) -- 0:00:39
346500 -- (-429.152) (-429.871) (-431.869) [-429.622] * (-429.637) (-430.384) [-429.166] (-429.410) -- 0:00:39
347000 -- (-428.510) (-429.165) (-428.903) [-431.153] * (-430.484) (-428.308) (-428.737) [-427.773] -- 0:00:39
347500 -- (-428.335) [-432.736] (-427.920) (-431.604) * (-430.194) [-432.391] (-428.979) (-428.103) -- 0:00:39
348000 -- (-427.976) (-433.382) (-431.734) [-432.918] * (-427.582) (-435.690) [-429.013] (-433.841) -- 0:00:39
348500 -- (-430.748) (-430.458) [-428.664] (-438.352) * (-430.250) (-428.157) [-430.073] (-429.514) -- 0:00:39
349000 -- (-429.067) (-430.172) (-429.512) [-432.255] * (-431.242) (-431.264) [-428.030] (-432.309) -- 0:00:39
349500 -- [-428.152] (-427.877) (-428.922) (-429.047) * (-429.457) [-429.507] (-435.322) (-430.389) -- 0:00:39
350000 -- (-428.332) [-430.284] (-429.255) (-429.283) * (-428.427) (-428.514) (-430.803) [-428.077] -- 0:00:39
Average standard deviation of split frequencies: 0.010596
350500 -- [-430.905] (-428.270) (-429.206) (-429.287) * (-429.837) (-431.365) [-430.106] (-428.570) -- 0:00:38
351000 -- (-430.007) (-427.805) (-428.588) [-429.974] * (-429.706) (-430.268) [-432.651] (-428.035) -- 0:00:38
351500 -- (-428.640) [-432.013] (-432.216) (-435.511) * (-427.517) (-432.327) [-429.373] (-429.600) -- 0:00:38
352000 -- (-428.887) (-428.760) [-434.393] (-431.356) * (-428.361) (-432.097) [-428.841] (-432.616) -- 0:00:38
352500 -- (-433.708) (-429.340) (-429.027) [-430.338] * (-430.903) (-432.581) (-428.751) [-430.485] -- 0:00:40
353000 -- (-427.627) (-429.742) (-432.078) [-431.791] * (-429.914) (-429.763) [-428.089] (-428.242) -- 0:00:40
353500 -- (-429.100) [-427.280] (-429.149) (-431.626) * (-438.289) (-430.077) (-429.254) [-429.455] -- 0:00:40
354000 -- (-429.585) (-427.428) (-429.404) [-429.311] * (-435.924) (-430.924) (-429.034) [-431.502] -- 0:00:40
354500 -- (-433.483) [-427.592] (-428.832) (-429.513) * (-432.090) (-428.810) (-430.060) [-428.288] -- 0:00:40
355000 -- [-432.414] (-428.552) (-434.762) (-432.215) * [-428.242] (-431.087) (-430.338) (-430.179) -- 0:00:39
Average standard deviation of split frequencies: 0.010593
355500 -- (-429.493) (-432.506) [-429.229] (-432.012) * [-429.606] (-428.579) (-429.102) (-432.025) -- 0:00:39
356000 -- (-428.151) [-429.279] (-429.188) (-427.822) * [-429.550] (-427.922) (-427.925) (-429.916) -- 0:00:39
356500 -- (-427.886) (-428.079) (-429.295) [-429.388] * (-427.920) (-427.582) [-429.367] (-429.149) -- 0:00:39
357000 -- (-428.257) (-427.876) (-428.609) [-429.308] * (-429.060) [-429.105] (-432.872) (-428.747) -- 0:00:39
357500 -- (-430.027) [-432.846] (-428.102) (-430.478) * (-430.561) [-430.990] (-432.721) (-429.530) -- 0:00:39
358000 -- (-430.590) (-430.214) [-428.382] (-429.889) * (-428.779) [-427.940] (-430.558) (-430.393) -- 0:00:39
358500 -- [-428.317] (-429.862) (-428.754) (-428.536) * (-429.646) (-429.860) (-432.571) [-431.420] -- 0:00:39
359000 -- (-429.880) (-430.149) (-428.213) [-429.568] * (-428.843) (-428.569) [-429.938] (-429.047) -- 0:00:39
359500 -- (-434.299) [-430.921] (-428.638) (-428.371) * (-428.878) [-430.973] (-429.056) (-429.899) -- 0:00:39
360000 -- (-429.577) (-428.940) (-428.692) [-428.282] * (-430.499) (-430.144) [-430.779] (-428.076) -- 0:00:39
Average standard deviation of split frequencies: 0.009918
360500 -- (-429.456) (-428.456) [-431.748] (-428.088) * [-428.408] (-430.147) (-429.491) (-429.363) -- 0:00:39
361000 -- (-429.329) (-427.884) (-429.035) [-429.196] * (-427.708) (-430.553) [-427.669] (-430.829) -- 0:00:38
361500 -- (-428.807) [-429.329] (-433.080) (-430.013) * [-428.964] (-430.552) (-428.223) (-432.435) -- 0:00:38
362000 -- (-429.070) (-431.733) (-431.520) [-430.994] * (-430.446) (-430.100) (-429.732) [-430.555] -- 0:00:38
362500 -- (-428.648) (-427.558) [-432.754] (-433.084) * (-429.862) [-427.602] (-431.327) (-434.096) -- 0:00:38
363000 -- (-428.719) (-428.161) (-429.653) [-428.645] * (-431.853) (-431.348) [-432.461] (-430.286) -- 0:00:38
363500 -- (-427.324) (-427.460) [-430.211] (-428.963) * (-429.967) [-427.678] (-430.917) (-429.976) -- 0:00:38
364000 -- (-429.376) (-427.575) [-428.462] (-430.828) * (-429.205) (-429.933) [-430.928] (-429.361) -- 0:00:38
364500 -- [-433.516] (-430.694) (-430.626) (-429.743) * (-428.641) (-429.616) (-428.508) [-430.118] -- 0:00:38
365000 -- (-435.138) (-432.240) [-435.137] (-427.286) * (-430.030) [-430.128] (-427.943) (-428.933) -- 0:00:38
Average standard deviation of split frequencies: 0.009374
365500 -- (-428.697) (-429.500) (-429.914) [-427.607] * (-430.236) (-432.235) [-427.470] (-428.772) -- 0:00:38
366000 -- [-429.580] (-428.889) (-427.699) (-428.120) * (-428.546) [-431.059] (-428.854) (-428.411) -- 0:00:38
366500 -- [-429.585] (-430.872) (-429.579) (-430.599) * (-429.292) (-429.761) [-428.947] (-428.700) -- 0:00:38
367000 -- (-429.065) (-428.955) (-430.306) [-429.588] * (-429.261) (-431.133) (-427.928) [-431.940] -- 0:00:37
367500 -- (-431.786) (-427.509) (-428.413) [-428.862] * (-428.764) (-428.752) [-430.015] (-430.182) -- 0:00:37
368000 -- (-430.405) [-428.675] (-432.164) (-431.636) * (-432.393) (-428.746) (-432.832) [-429.001] -- 0:00:39
368500 -- (-429.193) (-427.495) [-429.973] (-428.938) * (-430.223) (-432.203) (-429.706) [-428.832] -- 0:00:39
369000 -- (-429.352) [-427.774] (-429.572) (-429.638) * (-430.209) (-427.542) [-431.208] (-428.537) -- 0:00:39
369500 -- [-428.100] (-430.384) (-431.197) (-431.768) * (-428.825) (-428.822) (-430.171) [-427.968] -- 0:00:39
370000 -- (-429.214) (-428.912) (-428.903) [-431.757] * (-428.684) [-428.796] (-430.236) (-427.201) -- 0:00:39
Average standard deviation of split frequencies: 0.008505
370500 -- [-429.410] (-428.617) (-431.891) (-428.096) * (-429.850) (-430.758) [-428.411] (-428.757) -- 0:00:39
371000 -- (-431.489) [-430.195] (-432.948) (-428.738) * (-428.582) (-430.181) [-430.514] (-429.460) -- 0:00:38
371500 -- [-433.769] (-428.598) (-428.586) (-431.346) * [-429.037] (-428.362) (-434.345) (-433.241) -- 0:00:38
372000 -- (-429.734) (-428.508) (-429.075) [-428.904] * (-430.993) (-429.391) [-430.648] (-431.173) -- 0:00:38
372500 -- (-429.033) [-430.272] (-429.805) (-433.578) * (-428.606) [-428.327] (-429.890) (-428.526) -- 0:00:38
373000 -- (-432.516) (-432.025) (-428.814) [-430.550] * (-428.219) (-427.949) [-430.758] (-429.514) -- 0:00:38
373500 -- (-428.883) (-428.668) [-429.428] (-430.262) * (-428.689) (-431.604) [-429.463] (-433.437) -- 0:00:38
374000 -- (-429.441) (-430.426) (-433.875) [-428.626] * [-430.655] (-429.999) (-429.929) (-428.619) -- 0:00:38
374500 -- (-433.955) (-429.039) (-428.350) [-429.015] * (-429.832) [-431.288] (-429.267) (-432.832) -- 0:00:38
375000 -- (-434.419) (-430.173) (-427.967) [-432.144] * (-428.838) (-429.405) (-433.148) [-431.103] -- 0:00:38
Average standard deviation of split frequencies: 0.008924
375500 -- (-432.157) (-429.345) [-428.300] (-431.838) * (-429.392) (-429.630) (-430.657) [-427.966] -- 0:00:38
376000 -- (-427.724) [-428.731] (-429.325) (-432.311) * (-428.766) (-429.405) [-428.517] (-430.622) -- 0:00:38
376500 -- (-430.889) (-429.789) [-427.858] (-433.883) * [-429.484] (-429.166) (-432.553) (-427.859) -- 0:00:38
377000 -- (-428.937) [-429.820] (-428.663) (-428.933) * [-428.146] (-429.946) (-428.075) (-428.423) -- 0:00:38
377500 -- (-427.854) (-427.838) (-430.857) [-430.540] * [-430.493] (-433.884) (-427.614) (-429.756) -- 0:00:37
378000 -- (-428.069) (-430.843) (-428.890) [-428.203] * (-430.961) [-431.095] (-428.023) (-428.803) -- 0:00:37
378500 -- (-430.127) [-430.142] (-428.750) (-431.721) * (-429.319) [-429.582] (-432.293) (-428.800) -- 0:00:37
379000 -- (-430.243) [-432.386] (-429.517) (-427.750) * (-431.585) [-427.554] (-428.813) (-429.917) -- 0:00:37
379500 -- (-431.132) (-427.941) [-431.953] (-432.068) * (-428.919) (-430.782) (-428.233) [-430.653] -- 0:00:37
380000 -- (-429.344) (-429.766) (-432.379) [-429.961] * (-427.604) (-429.525) [-429.503] (-428.733) -- 0:00:37
Average standard deviation of split frequencies: 0.008960
380500 -- (-429.128) (-429.405) [-433.809] (-429.993) * [-427.876] (-431.223) (-427.819) (-429.905) -- 0:00:37
381000 -- (-428.272) (-428.524) [-431.749] (-429.171) * (-429.331) (-428.005) [-428.499] (-433.583) -- 0:00:37
381500 -- [-430.759] (-428.737) (-428.640) (-430.582) * (-429.047) [-428.228] (-429.108) (-428.898) -- 0:00:37
382000 -- (-428.947) [-431.943] (-430.147) (-433.928) * (-430.950) [-428.500] (-428.403) (-429.001) -- 0:00:37
382500 -- [-429.419] (-429.746) (-427.929) (-429.544) * [-428.997] (-428.435) (-433.362) (-430.060) -- 0:00:37
383000 -- (-430.175) (-428.977) (-429.559) [-427.509] * (-431.170) [-431.059] (-428.334) (-428.747) -- 0:00:37
383500 -- (-430.210) (-430.083) (-431.046) [-427.915] * (-430.347) (-429.015) [-430.751] (-429.408) -- 0:00:38
384000 -- [-431.437] (-431.640) (-429.943) (-427.952) * (-430.387) (-428.963) (-430.415) [-428.904] -- 0:00:38
384500 -- (-429.912) [-434.963] (-430.670) (-428.785) * [-428.311] (-431.343) (-428.389) (-428.821) -- 0:00:38
385000 -- (-428.015) [-428.366] (-433.414) (-430.224) * [-429.045] (-428.418) (-429.546) (-433.884) -- 0:00:38
Average standard deviation of split frequencies: 0.009339
385500 -- (-430.532) (-430.888) (-428.708) [-430.922] * [-429.422] (-431.222) (-430.560) (-428.750) -- 0:00:38
386000 -- (-428.895) (-431.941) (-428.893) [-428.913] * (-432.863) (-427.739) (-427.913) [-429.692] -- 0:00:38
386500 -- (-429.350) (-433.542) (-428.968) [-431.183] * (-433.039) [-431.017] (-432.630) (-430.529) -- 0:00:38
387000 -- (-432.320) (-430.574) [-428.894] (-428.514) * (-428.732) (-432.828) (-434.765) [-431.569] -- 0:00:38
387500 -- (-428.394) (-430.531) [-427.314] (-428.201) * (-430.033) [-429.367] (-431.330) (-431.598) -- 0:00:37
388000 -- (-431.944) (-429.785) (-428.936) [-428.534] * (-427.908) (-429.088) [-428.320] (-434.157) -- 0:00:37
388500 -- [-432.275] (-429.999) (-433.953) (-430.375) * (-429.632) [-433.607] (-429.332) (-429.885) -- 0:00:37
389000 -- (-436.592) [-432.139] (-429.781) (-428.747) * [-428.719] (-430.178) (-438.742) (-430.028) -- 0:00:37
389500 -- (-437.884) (-430.998) [-428.544] (-430.654) * [-431.895] (-434.420) (-433.605) (-434.770) -- 0:00:37
390000 -- (-433.892) (-435.138) (-430.926) [-430.730] * (-432.023) [-429.133] (-429.482) (-429.328) -- 0:00:37
Average standard deviation of split frequencies: 0.009015
390500 -- (-429.344) (-428.608) (-430.723) [-429.378] * (-429.981) [-431.423] (-430.648) (-431.034) -- 0:00:37
391000 -- (-431.059) [-429.401] (-430.752) (-428.734) * (-430.332) (-431.229) (-428.630) [-433.045] -- 0:00:37
391500 -- (-430.142) [-428.809] (-431.234) (-427.615) * [-428.536] (-431.562) (-431.411) (-431.746) -- 0:00:37
392000 -- [-430.042] (-431.377) (-428.284) (-427.315) * (-428.391) (-430.228) [-433.715] (-429.297) -- 0:00:37
392500 -- [-429.452] (-429.699) (-431.261) (-436.487) * (-431.405) (-431.008) [-428.102] (-428.871) -- 0:00:37
393000 -- [-429.227] (-430.615) (-429.850) (-431.920) * (-431.919) (-431.012) [-428.859] (-429.823) -- 0:00:37
393500 -- (-430.239) (-427.922) (-431.716) [-428.408] * (-435.656) [-428.841] (-433.532) (-428.493) -- 0:00:36
394000 -- (-430.837) (-430.136) (-427.845) [-429.713] * (-434.890) [-429.810] (-430.786) (-430.251) -- 0:00:36
394500 -- (-429.419) (-430.204) (-429.864) [-428.686] * [-428.905] (-428.858) (-430.957) (-428.297) -- 0:00:36
395000 -- (-429.610) (-429.375) [-429.456] (-431.779) * [-429.695] (-430.121) (-431.986) (-429.281) -- 0:00:36
Average standard deviation of split frequencies: 0.008705
395500 -- (-429.170) (-428.886) (-429.837) [-428.033] * (-431.576) (-429.457) (-428.456) [-428.960] -- 0:00:36
396000 -- (-427.509) [-428.763] (-431.069) (-428.305) * (-433.383) [-428.567] (-428.776) (-429.957) -- 0:00:36
396500 -- (-427.474) (-430.131) (-427.769) [-430.366] * (-430.672) (-428.793) [-428.418] (-430.845) -- 0:00:36
397000 -- (-428.118) (-429.121) [-431.140] (-435.918) * [-429.104] (-428.824) (-430.240) (-430.915) -- 0:00:36
397500 -- [-427.472] (-428.921) (-431.909) (-431.818) * [-428.331] (-429.215) (-428.297) (-431.037) -- 0:00:36
398000 -- (-433.126) (-428.137) [-429.358] (-429.410) * (-431.726) (-429.655) [-428.369] (-432.125) -- 0:00:36
398500 -- [-429.798] (-428.358) (-428.908) (-428.216) * (-430.694) [-429.210] (-429.809) (-433.473) -- 0:00:36
399000 -- (-429.849) [-428.402] (-429.616) (-427.851) * [-431.876] (-428.366) (-429.119) (-434.023) -- 0:00:36
399500 -- (-429.691) [-429.479] (-427.538) (-428.130) * (-429.092) (-428.900) [-431.003] (-427.625) -- 0:00:37
400000 -- (-429.927) (-430.781) (-427.821) [-428.235] * (-429.544) (-432.838) [-432.090] (-428.729) -- 0:00:37
Average standard deviation of split frequencies: 0.009707
400500 -- (-433.982) (-431.393) [-434.633] (-428.889) * (-430.060) (-431.484) (-427.779) [-429.002] -- 0:00:37
401000 -- [-434.838] (-430.310) (-428.324) (-429.260) * (-428.618) (-433.260) (-429.345) [-428.301] -- 0:00:37
401500 -- (-428.974) (-428.943) [-427.970] (-429.366) * (-428.321) [-429.639] (-431.611) (-428.469) -- 0:00:37
402000 -- (-427.624) (-430.218) (-430.988) [-429.883] * (-430.567) [-427.443] (-429.041) (-428.554) -- 0:00:37
402500 -- (-431.899) [-430.215] (-428.516) (-429.768) * (-432.032) (-428.430) [-429.278] (-429.465) -- 0:00:37
403000 -- [-428.236] (-427.652) (-427.905) (-431.654) * [-430.193] (-428.738) (-428.312) (-433.150) -- 0:00:37
403500 -- (-428.716) (-430.280) [-431.163] (-427.446) * (-428.942) [-434.902] (-434.960) (-427.445) -- 0:00:36
404000 -- (-429.966) (-431.880) [-429.482] (-427.611) * (-430.126) (-429.425) [-431.883] (-429.845) -- 0:00:36
404500 -- (-432.296) (-435.209) (-431.390) [-429.441] * (-432.335) (-433.237) (-432.635) [-430.247] -- 0:00:36
405000 -- (-432.645) (-430.296) [-430.604] (-429.471) * (-428.587) (-428.545) [-430.389] (-430.378) -- 0:00:36
Average standard deviation of split frequencies: 0.009797
405500 -- [-429.263] (-430.429) (-428.639) (-430.960) * (-430.709) (-428.803) (-429.771) [-432.960] -- 0:00:36
406000 -- [-430.297] (-429.982) (-431.307) (-432.224) * (-430.498) (-429.398) [-428.384] (-428.126) -- 0:00:36
406500 -- [-433.935] (-429.387) (-429.696) (-428.230) * [-431.908] (-431.720) (-430.085) (-431.039) -- 0:00:36
407000 -- (-429.843) (-427.867) (-435.415) [-430.522] * [-431.076] (-433.932) (-428.516) (-428.215) -- 0:00:36
407500 -- (-430.035) (-428.616) (-428.443) [-427.636] * (-431.688) (-431.312) (-429.845) [-429.192] -- 0:00:36
408000 -- (-430.303) (-427.535) (-430.285) [-428.808] * (-428.631) [-429.711] (-427.972) (-428.873) -- 0:00:36
408500 -- [-430.970] (-427.812) (-429.937) (-428.006) * (-428.084) (-431.454) [-431.518] (-429.612) -- 0:00:36
409000 -- (-430.954) (-428.602) (-427.887) [-428.625] * [-427.879] (-431.376) (-431.557) (-428.764) -- 0:00:36
409500 -- (-430.661) (-430.652) (-427.758) [-428.786] * (-428.405) (-430.778) (-430.048) [-430.927] -- 0:00:36
410000 -- (-431.036) [-428.760] (-431.904) (-429.267) * [-428.862] (-430.370) (-429.596) (-428.726) -- 0:00:35
Average standard deviation of split frequencies: 0.009398
410500 -- (-433.013) [-430.797] (-430.241) (-428.374) * (-429.556) (-429.954) (-427.711) [-429.446] -- 0:00:35
411000 -- (-429.600) (-430.120) (-429.899) [-429.783] * (-436.025) [-427.952] (-430.275) (-429.639) -- 0:00:35
411500 -- [-431.203] (-431.399) (-430.947) (-430.631) * (-427.908) (-429.351) (-431.500) [-431.857] -- 0:00:35
412000 -- [-430.072] (-431.621) (-432.810) (-431.244) * (-434.966) [-428.191] (-430.284) (-431.188) -- 0:00:35
412500 -- (-429.754) (-429.671) [-428.549] (-428.880) * (-429.201) [-429.237] (-431.394) (-431.303) -- 0:00:35
413000 -- (-430.015) (-432.616) (-428.947) [-430.214] * [-428.160] (-428.085) (-429.897) (-429.658) -- 0:00:35
413500 -- (-432.262) (-430.108) [-430.564] (-431.559) * [-429.890] (-432.335) (-432.833) (-434.427) -- 0:00:35
414000 -- (-434.939) [-429.575] (-430.902) (-429.153) * (-434.077) [-429.992] (-429.581) (-433.331) -- 0:00:36
414500 -- (-432.372) [-430.754] (-429.013) (-428.571) * (-427.959) [-430.588] (-427.473) (-429.177) -- 0:00:36
415000 -- (-431.660) (-430.043) [-430.967] (-430.083) * [-428.331] (-429.975) (-429.857) (-429.451) -- 0:00:36
Average standard deviation of split frequencies: 0.008145
415500 -- (-430.205) [-432.736] (-428.453) (-429.522) * (-430.629) (-430.025) [-429.995] (-433.318) -- 0:00:36
416000 -- (-435.995) (-430.148) (-431.422) [-428.892] * (-430.464) (-428.263) [-429.463] (-427.879) -- 0:00:36
416500 -- (-429.188) [-428.910] (-433.190) (-428.930) * [-430.815] (-429.614) (-431.509) (-431.646) -- 0:00:36
417000 -- (-432.474) (-427.648) (-431.847) [-428.933] * (-432.183) (-429.782) (-429.380) [-428.242] -- 0:00:36
417500 -- [-430.849] (-434.168) (-431.235) (-432.362) * (-431.289) (-431.991) [-429.036] (-429.123) -- 0:00:36
418000 -- [-431.366] (-428.324) (-430.142) (-430.066) * [-429.796] (-428.960) (-430.890) (-431.361) -- 0:00:36
418500 -- (-429.422) [-428.601] (-429.263) (-430.781) * [-428.312] (-432.261) (-432.770) (-431.338) -- 0:00:36
419000 -- (-431.207) (-429.580) (-429.420) [-430.907] * [-430.479] (-428.072) (-428.027) (-430.407) -- 0:00:36
419500 -- (-433.441) [-429.177] (-430.325) (-428.620) * [-430.381] (-427.687) (-430.326) (-432.615) -- 0:00:35
420000 -- (-429.171) (-428.370) [-428.394] (-429.261) * (-429.201) (-427.976) [-439.481] (-430.667) -- 0:00:35
Average standard deviation of split frequencies: 0.008265
420500 -- (-429.985) [-431.301] (-430.661) (-428.596) * (-432.036) (-428.197) [-431.306] (-431.869) -- 0:00:35
421000 -- [-435.018] (-430.108) (-430.273) (-430.811) * (-430.726) (-436.099) (-429.537) [-428.326] -- 0:00:35
421500 -- (-433.553) [-428.563] (-427.637) (-429.551) * (-430.774) (-429.174) (-430.117) [-429.875] -- 0:00:35
422000 -- (-429.122) [-427.634] (-434.145) (-429.025) * [-429.930] (-429.805) (-430.321) (-428.589) -- 0:00:35
422500 -- (-427.871) [-430.993] (-429.659) (-429.164) * (-438.591) (-433.293) [-432.121] (-430.448) -- 0:00:35
423000 -- (-427.893) (-429.559) [-427.808] (-430.106) * (-430.056) (-430.120) [-428.930] (-431.302) -- 0:00:35
423500 -- [-428.167] (-433.367) (-434.412) (-430.532) * (-429.319) (-430.616) (-430.889) [-429.699] -- 0:00:35
424000 -- (-428.875) (-430.245) [-429.323] (-431.670) * (-428.876) [-431.512] (-428.438) (-430.027) -- 0:00:35
424500 -- (-431.264) (-427.885) [-429.559] (-429.956) * (-428.592) [-433.231] (-427.697) (-430.082) -- 0:00:35
425000 -- (-431.227) (-430.352) [-428.857] (-427.591) * (-428.806) (-430.077) (-430.945) [-429.253] -- 0:00:35
Average standard deviation of split frequencies: 0.008369
425500 -- (-431.098) (-435.761) (-429.099) [-428.766] * (-428.912) [-428.006] (-428.064) (-432.325) -- 0:00:35
426000 -- (-429.052) (-428.387) [-429.208] (-429.133) * [-428.071] (-430.124) (-432.899) (-430.279) -- 0:00:35
426500 -- [-429.162] (-429.014) (-428.136) (-430.742) * (-429.093) (-431.220) (-428.328) [-427.567] -- 0:00:34
427000 -- (-430.357) (-430.512) [-429.533] (-429.885) * (-429.528) (-427.957) [-428.088] (-429.842) -- 0:00:34
427500 -- [-428.328] (-431.095) (-431.203) (-429.226) * [-433.212] (-428.675) (-430.668) (-428.529) -- 0:00:34
428000 -- (-430.180) (-428.431) [-431.408] (-429.886) * (-434.330) (-431.970) [-428.893] (-433.219) -- 0:00:34
428500 -- (-431.830) (-428.141) (-428.202) [-428.417] * (-436.244) (-429.394) [-427.660] (-433.354) -- 0:00:34
429000 -- (-431.312) [-428.924] (-429.041) (-428.071) * (-436.843) (-429.080) [-430.927] (-429.179) -- 0:00:34
429500 -- (-434.754) (-430.747) [-431.827] (-432.823) * (-430.957) [-429.063] (-428.782) (-427.735) -- 0:00:34
430000 -- [-429.685] (-430.357) (-430.901) (-427.930) * (-428.043) [-427.743] (-427.959) (-431.676) -- 0:00:34
Average standard deviation of split frequencies: 0.008465
430500 -- [-433.118] (-429.623) (-430.559) (-428.729) * [-428.491] (-429.108) (-428.188) (-430.480) -- 0:00:35
431000 -- (-430.017) (-430.057) [-429.895] (-427.891) * (-429.288) [-427.655] (-428.223) (-428.779) -- 0:00:35
431500 -- (-430.437) (-432.375) (-433.460) [-428.609] * (-429.117) [-430.026] (-429.432) (-431.354) -- 0:00:35
432000 -- (-430.448) (-429.281) [-427.869] (-430.503) * [-429.742] (-428.645) (-429.618) (-428.778) -- 0:00:35
432500 -- (-430.640) (-429.510) [-427.617] (-431.996) * (-427.956) [-429.312] (-430.099) (-432.123) -- 0:00:35
433000 -- (-428.759) [-433.896] (-435.490) (-430.092) * (-427.796) (-433.195) (-428.780) [-429.554] -- 0:00:35
433500 -- (-429.180) [-429.656] (-428.954) (-427.984) * (-427.731) (-429.287) (-429.032) [-432.296] -- 0:00:35
434000 -- (-429.496) (-429.572) (-427.574) [-428.211] * (-437.063) (-429.746) [-428.991] (-428.130) -- 0:00:35
434500 -- (-429.760) [-428.309] (-430.689) (-428.240) * (-427.347) [-430.415] (-427.692) (-429.389) -- 0:00:35
435000 -- (-429.516) (-428.642) [-429.547] (-428.936) * (-428.917) [-427.935] (-431.373) (-429.798) -- 0:00:35
Average standard deviation of split frequencies: 0.009298
435500 -- (-430.347) (-428.382) [-430.501] (-431.899) * [-429.592] (-427.706) (-429.520) (-428.586) -- 0:00:34
436000 -- (-430.699) (-428.125) (-430.599) [-429.853] * [-432.848] (-428.280) (-429.525) (-428.229) -- 0:00:34
436500 -- (-430.867) (-428.853) (-431.319) [-430.623] * (-430.975) [-427.411] (-430.034) (-429.848) -- 0:00:34
437000 -- (-430.232) [-433.635] (-431.714) (-430.689) * (-429.716) [-428.792] (-427.838) (-431.091) -- 0:00:34
437500 -- (-428.324) (-432.852) (-428.860) [-428.368] * (-429.355) (-431.313) [-428.303] (-428.860) -- 0:00:34
438000 -- (-429.688) (-430.904) [-427.997] (-429.705) * [-428.908] (-434.302) (-427.718) (-430.104) -- 0:00:34
438500 -- [-427.599] (-430.565) (-428.181) (-428.575) * (-427.495) (-430.898) (-428.824) [-430.555] -- 0:00:34
439000 -- (-429.932) (-429.057) [-429.733] (-429.846) * (-430.110) [-431.006] (-427.967) (-430.163) -- 0:00:34
439500 -- (-430.878) [-427.431] (-429.346) (-431.261) * [-433.570] (-429.004) (-432.177) (-430.309) -- 0:00:34
440000 -- [-430.882] (-427.650) (-431.874) (-432.077) * (-429.339) [-429.715] (-427.853) (-429.493) -- 0:00:34
Average standard deviation of split frequencies: 0.009343
440500 -- (-429.149) (-428.890) (-430.361) [-428.424] * (-430.198) [-428.660] (-428.103) (-430.001) -- 0:00:34
441000 -- (-430.681) (-431.193) [-428.930] (-428.131) * (-435.082) (-430.034) (-429.625) [-429.345] -- 0:00:34
441500 -- (-430.474) (-428.258) (-429.101) [-428.746] * (-428.653) [-428.903] (-431.938) (-429.142) -- 0:00:34
442000 -- [-428.747] (-427.764) (-430.569) (-430.342) * [-427.877] (-429.024) (-429.049) (-433.371) -- 0:00:34
442500 -- [-429.142] (-431.179) (-427.759) (-429.592) * (-429.086) [-429.153] (-430.709) (-428.380) -- 0:00:34
443000 -- (-430.423) [-429.216] (-429.517) (-429.491) * (-428.873) [-429.328] (-433.165) (-432.185) -- 0:00:33
443500 -- [-429.546] (-429.779) (-430.736) (-429.635) * (-432.961) (-427.541) (-431.236) [-428.096] -- 0:00:33
444000 -- (-429.246) (-428.756) [-429.111] (-430.325) * (-434.284) (-429.047) [-431.560] (-428.817) -- 0:00:33
444500 -- (-432.658) [-428.786] (-428.935) (-428.714) * (-427.924) (-429.580) (-430.328) [-428.235] -- 0:00:33
445000 -- (-431.605) (-430.359) (-428.337) [-428.795] * (-428.167) (-428.947) [-428.174] (-429.609) -- 0:00:33
Average standard deviation of split frequencies: 0.009231
445500 -- (-432.397) [-428.349] (-430.245) (-429.489) * (-428.591) [-431.960] (-431.648) (-428.926) -- 0:00:33
446000 -- [-428.891] (-429.558) (-428.616) (-428.302) * [-430.201] (-428.648) (-429.215) (-431.040) -- 0:00:33
446500 -- [-428.918] (-431.045) (-428.892) (-429.424) * (-434.467) (-428.185) [-429.157] (-428.383) -- 0:00:34
447000 -- (-436.529) [-430.000] (-428.386) (-427.688) * (-430.068) [-428.106] (-427.686) (-430.098) -- 0:00:34
447500 -- [-432.458] (-427.997) (-432.078) (-427.563) * (-427.603) [-429.536] (-428.649) (-431.322) -- 0:00:34
448000 -- [-432.015] (-427.486) (-431.005) (-431.200) * (-431.116) (-428.971) [-431.802] (-431.800) -- 0:00:34
448500 -- (-433.376) (-430.201) (-434.006) [-428.506] * (-429.204) [-430.448] (-431.083) (-431.703) -- 0:00:34
449000 -- [-428.971] (-427.958) (-434.251) (-430.288) * (-429.048) [-430.599] (-432.763) (-431.487) -- 0:00:34
449500 -- [-429.527] (-428.856) (-428.921) (-428.347) * (-431.403) (-427.361) (-431.322) [-430.906] -- 0:00:34
450000 -- (-429.351) (-430.360) (-429.239) [-429.453] * (-429.179) [-431.110] (-431.277) (-430.823) -- 0:00:34
Average standard deviation of split frequencies: 0.009065
450500 -- [-427.301] (-431.428) (-428.963) (-431.613) * [-430.366] (-431.716) (-430.119) (-429.883) -- 0:00:34
451000 -- [-430.112] (-427.558) (-429.998) (-432.655) * (-432.094) [-430.332] (-427.806) (-428.914) -- 0:00:34
451500 -- (-431.914) (-428.089) (-430.622) [-429.479] * [-429.667] (-428.379) (-431.278) (-431.760) -- 0:00:34
452000 -- (-430.214) (-428.919) (-432.638) [-429.232] * (-428.482) (-429.849) (-429.328) [-428.248] -- 0:00:33
452500 -- (-437.043) (-429.735) (-429.587) [-428.451] * [-427.957] (-430.002) (-427.605) (-430.675) -- 0:00:33
453000 -- (-428.699) [-431.055] (-434.140) (-430.024) * (-429.244) (-428.977) [-428.943] (-429.751) -- 0:00:33
453500 -- (-431.095) (-430.078) [-428.503] (-429.296) * (-433.058) (-428.933) (-428.545) [-427.465] -- 0:00:33
454000 -- [-427.324] (-431.358) (-427.865) (-433.068) * (-428.870) [-430.662] (-431.273) (-427.421) -- 0:00:33
454500 -- [-429.293] (-431.664) (-429.167) (-436.527) * [-435.478] (-429.413) (-429.186) (-427.285) -- 0:00:33
455000 -- (-432.454) (-430.492) [-429.397] (-428.324) * (-429.583) (-428.282) (-430.619) [-428.663] -- 0:00:33
Average standard deviation of split frequencies: 0.009373
455500 -- (-429.412) (-432.319) (-428.000) [-431.540] * (-430.307) (-430.070) (-429.652) [-429.257] -- 0:00:33
456000 -- (-430.036) (-430.698) (-428.092) [-430.473] * (-432.685) (-431.103) [-429.326] (-429.726) -- 0:00:33
456500 -- (-429.353) [-430.097] (-428.314) (-430.119) * [-429.081] (-427.947) (-428.278) (-430.844) -- 0:00:33
457000 -- (-428.385) (-428.400) [-431.182] (-429.999) * (-429.387) [-431.090] (-432.241) (-432.690) -- 0:00:33
457500 -- [-429.637] (-430.381) (-431.956) (-431.697) * (-432.105) (-428.458) [-429.184] (-430.023) -- 0:00:33
458000 -- (-428.014) (-430.720) (-432.747) [-431.498] * (-429.332) [-427.911] (-432.470) (-428.070) -- 0:00:33
458500 -- [-427.775] (-429.997) (-431.757) (-429.939) * [-429.624] (-428.228) (-428.547) (-428.296) -- 0:00:33
459000 -- (-429.962) (-429.676) (-428.185) [-430.192] * [-430.692] (-428.830) (-430.174) (-427.792) -- 0:00:33
459500 -- [-429.362] (-429.166) (-431.961) (-427.988) * [-431.348] (-428.266) (-428.971) (-430.386) -- 0:00:32
460000 -- [-429.563] (-428.895) (-429.960) (-431.524) * (-431.578) (-433.437) [-430.605] (-429.999) -- 0:00:32
Average standard deviation of split frequencies: 0.009687
460500 -- (-431.022) (-431.973) [-428.345] (-431.067) * [-430.480] (-428.478) (-428.647) (-428.608) -- 0:00:32
461000 -- (-431.606) (-430.503) (-427.874) [-428.535] * (-429.271) (-428.384) [-428.416] (-430.582) -- 0:00:32
461500 -- (-428.129) (-428.509) (-431.049) [-432.078] * (-428.753) (-429.310) [-432.660] (-430.997) -- 0:00:32
462000 -- [-429.893] (-428.973) (-429.100) (-436.177) * (-428.989) [-435.840] (-427.864) (-430.919) -- 0:00:32
462500 -- [-430.107] (-428.911) (-431.240) (-432.231) * (-432.032) (-432.357) (-430.267) [-428.323] -- 0:00:32
463000 -- [-429.861] (-428.134) (-430.786) (-429.148) * (-428.580) (-428.233) (-429.535) [-428.537] -- 0:00:33
463500 -- (-431.102) (-429.416) [-431.220] (-430.491) * (-430.682) (-428.830) (-428.109) [-427.965] -- 0:00:33
464000 -- [-429.820] (-433.106) (-428.888) (-431.098) * (-429.979) [-428.149] (-430.061) (-430.420) -- 0:00:33
464500 -- (-430.457) (-438.410) [-429.698] (-431.059) * (-429.800) [-429.202] (-430.313) (-429.931) -- 0:00:33
465000 -- [-430.292] (-428.465) (-428.080) (-429.225) * (-430.881) (-428.166) [-430.449] (-431.351) -- 0:00:33
Average standard deviation of split frequencies: 0.009779
465500 -- (-433.063) (-428.303) [-429.241] (-431.481) * (-433.935) (-428.075) [-429.789] (-428.689) -- 0:00:33
466000 -- [-427.615] (-432.008) (-430.308) (-430.507) * [-430.340] (-427.548) (-430.360) (-427.547) -- 0:00:33
466500 -- (-429.859) (-429.993) (-428.176) [-428.419] * (-430.722) [-428.559] (-429.844) (-427.824) -- 0:00:33
467000 -- (-429.526) (-434.132) [-428.335] (-429.085) * (-427.407) (-429.110) (-431.114) [-429.687] -- 0:00:33
467500 -- [-430.327] (-431.394) (-431.444) (-430.962) * (-429.918) (-432.207) (-432.918) [-430.238] -- 0:00:33
468000 -- (-429.504) [-430.789] (-431.334) (-428.265) * (-430.363) [-430.652] (-431.982) (-429.334) -- 0:00:32
468500 -- (-429.274) (-434.734) (-431.714) [-430.005] * (-433.316) (-432.595) [-429.804] (-428.412) -- 0:00:32
469000 -- (-431.305) (-430.988) [-428.622] (-428.647) * (-429.866) [-429.146] (-429.162) (-428.787) -- 0:00:32
469500 -- (-432.488) [-430.790] (-433.601) (-428.115) * (-427.742) [-428.455] (-432.881) (-427.695) -- 0:00:32
470000 -- (-428.743) (-428.034) [-431.809] (-431.675) * (-432.068) (-430.393) [-429.329] (-428.488) -- 0:00:32
Average standard deviation of split frequencies: 0.009882
470500 -- (-427.712) [-428.246] (-428.079) (-432.631) * [-430.579] (-432.048) (-432.690) (-431.650) -- 0:00:32
471000 -- [-428.680] (-431.692) (-428.681) (-431.277) * (-427.850) [-428.038] (-429.070) (-429.447) -- 0:00:32
471500 -- (-428.736) (-428.299) [-428.339] (-428.777) * (-428.749) (-431.966) [-430.522] (-428.869) -- 0:00:32
472000 -- [-430.450] (-427.861) (-432.077) (-429.207) * (-430.530) (-429.618) (-428.843) [-430.335] -- 0:00:32
472500 -- (-432.893) (-428.713) [-429.530] (-429.496) * (-432.580) [-428.522] (-427.841) (-431.556) -- 0:00:32
473000 -- [-428.852] (-429.678) (-428.346) (-435.643) * [-428.606] (-428.541) (-432.918) (-431.787) -- 0:00:32
473500 -- (-432.195) [-430.557] (-429.679) (-428.988) * (-431.256) (-429.770) [-428.943] (-427.725) -- 0:00:32
474000 -- (-432.991) [-430.057] (-427.386) (-429.572) * [-429.827] (-429.503) (-429.438) (-429.846) -- 0:00:32
474500 -- [-428.962] (-431.379) (-432.865) (-427.939) * (-429.286) (-429.928) (-431.177) [-427.333] -- 0:00:32
475000 -- (-428.935) (-430.683) (-430.253) [-428.368] * [-429.295] (-431.281) (-429.925) (-427.837) -- 0:00:32
Average standard deviation of split frequencies: 0.009045
475500 -- (-430.017) [-430.677] (-429.320) (-434.259) * (-430.189) (-432.151) [-432.997] (-430.248) -- 0:00:31
476000 -- [-429.022] (-431.176) (-429.722) (-430.509) * (-434.724) (-430.497) (-431.392) [-430.651] -- 0:00:31
476500 -- (-429.783) [-429.760] (-429.544) (-435.575) * (-430.173) (-438.454) [-428.531] (-429.504) -- 0:00:31
477000 -- (-428.839) (-430.088) (-429.647) [-434.906] * [-430.250] (-430.213) (-432.751) (-428.175) -- 0:00:31
477500 -- (-428.700) [-428.931] (-429.153) (-433.517) * (-433.086) (-428.564) [-430.166] (-432.395) -- 0:00:31
478000 -- (-428.260) (-428.665) [-428.027] (-429.507) * (-434.301) (-432.205) [-430.632] (-430.475) -- 0:00:31
478500 -- (-430.598) [-430.642] (-429.797) (-428.952) * (-435.529) [-429.171] (-430.874) (-432.400) -- 0:00:31
479000 -- (-429.174) (-433.852) (-427.834) [-427.668] * (-431.363) [-428.561] (-428.211) (-433.781) -- 0:00:32
479500 -- (-428.492) (-433.956) [-428.145] (-434.899) * (-434.423) [-428.675] (-428.059) (-428.916) -- 0:00:32
480000 -- [-428.554] (-436.222) (-427.893) (-430.205) * (-428.733) (-430.659) (-433.044) [-427.637] -- 0:00:32
Average standard deviation of split frequencies: 0.009501
480500 -- (-427.347) (-427.843) (-429.233) [-428.436] * (-431.463) (-428.162) (-428.775) [-429.179] -- 0:00:32
481000 -- (-429.128) (-429.760) [-431.675] (-428.563) * (-429.350) [-427.478] (-430.944) (-432.005) -- 0:00:32
481500 -- (-430.571) (-430.667) (-432.799) [-428.700] * (-430.116) (-428.385) [-428.109] (-428.086) -- 0:00:32
482000 -- (-430.074) (-429.858) (-431.683) [-430.863] * (-430.454) [-430.773] (-427.270) (-428.877) -- 0:00:32
482500 -- (-431.114) (-428.383) [-429.608] (-430.441) * (-429.979) (-434.684) (-433.258) [-428.601] -- 0:00:32
483000 -- (-428.908) [-430.029] (-428.827) (-431.694) * (-428.574) (-432.636) (-432.100) [-428.696] -- 0:00:32
483500 -- (-428.995) (-431.053) (-430.410) [-435.283] * (-429.908) [-428.576] (-428.371) (-429.323) -- 0:00:32
484000 -- (-428.798) (-429.054) (-429.095) [-434.164] * (-431.614) (-431.235) (-430.671) [-429.433] -- 0:00:31
484500 -- (-429.242) [-428.705] (-427.826) (-428.886) * (-429.831) (-429.739) [-428.507] (-427.884) -- 0:00:31
485000 -- [-427.190] (-427.850) (-429.213) (-433.551) * (-428.860) (-428.397) [-429.786] (-428.177) -- 0:00:31
Average standard deviation of split frequencies: 0.009700
485500 -- (-429.203) (-427.540) [-427.931] (-433.945) * (-429.221) [-429.036] (-428.724) (-430.177) -- 0:00:31
486000 -- (-429.224) [-427.863] (-427.858) (-430.052) * (-432.816) [-429.130] (-428.488) (-432.193) -- 0:00:31
486500 -- (-429.485) [-428.038] (-430.992) (-428.011) * [-431.753] (-428.955) (-432.668) (-432.663) -- 0:00:31
487000 -- (-432.213) [-428.271] (-440.452) (-427.953) * (-433.897) [-430.018] (-430.676) (-430.101) -- 0:00:31
487500 -- (-429.049) (-431.675) (-434.096) [-428.359] * (-431.462) (-431.671) (-433.748) [-430.236] -- 0:00:31
488000 -- [-428.060] (-432.969) (-432.499) (-429.563) * (-427.780) [-431.372] (-429.371) (-431.432) -- 0:00:31
488500 -- [-429.076] (-432.286) (-430.689) (-430.311) * [-428.152] (-438.022) (-432.458) (-430.764) -- 0:00:31
489000 -- [-427.682] (-433.697) (-428.696) (-428.124) * [-428.317] (-432.471) (-427.793) (-429.333) -- 0:00:31
489500 -- (-427.765) (-429.481) (-429.178) [-427.495] * [-430.225] (-428.612) (-429.782) (-428.538) -- 0:00:31
490000 -- [-433.983] (-429.539) (-430.796) (-427.953) * [-428.992] (-427.728) (-429.893) (-428.715) -- 0:00:31
Average standard deviation of split frequencies: 0.009367
490500 -- (-429.805) [-428.091] (-433.510) (-427.475) * (-431.140) (-428.092) (-429.397) [-427.573] -- 0:00:31
491000 -- (-432.236) (-435.060) [-434.932] (-427.933) * (-429.151) (-430.008) (-428.065) [-430.052] -- 0:00:31
491500 -- (-430.142) (-430.627) [-431.431] (-427.869) * (-430.471) (-432.041) (-430.310) [-430.503] -- 0:00:31
492000 -- (-431.481) (-433.661) [-431.269] (-429.278) * (-428.772) (-431.326) [-431.499] (-428.960) -- 0:00:30
492500 -- [-430.754] (-430.603) (-428.751) (-428.359) * (-431.444) (-429.462) (-428.811) [-429.703] -- 0:00:30
493000 -- (-431.742) (-429.343) [-428.163] (-430.920) * (-431.417) (-429.566) [-428.275] (-430.109) -- 0:00:30
493500 -- [-431.362] (-431.291) (-428.529) (-428.897) * (-436.177) [-429.471] (-428.479) (-427.982) -- 0:00:30
494000 -- (-431.045) (-427.724) [-430.362] (-429.318) * [-428.065] (-428.445) (-428.380) (-432.061) -- 0:00:30
494500 -- (-428.216) (-429.440) (-431.818) [-427.845] * (-430.491) (-430.228) (-428.407) [-430.609] -- 0:00:30
495000 -- [-427.523] (-429.858) (-428.182) (-427.804) * (-431.435) (-429.138) (-429.043) [-429.254] -- 0:00:30
Average standard deviation of split frequencies: 0.009207
495500 -- (-428.921) (-429.582) (-430.849) [-428.836] * (-428.613) [-428.263] (-429.421) (-428.514) -- 0:00:31
496000 -- (-429.908) (-428.980) [-430.241] (-430.193) * (-427.423) (-430.252) [-429.105] (-429.235) -- 0:00:31
496500 -- [-431.421] (-435.417) (-431.844) (-430.414) * (-428.256) (-429.252) (-429.118) [-429.454] -- 0:00:31
497000 -- [-429.360] (-429.709) (-431.284) (-428.076) * [-429.974] (-428.780) (-429.810) (-429.015) -- 0:00:31
497500 -- (-428.206) [-429.209] (-435.217) (-428.378) * (-433.370) (-428.325) (-433.881) [-434.379] -- 0:00:31
498000 -- (-427.923) [-428.618] (-436.898) (-427.634) * [-428.534] (-427.740) (-433.356) (-433.075) -- 0:00:31
498500 -- (-432.187) [-429.163] (-431.125) (-429.341) * (-428.993) (-433.157) (-433.811) [-428.838] -- 0:00:31
499000 -- (-430.632) (-429.639) (-429.316) [-430.010] * [-431.616] (-430.112) (-429.886) (-430.154) -- 0:00:31
499500 -- (-431.049) [-428.820] (-432.684) (-430.575) * [-430.382] (-429.079) (-429.779) (-433.739) -- 0:00:31
500000 -- (-433.425) [-433.103] (-430.284) (-427.839) * (-432.730) (-430.678) [-429.630] (-429.213) -- 0:00:31
Average standard deviation of split frequencies: 0.007470
500500 -- [-429.366] (-433.217) (-428.280) (-428.002) * (-436.186) [-431.206] (-429.369) (-428.619) -- 0:00:30
501000 -- (-430.752) (-433.369) (-428.551) [-429.391] * [-428.151] (-428.433) (-428.288) (-433.434) -- 0:00:30
501500 -- (-429.810) [-430.233] (-428.449) (-429.198) * [-431.268] (-431.648) (-427.977) (-435.734) -- 0:00:30
502000 -- (-430.160) (-429.490) [-432.604] (-428.561) * (-427.466) [-431.230] (-431.415) (-434.817) -- 0:00:30
502500 -- (-430.374) (-429.341) (-434.005) [-428.524] * [-431.370] (-431.769) (-431.470) (-435.077) -- 0:00:30
503000 -- [-429.019] (-427.786) (-433.273) (-428.180) * (-429.849) (-427.371) [-428.579] (-429.668) -- 0:00:30
503500 -- (-434.194) [-432.535] (-431.577) (-428.152) * (-431.201) (-428.648) [-428.764] (-428.453) -- 0:00:30
504000 -- (-430.927) [-429.897] (-428.262) (-430.366) * (-429.971) [-429.854] (-429.510) (-429.367) -- 0:00:30
504500 -- (-430.902) [-428.927] (-430.792) (-430.782) * (-429.173) [-427.775] (-428.532) (-429.055) -- 0:00:30
505000 -- (-432.198) (-429.463) (-428.963) [-429.139] * (-428.128) [-429.031] (-430.206) (-427.411) -- 0:00:30
Average standard deviation of split frequencies: 0.008443
505500 -- [-430.972] (-429.338) (-428.860) (-428.696) * (-429.735) [-430.705] (-429.586) (-428.930) -- 0:00:30
506000 -- (-429.954) (-427.559) (-428.653) [-431.576] * (-427.885) [-428.529] (-428.808) (-427.921) -- 0:00:30
506500 -- (-430.065) (-429.716) (-428.918) [-430.989] * (-428.137) (-429.835) [-428.112] (-430.325) -- 0:00:30
507000 -- [-427.892] (-428.780) (-429.906) (-429.604) * [-431.971] (-429.586) (-427.850) (-431.801) -- 0:00:30
507500 -- [-427.649] (-428.333) (-428.933) (-431.399) * (-429.024) [-429.847] (-430.992) (-428.328) -- 0:00:30
508000 -- (-428.757) (-432.063) (-428.628) [-429.297] * [-429.575] (-428.691) (-428.689) (-428.198) -- 0:00:30
508500 -- (-428.552) [-432.075] (-427.784) (-430.700) * (-428.633) (-428.307) [-427.895] (-428.981) -- 0:00:29
509000 -- (-429.473) (-429.368) [-428.298] (-434.760) * (-427.947) (-429.151) [-429.093] (-429.692) -- 0:00:29
509500 -- (-430.211) (-428.745) [-428.516] (-427.453) * [-430.209] (-430.114) (-438.318) (-427.835) -- 0:00:29
510000 -- [-428.708] (-430.550) (-428.353) (-429.693) * (-430.036) [-429.185] (-429.077) (-427.668) -- 0:00:29
Average standard deviation of split frequencies: 0.007904
510500 -- (-433.137) (-428.692) [-427.995] (-427.603) * (-428.194) (-428.053) (-428.375) [-430.782] -- 0:00:29
511000 -- (-428.198) (-427.658) [-428.634] (-429.785) * (-431.900) (-429.429) [-433.015] (-429.438) -- 0:00:29
511500 -- (-428.511) (-427.654) [-429.776] (-428.236) * (-428.017) [-428.661] (-431.934) (-428.439) -- 0:00:29
512000 -- [-432.801] (-430.587) (-428.320) (-428.439) * (-429.147) (-428.055) [-427.685] (-430.475) -- 0:00:30
512500 -- (-433.350) (-427.773) [-428.580] (-429.159) * (-433.622) (-430.406) (-427.450) [-427.578] -- 0:00:30
513000 -- (-435.031) [-430.942] (-427.531) (-428.085) * [-429.271] (-431.614) (-428.067) (-428.706) -- 0:00:30
513500 -- (-431.554) (-429.633) (-431.185) [-429.532] * (-430.431) [-427.495] (-429.452) (-428.765) -- 0:00:30
514000 -- (-428.310) (-428.251) (-430.903) [-428.292] * (-428.136) (-433.024) [-431.098] (-428.169) -- 0:00:30
514500 -- (-430.064) (-431.283) (-430.299) [-429.462] * (-427.908) [-430.421] (-430.727) (-429.348) -- 0:00:30
515000 -- [-430.231] (-428.748) (-429.919) (-428.594) * (-429.461) (-428.490) (-433.232) [-427.517] -- 0:00:30
Average standard deviation of split frequencies: 0.006909
515500 -- (-430.241) (-427.861) (-427.955) [-429.527] * (-429.906) (-429.417) [-429.021] (-427.211) -- 0:00:30
516000 -- (-433.342) [-429.596] (-430.821) (-427.976) * [-429.251] (-428.164) (-432.157) (-431.371) -- 0:00:30
516500 -- (-431.323) (-430.010) [-429.084] (-429.898) * (-429.346) [-430.078] (-434.374) (-430.656) -- 0:00:29
517000 -- [-428.834] (-429.279) (-428.491) (-431.872) * (-427.777) (-430.904) [-430.324] (-429.171) -- 0:00:29
517500 -- (-429.568) (-430.532) [-432.477] (-430.844) * (-429.782) [-434.764] (-429.566) (-434.078) -- 0:00:29
518000 -- (-431.840) [-427.635] (-430.310) (-428.599) * [-428.959] (-433.496) (-429.152) (-428.497) -- 0:00:29
518500 -- (-430.351) (-428.345) (-430.331) [-429.542] * [-429.299] (-432.106) (-429.858) (-427.823) -- 0:00:29
519000 -- [-428.018] (-427.495) (-430.963) (-429.262) * [-429.009] (-430.461) (-431.280) (-428.724) -- 0:00:29
519500 -- [-428.688] (-427.601) (-430.905) (-429.744) * (-427.310) [-430.413] (-429.999) (-430.981) -- 0:00:29
520000 -- [-429.244] (-428.744) (-428.554) (-429.928) * (-429.240) (-428.854) (-433.177) [-431.801] -- 0:00:29
Average standard deviation of split frequencies: 0.007413
520500 -- (-428.957) [-428.998] (-428.393) (-430.614) * [-430.037] (-429.028) (-433.003) (-428.818) -- 0:00:29
521000 -- (-431.154) [-428.155] (-427.858) (-428.703) * [-429.364] (-428.348) (-429.071) (-427.830) -- 0:00:29
521500 -- (-434.726) [-432.124] (-430.679) (-428.974) * (-430.411) (-428.846) [-430.136] (-428.627) -- 0:00:29
522000 -- (-431.108) (-428.978) (-430.983) [-428.110] * (-430.111) (-429.713) [-430.265] (-429.267) -- 0:00:29
522500 -- (-431.812) [-428.252] (-432.394) (-428.202) * (-430.819) (-430.063) [-432.223] (-430.348) -- 0:00:29
523000 -- (-428.770) (-430.891) (-430.793) [-428.719] * (-428.164) (-428.895) [-428.896] (-428.000) -- 0:00:29
523500 -- (-432.049) (-435.630) [-428.705] (-428.487) * (-428.676) (-429.871) [-428.385] (-427.538) -- 0:00:29
524000 -- [-428.310] (-430.519) (-429.571) (-428.849) * [-429.541] (-432.429) (-428.430) (-430.639) -- 0:00:29
524500 -- (-431.277) (-427.876) (-428.334) [-428.011] * (-432.713) (-430.982) (-428.675) [-429.163] -- 0:00:29
525000 -- [-427.548] (-431.333) (-430.356) (-431.444) * [-431.849] (-432.178) (-429.016) (-428.885) -- 0:00:28
Average standard deviation of split frequencies: 0.007506
525500 -- (-429.570) (-429.511) [-429.422] (-428.812) * [-427.675] (-434.526) (-429.370) (-429.610) -- 0:00:28
526000 -- [-429.144] (-431.120) (-431.430) (-433.857) * (-427.982) [-429.714] (-429.116) (-430.805) -- 0:00:28
526500 -- [-428.591] (-428.723) (-434.919) (-431.285) * [-429.836] (-430.003) (-427.836) (-429.679) -- 0:00:28
527000 -- [-428.575] (-432.368) (-429.147) (-430.257) * (-433.292) (-430.069) [-434.245] (-428.844) -- 0:00:28
527500 -- (-428.532) (-429.615) (-430.259) [-434.769] * (-434.044) [-433.409] (-431.500) (-428.240) -- 0:00:28
528000 -- (-427.978) [-428.647] (-430.642) (-433.079) * (-427.997) (-430.037) (-429.110) [-428.573] -- 0:00:29
528500 -- [-428.796] (-429.304) (-429.293) (-429.528) * [-427.933] (-431.371) (-436.337) (-428.335) -- 0:00:29
529000 -- (-433.863) (-429.722) [-428.089] (-427.934) * (-427.602) (-429.699) (-433.690) [-428.385] -- 0:00:29
529500 -- (-428.980) (-429.850) [-429.133] (-429.457) * (-427.616) [-429.699] (-431.517) (-428.904) -- 0:00:29
530000 -- (-429.473) (-435.080) (-430.500) [-428.747] * [-428.300] (-429.510) (-429.940) (-428.692) -- 0:00:29
Average standard deviation of split frequencies: 0.007551
530500 -- (-429.271) (-435.719) [-428.487] (-428.289) * [-428.817] (-428.220) (-430.308) (-435.257) -- 0:00:29
531000 -- [-430.968] (-430.222) (-428.631) (-427.851) * (-428.527) (-428.046) [-429.279] (-430.365) -- 0:00:29
531500 -- (-428.243) [-429.640] (-430.204) (-432.072) * (-428.372) (-429.380) (-428.587) [-430.537] -- 0:00:29
532000 -- (-430.168) (-432.178) [-429.632] (-428.841) * [-430.859] (-429.571) (-433.730) (-429.199) -- 0:00:29
532500 -- (-428.478) (-433.424) (-429.035) [-427.244] * [-428.415] (-431.096) (-428.219) (-431.138) -- 0:00:28
533000 -- (-428.682) (-432.596) [-429.041] (-432.557) * (-428.484) [-430.687] (-428.843) (-429.484) -- 0:00:28
533500 -- [-428.257] (-431.867) (-434.332) (-433.951) * (-431.398) (-429.713) [-429.803] (-431.252) -- 0:00:28
534000 -- (-427.953) (-429.341) (-430.462) [-430.441] * (-427.612) [-429.329] (-429.033) (-431.594) -- 0:00:28
534500 -- [-430.388] (-428.897) (-430.053) (-432.199) * (-427.962) [-430.475] (-431.225) (-430.251) -- 0:00:28
535000 -- [-428.959] (-432.097) (-428.135) (-430.740) * (-431.939) (-431.963) (-430.533) [-428.374] -- 0:00:28
Average standard deviation of split frequencies: 0.008080
535500 -- (-427.831) (-429.797) (-429.129) [-429.818] * (-428.147) (-429.872) (-434.433) [-428.635] -- 0:00:28
536000 -- (-429.461) (-427.786) (-430.435) [-430.636] * (-434.183) (-430.813) (-431.970) [-432.723] -- 0:00:28
536500 -- (-427.702) [-428.247] (-430.668) (-430.154) * (-431.119) (-432.428) [-428.455] (-429.346) -- 0:00:28
537000 -- (-427.491) (-428.295) [-430.978] (-428.178) * (-429.642) (-430.975) [-430.078] (-428.573) -- 0:00:28
537500 -- (-429.127) (-428.005) [-429.052] (-428.330) * (-432.420) (-434.864) (-428.233) [-429.368] -- 0:00:28
538000 -- [-428.862] (-427.773) (-428.599) (-427.728) * (-429.887) (-429.652) [-428.441] (-433.621) -- 0:00:28
538500 -- [-429.185] (-428.519) (-432.277) (-428.642) * (-430.662) (-431.532) [-430.187] (-429.455) -- 0:00:28
539000 -- (-430.157) (-428.573) [-432.255] (-432.059) * (-430.200) [-432.029] (-433.554) (-429.939) -- 0:00:28
539500 -- (-431.308) (-429.095) [-433.546] (-430.470) * (-427.591) [-433.354] (-429.383) (-430.207) -- 0:00:28
540000 -- (-432.396) (-430.104) (-428.163) [-429.788] * (-431.983) (-430.544) [-429.918] (-429.784) -- 0:00:28
Average standard deviation of split frequencies: 0.008337
540500 -- (-430.924) [-427.569] (-433.285) (-431.146) * (-428.897) (-427.886) (-428.652) [-432.396] -- 0:00:28
541000 -- (-432.332) (-427.572) [-429.652] (-429.017) * (-428.025) (-429.338) [-431.040] (-434.084) -- 0:00:27
541500 -- (-428.802) (-429.401) (-427.281) [-430.090] * (-429.053) (-428.939) [-432.677] (-428.894) -- 0:00:27
542000 -- (-429.713) [-427.853] (-432.437) (-429.326) * [-429.757] (-429.859) (-431.136) (-431.238) -- 0:00:27
542500 -- (-430.628) (-427.764) (-431.630) [-429.407] * (-430.532) [-430.522] (-430.953) (-433.414) -- 0:00:27
543000 -- (-428.675) [-428.289] (-431.067) (-429.029) * (-432.249) (-427.512) [-428.110] (-432.300) -- 0:00:27
543500 -- [-428.679] (-432.973) (-429.468) (-429.635) * (-429.343) [-427.348] (-428.737) (-433.351) -- 0:00:27
544000 -- [-427.831] (-428.419) (-431.861) (-435.399) * (-429.691) (-427.983) [-427.977] (-431.233) -- 0:00:27
544500 -- (-428.857) (-430.368) [-429.421] (-434.357) * (-429.216) (-429.749) (-428.160) [-427.749] -- 0:00:28
545000 -- (-430.399) [-428.137] (-428.209) (-428.846) * (-429.879) [-427.303] (-428.342) (-433.139) -- 0:00:28
Average standard deviation of split frequencies: 0.008364
545500 -- [-428.965] (-431.090) (-428.173) (-429.896) * (-427.864) (-427.454) (-429.935) [-428.816] -- 0:00:28
546000 -- (-428.506) (-428.685) (-430.322) [-429.436] * [-427.948] (-431.043) (-428.910) (-434.220) -- 0:00:28
546500 -- (-428.642) (-428.384) (-431.299) [-429.019] * [-428.581] (-433.005) (-436.431) (-433.182) -- 0:00:28
547000 -- (-429.071) (-429.188) [-430.503] (-427.462) * (-431.859) (-431.114) [-429.651] (-431.768) -- 0:00:28
547500 -- (-427.954) (-428.260) (-431.068) [-427.898] * (-428.746) [-429.298] (-429.908) (-431.019) -- 0:00:28
548000 -- (-428.187) [-427.663] (-428.423) (-428.527) * [-428.594] (-427.608) (-427.901) (-434.104) -- 0:00:28
548500 -- (-429.212) (-428.427) [-429.011] (-429.323) * [-428.410] (-428.555) (-428.865) (-430.628) -- 0:00:27
549000 -- [-428.941] (-429.732) (-430.775) (-430.253) * (-432.251) [-429.179] (-430.300) (-428.008) -- 0:00:27
549500 -- (-431.424) [-431.726] (-429.596) (-428.115) * [-433.182] (-429.919) (-430.586) (-429.613) -- 0:00:27
550000 -- (-432.152) [-429.148] (-432.716) (-429.607) * (-427.253) (-428.222) (-427.951) [-428.445] -- 0:00:27
Average standard deviation of split frequencies: 0.008347
550500 -- (-436.152) (-429.197) (-430.196) [-430.177] * (-432.567) [-428.044] (-430.376) (-428.685) -- 0:00:27
551000 -- (-428.598) (-431.473) [-428.872] (-431.184) * (-429.604) (-429.289) [-429.645] (-430.658) -- 0:00:27
551500 -- (-431.891) (-427.696) [-429.299] (-431.566) * (-428.911) (-430.424) (-430.286) [-428.047] -- 0:00:27
552000 -- (-429.564) (-427.526) [-427.951] (-434.123) * (-429.533) [-428.788] (-428.042) (-429.923) -- 0:00:27
552500 -- (-429.651) (-427.828) (-429.587) [-430.266] * (-430.115) (-429.327) [-429.586] (-428.328) -- 0:00:27
553000 -- (-434.577) (-428.980) [-429.044] (-429.246) * (-429.525) (-427.801) (-430.091) [-427.885] -- 0:00:27
553500 -- (-430.635) [-429.048] (-429.820) (-427.845) * (-433.608) [-430.234] (-428.423) (-435.666) -- 0:00:27
554000 -- [-429.034] (-428.433) (-430.095) (-433.173) * (-429.552) (-433.339) (-429.827) [-428.814] -- 0:00:27
554500 -- (-431.925) (-429.106) (-429.634) [-430.342] * (-428.126) (-427.541) [-429.508] (-431.402) -- 0:00:27
555000 -- (-431.043) (-431.699) (-432.700) [-432.072] * (-429.149) (-427.910) [-428.051] (-431.553) -- 0:00:27
Average standard deviation of split frequencies: 0.008320
555500 -- (-427.899) (-429.864) (-429.584) [-430.064] * (-432.338) [-434.870] (-429.389) (-430.957) -- 0:00:27
556000 -- (-429.656) (-430.117) [-428.835] (-432.196) * [-430.166] (-428.194) (-431.305) (-429.797) -- 0:00:27
556500 -- (-429.577) (-429.220) (-429.466) [-431.002] * (-433.150) (-428.036) (-428.659) [-428.006] -- 0:00:27
557000 -- (-431.019) (-430.352) (-431.299) [-428.423] * (-429.517) [-429.112] (-430.090) (-430.707) -- 0:00:27
557500 -- [-433.013] (-433.211) (-427.685) (-428.699) * [-427.557] (-429.380) (-429.325) (-430.922) -- 0:00:26
558000 -- [-431.501] (-429.291) (-431.731) (-434.201) * (-427.870) (-430.472) [-428.332] (-430.550) -- 0:00:26
558500 -- (-429.607) [-428.681] (-431.638) (-432.579) * (-431.983) (-431.036) (-428.475) [-429.091] -- 0:00:26
559000 -- (-431.532) (-428.829) (-429.035) [-432.427] * (-432.441) (-432.678) (-429.236) [-428.274] -- 0:00:26
559500 -- (-428.761) [-427.996] (-429.315) (-428.737) * (-431.439) (-431.272) (-428.616) [-428.713] -- 0:00:26
560000 -- (-429.448) [-428.545] (-430.346) (-429.487) * [-430.093] (-432.833) (-430.956) (-431.412) -- 0:00:26
Average standard deviation of split frequencies: 0.007935
560500 -- (-428.257) (-431.515) [-428.123] (-431.779) * (-429.518) (-434.114) (-429.871) [-427.544] -- 0:00:27
561000 -- [-429.127] (-429.707) (-428.191) (-428.232) * [-429.665] (-429.860) (-432.139) (-429.336) -- 0:00:27
561500 -- (-429.756) (-428.828) [-428.156] (-431.714) * (-429.205) [-429.006] (-432.440) (-431.291) -- 0:00:27
562000 -- [-430.899] (-431.716) (-434.065) (-428.876) * (-432.803) (-430.248) [-427.889] (-429.416) -- 0:00:27
562500 -- (-431.067) (-429.376) [-429.128] (-434.903) * (-433.915) [-429.104] (-432.082) (-430.608) -- 0:00:27
563000 -- (-430.457) [-430.105] (-427.745) (-428.735) * [-429.208] (-432.614) (-432.395) (-437.717) -- 0:00:27
563500 -- (-427.700) [-432.818] (-429.590) (-428.164) * (-429.970) (-429.899) (-428.938) [-429.607] -- 0:00:27
564000 -- (-429.461) (-428.933) (-429.190) [-431.368] * (-430.415) (-428.918) (-427.208) [-429.178] -- 0:00:27
564500 -- [-429.754] (-430.809) (-430.412) (-433.557) * (-429.888) (-429.097) (-428.081) [-427.810] -- 0:00:27
565000 -- (-429.323) (-427.631) (-431.943) [-430.160] * (-429.826) [-430.073] (-432.357) (-430.448) -- 0:00:26
Average standard deviation of split frequencies: 0.007808
565500 -- (-434.481) (-431.035) (-428.573) [-431.119] * (-429.075) [-429.357] (-429.231) (-428.162) -- 0:00:26
566000 -- (-434.633) (-429.311) [-432.195] (-427.374) * [-434.107] (-428.768) (-434.152) (-430.461) -- 0:00:26
566500 -- [-429.386] (-427.359) (-431.225) (-427.922) * (-431.744) [-428.520] (-433.729) (-427.956) -- 0:00:26
567000 -- [-430.442] (-433.303) (-431.363) (-429.741) * [-431.495] (-429.074) (-430.949) (-429.893) -- 0:00:26
567500 -- (-429.536) (-428.781) (-431.457) [-429.590] * (-430.072) [-428.012] (-430.354) (-428.550) -- 0:00:26
568000 -- (-430.993) (-428.564) (-427.660) [-435.844] * (-429.827) [-428.375] (-430.030) (-431.432) -- 0:00:26
568500 -- (-428.218) (-432.593) [-428.941] (-430.742) * (-428.812) [-430.611] (-430.526) (-428.994) -- 0:00:26
569000 -- (-428.596) (-429.720) [-435.903] (-431.969) * (-428.044) (-428.403) [-429.799] (-431.802) -- 0:00:26
569500 -- (-430.552) (-428.995) [-429.301] (-428.097) * (-430.534) (-427.488) [-430.101] (-429.520) -- 0:00:26
570000 -- [-431.240] (-431.927) (-430.440) (-430.054) * (-428.830) (-428.039) (-429.413) [-429.610] -- 0:00:26
Average standard deviation of split frequencies: 0.007589
570500 -- (-428.697) (-430.754) (-429.874) [-434.395] * (-427.485) (-427.417) (-432.678) [-431.988] -- 0:00:26
571000 -- (-427.579) [-429.494] (-429.447) (-433.097) * [-428.960] (-431.060) (-430.095) (-430.194) -- 0:00:26
571500 -- [-427.779] (-427.444) (-430.636) (-428.818) * [-430.467] (-428.827) (-431.292) (-431.349) -- 0:00:26
572000 -- [-431.217] (-428.338) (-429.965) (-432.620) * (-428.417) (-428.984) [-429.273] (-430.153) -- 0:00:26
572500 -- (-428.210) [-429.152] (-428.101) (-431.979) * (-428.242) (-430.582) [-427.706] (-430.614) -- 0:00:26
573000 -- (-430.326) (-428.353) (-428.362) [-432.400] * (-430.230) (-428.234) (-431.747) [-429.461] -- 0:00:26
573500 -- (-428.408) [-428.967] (-429.841) (-430.997) * (-431.099) (-429.491) [-430.386] (-432.966) -- 0:00:26
574000 -- (-430.879) (-428.780) [-428.537] (-429.289) * (-429.999) (-430.311) (-434.134) [-429.289] -- 0:00:25
574500 -- (-431.918) (-430.136) (-429.159) [-429.644] * [-429.175] (-430.821) (-427.713) (-429.057) -- 0:00:25
575000 -- (-432.891) (-428.505) [-429.906] (-429.144) * [-428.259] (-432.771) (-430.459) (-430.204) -- 0:00:25
Average standard deviation of split frequencies: 0.006752
575500 -- (-430.735) [-428.224] (-429.269) (-432.054) * (-428.671) (-432.548) (-427.953) [-429.762] -- 0:00:25
576000 -- [-431.258] (-429.155) (-428.884) (-430.141) * [-428.422] (-428.610) (-429.152) (-430.969) -- 0:00:26
576500 -- (-429.877) [-428.491] (-432.464) (-427.299) * (-428.136) [-428.650] (-427.836) (-428.180) -- 0:00:26
577000 -- (-427.622) (-431.593) [-427.789] (-427.321) * (-428.174) (-429.313) [-430.048] (-429.030) -- 0:00:26
577500 -- (-427.610) (-428.468) (-428.111) [-428.401] * (-428.537) (-430.192) [-431.382] (-427.715) -- 0:00:26
578000 -- (-428.661) (-431.237) [-428.576] (-430.085) * (-428.569) [-428.942] (-432.335) (-428.647) -- 0:00:26
578500 -- (-433.526) (-430.263) (-428.530) [-435.838] * (-428.916) (-430.195) (-429.906) [-427.528] -- 0:00:26
579000 -- (-431.072) (-428.620) (-429.452) [-433.520] * (-430.266) (-428.837) (-428.607) [-427.869] -- 0:00:26
579500 -- (-430.284) [-429.737] (-430.360) (-431.884) * (-429.570) (-431.309) (-430.428) [-430.673] -- 0:00:26
580000 -- [-429.545] (-427.830) (-430.669) (-429.845) * (-432.208) (-431.340) (-428.873) [-428.864] -- 0:00:26
Average standard deviation of split frequencies: 0.007205
580500 -- (-429.733) [-429.876] (-428.607) (-429.239) * (-431.174) (-428.362) [-429.344] (-430.630) -- 0:00:26
581000 -- (-430.127) (-429.281) (-427.800) [-428.313] * [-428.274] (-428.974) (-434.763) (-431.530) -- 0:00:25
581500 -- (-428.664) (-430.523) (-428.586) [-429.809] * (-428.503) (-428.584) (-428.518) [-428.803] -- 0:00:25
582000 -- [-430.556] (-431.856) (-430.518) (-431.811) * [-430.371] (-429.129) (-431.521) (-429.972) -- 0:00:25
582500 -- (-429.902) (-432.404) [-429.948] (-428.832) * (-436.506) (-428.717) (-429.442) [-430.481] -- 0:00:25
583000 -- (-430.642) [-432.561] (-429.688) (-431.137) * (-434.228) (-428.116) (-433.819) [-428.881] -- 0:00:25
583500 -- (-435.514) [-430.616] (-431.149) (-429.484) * (-436.991) (-430.135) (-427.631) [-428.792] -- 0:00:25
584000 -- (-429.800) (-429.976) (-429.109) [-429.534] * (-430.114) [-429.630] (-434.136) (-430.664) -- 0:00:25
584500 -- (-430.198) (-428.198) (-430.449) [-429.867] * [-430.390] (-427.960) (-428.856) (-430.452) -- 0:00:25
585000 -- (-429.162) (-431.890) [-427.609] (-431.090) * (-430.335) (-427.686) (-431.868) [-428.936] -- 0:00:25
Average standard deviation of split frequencies: 0.007391
585500 -- (-428.163) (-429.318) [-427.505] (-428.188) * [-430.601] (-428.168) (-429.712) (-429.108) -- 0:00:25
586000 -- (-429.661) (-429.750) [-428.053] (-434.217) * [-430.304] (-428.641) (-429.653) (-430.806) -- 0:00:25
586500 -- (-428.309) [-434.357] (-429.964) (-430.786) * (-429.535) (-428.696) [-427.852] (-429.058) -- 0:00:25
587000 -- (-427.993) [-428.488] (-430.158) (-429.876) * (-432.587) (-430.680) (-430.960) [-430.053] -- 0:00:25
587500 -- [-432.045] (-429.872) (-430.303) (-431.160) * [-430.894] (-430.447) (-430.701) (-430.634) -- 0:00:25
588000 -- (-430.117) (-429.136) (-428.190) [-429.316] * (-429.000) [-429.028] (-427.389) (-428.549) -- 0:00:25
588500 -- (-428.814) [-427.383] (-428.183) (-434.194) * [-429.472] (-428.862) (-428.599) (-430.548) -- 0:00:25
589000 -- (-429.000) (-431.357) [-432.240] (-428.460) * [-428.265] (-430.211) (-429.324) (-431.088) -- 0:00:25
589500 -- [-428.917] (-430.218) (-433.142) (-428.993) * (-431.257) (-430.106) [-428.838] (-432.634) -- 0:00:25
590000 -- (-431.990) (-429.403) (-429.576) [-431.610] * (-429.780) (-428.059) (-427.798) [-430.966] -- 0:00:25
Average standard deviation of split frequencies: 0.007482
590500 -- [-429.883] (-429.719) (-429.385) (-428.202) * (-429.504) [-431.277] (-429.357) (-428.159) -- 0:00:24
591000 -- (-430.191) (-428.907) [-429.011] (-430.633) * [-431.153] (-430.970) (-433.599) (-429.911) -- 0:00:24
591500 -- [-428.937] (-433.397) (-427.943) (-427.464) * (-430.981) (-429.665) (-431.679) [-431.319] -- 0:00:24
592000 -- (-431.578) [-433.111] (-428.022) (-428.208) * (-428.394) [-427.447] (-430.194) (-432.527) -- 0:00:24
592500 -- (-430.300) (-434.174) (-429.276) [-427.946] * (-428.580) (-429.432) [-430.944] (-433.388) -- 0:00:25
593000 -- (-429.306) [-434.901] (-431.374) (-427.968) * (-428.574) (-428.675) (-431.649) [-429.043] -- 0:00:25
593500 -- (-429.372) [-433.741] (-431.202) (-432.762) * (-430.882) (-428.974) (-436.267) [-429.871] -- 0:00:25
594000 -- (-428.303) (-434.455) [-429.616] (-430.351) * (-429.548) [-428.022] (-429.716) (-428.143) -- 0:00:25
594500 -- [-429.817] (-430.655) (-432.818) (-431.435) * (-428.696) [-428.268] (-428.845) (-429.924) -- 0:00:25
595000 -- (-429.270) (-431.070) (-436.346) [-429.373] * [-428.755] (-431.794) (-431.165) (-428.084) -- 0:00:25
Average standard deviation of split frequencies: 0.007329
595500 -- (-428.849) (-429.597) (-431.777) [-427.993] * [-428.141] (-428.657) (-427.567) (-427.936) -- 0:00:25
596000 -- (-430.778) (-428.772) [-432.409] (-435.526) * (-428.846) (-428.373) [-428.986] (-430.911) -- 0:00:25
596500 -- (-428.428) [-431.526] (-428.702) (-432.602) * (-427.685) (-428.591) (-431.161) [-429.145] -- 0:00:25
597000 -- (-431.658) (-432.245) (-428.731) [-428.739] * [-432.439] (-432.873) (-431.952) (-427.651) -- 0:00:24
597500 -- [-428.210] (-429.072) (-430.869) (-430.798) * (-429.689) [-429.697] (-430.490) (-427.799) -- 0:00:24
598000 -- (-427.750) (-431.665) [-429.038] (-430.972) * [-428.036] (-429.137) (-431.319) (-427.860) -- 0:00:24
598500 -- [-427.827] (-430.947) (-432.334) (-428.147) * (-429.194) [-428.639] (-430.264) (-428.524) -- 0:00:24
599000 -- (-430.627) (-430.617) [-430.631] (-430.050) * (-430.584) (-432.379) (-432.478) [-429.871] -- 0:00:24
599500 -- [-432.006] (-431.785) (-433.032) (-427.630) * (-430.501) (-430.334) (-428.680) [-428.554] -- 0:00:24
600000 -- (-434.002) (-431.813) [-433.491] (-428.388) * (-432.150) (-430.647) (-430.689) [-433.091] -- 0:00:24
Average standard deviation of split frequencies: 0.007691
600500 -- (-430.488) [-429.100] (-431.050) (-430.066) * (-429.558) (-428.109) (-429.040) [-430.034] -- 0:00:24
601000 -- (-436.834) (-431.262) [-430.294] (-428.440) * (-433.022) (-429.734) [-431.041] (-431.251) -- 0:00:24
601500 -- (-439.435) (-431.021) (-428.678) [-429.942] * (-429.109) [-428.792] (-429.435) (-431.224) -- 0:00:24
602000 -- (-430.498) (-430.458) [-431.358] (-431.659) * (-430.235) (-434.125) [-427.924] (-431.038) -- 0:00:24
602500 -- [-428.699] (-428.543) (-428.889) (-431.556) * (-427.543) (-438.845) [-427.975] (-428.002) -- 0:00:24
603000 -- (-428.979) (-430.161) [-430.602] (-429.181) * [-431.251] (-431.667) (-429.841) (-430.405) -- 0:00:24
603500 -- [-431.039] (-434.646) (-429.149) (-429.966) * (-432.578) (-431.232) (-429.062) [-429.098] -- 0:00:24
604000 -- (-433.875) (-428.450) (-429.424) [-428.704] * (-430.658) (-429.825) [-428.633] (-428.747) -- 0:00:24
604500 -- (-428.020) [-436.426] (-431.608) (-429.091) * (-429.699) (-432.581) (-429.669) [-431.350] -- 0:00:24
605000 -- (-434.029) (-429.570) (-428.092) [-428.115] * [-429.264] (-430.745) (-429.010) (-431.873) -- 0:00:24
Average standard deviation of split frequencies: 0.007831
605500 -- [-433.559] (-428.539) (-434.220) (-428.972) * (-431.012) (-430.861) [-428.445] (-430.537) -- 0:00:24
606000 -- (-437.764) (-427.615) [-428.548] (-430.148) * (-428.772) [-429.516] (-428.125) (-430.598) -- 0:00:24
606500 -- (-429.610) (-429.128) (-429.258) [-429.879] * [-428.452] (-428.584) (-428.680) (-430.519) -- 0:00:24
607000 -- [-431.339] (-428.357) (-427.623) (-430.311) * (-428.924) [-427.794] (-427.830) (-434.098) -- 0:00:23
607500 -- (-428.152) [-427.858] (-430.727) (-428.872) * (-429.147) (-431.144) (-432.538) [-431.765] -- 0:00:23
608000 -- (-429.201) [-428.202] (-430.899) (-432.389) * [-429.535] (-432.248) (-430.472) (-427.341) -- 0:00:24
608500 -- [-429.756] (-429.743) (-427.965) (-430.281) * (-428.591) (-430.341) (-430.089) [-428.302] -- 0:00:24
609000 -- (-429.888) (-430.390) (-430.192) [-429.077] * [-432.366] (-428.279) (-432.579) (-429.179) -- 0:00:24
609500 -- (-429.565) (-429.307) [-428.409] (-427.939) * (-429.596) (-429.664) (-429.565) [-429.501] -- 0:00:24
610000 -- (-429.971) (-431.245) [-429.362] (-429.955) * (-431.543) (-430.002) (-430.222) [-429.564] -- 0:00:24
Average standard deviation of split frequencies: 0.008395
610500 -- (-428.387) [-429.993] (-429.457) (-427.456) * (-429.536) (-430.577) [-429.227] (-428.303) -- 0:00:24
611000 -- (-428.168) [-427.824] (-430.162) (-427.846) * (-428.292) [-429.744] (-431.599) (-430.182) -- 0:00:24
611500 -- (-428.235) [-430.828] (-430.225) (-428.917) * [-430.379] (-430.638) (-428.923) (-429.193) -- 0:00:24
612000 -- [-427.388] (-433.002) (-429.036) (-427.538) * (-430.399) [-431.136] (-430.312) (-427.852) -- 0:00:24
612500 -- [-429.928] (-429.694) (-432.053) (-431.655) * (-430.185) (-431.451) (-431.131) [-432.341] -- 0:00:24
613000 -- (-428.387) [-432.214] (-430.108) (-428.884) * (-429.235) (-428.051) (-429.018) [-429.018] -- 0:00:23
613500 -- (-431.821) (-429.214) (-428.683) [-429.879] * (-432.193) (-428.431) [-428.132] (-427.712) -- 0:00:23
614000 -- (-429.445) [-427.995] (-431.019) (-427.632) * (-428.264) (-428.502) [-430.659] (-428.595) -- 0:00:23
614500 -- (-435.221) [-428.203] (-427.604) (-427.519) * (-429.954) [-428.968] (-431.169) (-428.420) -- 0:00:23
615000 -- [-429.743] (-431.565) (-434.128) (-430.651) * (-427.640) (-430.152) [-432.770] (-428.402) -- 0:00:23
Average standard deviation of split frequencies: 0.007551
615500 -- (-428.671) (-427.409) (-430.824) [-429.300] * (-430.892) (-428.985) [-428.692] (-429.145) -- 0:00:23
616000 -- (-430.438) (-429.696) (-429.058) [-430.653] * (-431.157) (-429.920) (-428.134) [-431.973] -- 0:00:23
616500 -- (-429.885) (-428.286) (-428.849) [-428.341] * (-431.521) (-429.072) [-430.391] (-430.489) -- 0:00:23
617000 -- [-428.565] (-428.863) (-427.611) (-429.494) * [-428.135] (-429.857) (-430.384) (-430.572) -- 0:00:23
617500 -- (-428.148) [-430.304] (-427.693) (-429.388) * (-431.686) (-428.608) [-435.068] (-429.370) -- 0:00:23
618000 -- (-430.044) (-430.861) (-428.383) [-428.024] * (-432.877) [-429.200] (-427.640) (-429.507) -- 0:00:23
618500 -- [-428.636] (-428.958) (-428.181) (-428.033) * (-429.480) [-428.084] (-427.502) (-430.096) -- 0:00:23
619000 -- (-428.810) (-430.469) (-428.351) [-427.919] * [-430.971] (-430.754) (-429.470) (-428.330) -- 0:00:23
619500 -- (-429.135) (-428.873) [-427.814] (-430.476) * [-430.452] (-429.947) (-429.463) (-428.449) -- 0:00:23
620000 -- (-431.922) (-431.622) (-428.584) [-428.385] * (-432.823) (-431.205) [-432.040] (-429.464) -- 0:00:23
Average standard deviation of split frequencies: 0.007393
620500 -- (-429.581) (-428.754) (-431.239) [-428.963] * (-429.448) [-432.136] (-429.994) (-428.255) -- 0:00:23
621000 -- [-427.721] (-428.316) (-430.541) (-428.425) * (-428.466) (-427.536) [-427.547] (-429.096) -- 0:00:23
621500 -- (-427.728) [-432.162] (-432.334) (-428.694) * [-431.678] (-429.390) (-430.833) (-428.818) -- 0:00:23
622000 -- (-429.597) [-428.549] (-431.553) (-434.949) * (-432.624) (-431.187) [-427.951] (-429.877) -- 0:00:23
622500 -- (-428.353) (-428.469) (-431.575) [-428.322] * (-431.521) [-430.785] (-429.397) (-431.123) -- 0:00:23
623000 -- (-428.713) (-429.704) [-433.083] (-429.148) * (-427.314) (-429.114) [-430.482] (-428.876) -- 0:00:22
623500 -- (-428.863) (-429.085) [-429.077] (-428.987) * (-428.383) (-428.815) (-430.506) [-429.048] -- 0:00:22
624000 -- (-427.304) [-428.501] (-430.612) (-429.222) * (-432.285) (-431.699) [-428.438] (-428.428) -- 0:00:23
624500 -- [-427.668] (-430.190) (-430.922) (-429.753) * (-430.356) [-429.921] (-428.550) (-428.110) -- 0:00:23
625000 -- (-431.238) (-432.022) [-428.137] (-428.290) * (-430.115) [-429.509] (-427.410) (-427.448) -- 0:00:23
Average standard deviation of split frequencies: 0.007932
625500 -- (-429.538) (-428.568) [-430.357] (-427.910) * (-428.546) (-429.385) (-429.075) [-428.225] -- 0:00:23
626000 -- [-431.703] (-428.640) (-429.196) (-428.944) * [-427.864] (-429.119) (-430.418) (-429.472) -- 0:00:23
626500 -- (-429.226) (-429.587) (-432.106) [-427.954] * (-428.521) [-427.822] (-431.482) (-428.271) -- 0:00:23
627000 -- (-429.666) [-429.104] (-432.261) (-429.752) * (-429.006) (-427.809) (-428.012) [-428.287] -- 0:00:23
627500 -- (-429.765) (-429.100) [-429.936] (-428.715) * (-430.258) (-429.413) (-428.874) [-429.910] -- 0:00:23
628000 -- (-435.078) (-429.739) [-431.237] (-428.324) * [-427.846] (-427.346) (-430.457) (-432.102) -- 0:00:23
628500 -- (-430.048) (-429.373) [-428.894] (-432.621) * (-434.047) (-427.599) (-428.224) [-428.934] -- 0:00:23
629000 -- (-429.672) (-432.802) [-427.479] (-430.130) * [-428.548] (-430.045) (-431.060) (-431.017) -- 0:00:23
629500 -- (-432.298) (-431.089) (-430.297) [-428.464] * (-429.244) (-428.830) (-433.572) [-429.810] -- 0:00:22
630000 -- [-431.071] (-428.132) (-430.330) (-427.745) * (-429.682) (-428.170) (-430.877) [-429.281] -- 0:00:22
Average standard deviation of split frequencies: 0.007923
630500 -- (-428.219) [-429.167] (-429.818) (-428.263) * (-433.481) [-428.362] (-428.385) (-435.429) -- 0:00:22
631000 -- [-428.805] (-430.568) (-430.023) (-432.061) * (-434.329) (-428.257) [-429.623] (-431.217) -- 0:00:22
631500 -- (-429.372) (-432.001) [-429.268] (-430.001) * (-428.326) (-428.615) (-430.496) [-431.887] -- 0:00:22
632000 -- (-428.660) (-432.784) [-430.567] (-430.567) * (-429.082) (-430.413) [-428.381] (-429.705) -- 0:00:22
632500 -- [-429.467] (-429.470) (-428.281) (-432.632) * [-429.916] (-430.480) (-427.980) (-429.910) -- 0:00:22
633000 -- (-430.082) (-433.109) [-429.166] (-437.624) * [-430.697] (-432.317) (-429.036) (-429.509) -- 0:00:22
633500 -- (-428.421) [-429.300] (-428.438) (-431.904) * [-428.334] (-436.260) (-429.984) (-430.008) -- 0:00:22
634000 -- (-429.590) [-432.118] (-428.079) (-432.545) * (-435.293) (-430.374) [-429.795] (-429.260) -- 0:00:22
634500 -- (-427.705) (-430.227) [-429.023] (-430.672) * (-432.543) (-434.650) (-431.054) [-429.992] -- 0:00:22
635000 -- (-428.333) [-428.392] (-429.476) (-429.167) * (-435.020) (-429.064) (-429.703) [-428.029] -- 0:00:22
Average standard deviation of split frequencies: 0.008005
635500 -- (-436.247) (-428.788) (-431.503) [-430.699] * (-438.046) (-429.630) (-433.089) [-428.174] -- 0:00:22
636000 -- (-431.408) [-429.212] (-429.301) (-428.434) * (-436.205) (-429.512) [-430.941] (-429.322) -- 0:00:22
636500 -- (-432.813) (-429.041) [-428.711] (-428.448) * (-433.435) [-428.023] (-428.116) (-431.360) -- 0:00:22
637000 -- (-432.409) [-430.686] (-428.546) (-429.706) * (-428.498) (-430.032) (-428.442) [-429.906] -- 0:00:22
637500 -- (-431.055) (-430.308) [-428.749] (-429.279) * (-428.097) [-433.693] (-428.899) (-431.091) -- 0:00:22
638000 -- (-430.492) (-429.825) (-428.723) [-428.178] * (-432.658) (-433.348) [-428.097] (-428.625) -- 0:00:22
638500 -- [-429.135] (-431.592) (-432.076) (-429.339) * [-431.633] (-428.759) (-430.796) (-429.206) -- 0:00:22
639000 -- (-428.793) (-429.051) (-430.927) [-427.571] * [-429.348] (-432.343) (-430.902) (-431.668) -- 0:00:22
639500 -- (-432.564) (-429.310) [-430.357] (-431.579) * (-427.680) (-431.940) (-430.241) [-432.099] -- 0:00:21
640000 -- (-429.793) [-427.725] (-428.744) (-432.034) * (-427.687) (-429.305) [-428.897] (-433.299) -- 0:00:21
Average standard deviation of split frequencies: 0.008143
640500 -- [-428.774] (-428.367) (-429.455) (-430.671) * (-429.438) [-428.639] (-433.319) (-429.295) -- 0:00:22
641000 -- (-428.850) [-429.314] (-429.525) (-427.966) * [-429.635] (-429.881) (-434.489) (-429.204) -- 0:00:22
641500 -- (-434.330) (-430.317) [-428.241] (-428.144) * [-428.805] (-429.488) (-427.753) (-430.430) -- 0:00:22
642000 -- [-428.856] (-428.797) (-429.392) (-430.613) * (-429.226) [-430.184] (-433.165) (-431.394) -- 0:00:22
642500 -- [-428.739] (-430.341) (-433.525) (-432.604) * (-430.955) (-433.578) (-428.092) [-429.504] -- 0:00:22
643000 -- [-429.418] (-432.555) (-432.199) (-433.849) * [-430.521] (-429.816) (-428.511) (-431.326) -- 0:00:22
643500 -- (-427.404) [-428.894] (-431.367) (-434.333) * (-429.675) (-431.082) (-432.838) [-432.011] -- 0:00:22
644000 -- (-428.438) (-429.074) [-429.457] (-428.615) * (-429.829) (-429.024) (-431.351) [-430.619] -- 0:00:22
644500 -- (-429.698) (-430.065) (-428.775) [-428.618] * (-427.659) [-432.046] (-429.312) (-428.639) -- 0:00:22
645000 -- (-428.089) (-428.686) [-428.196] (-428.689) * (-429.030) (-431.091) [-428.558] (-429.340) -- 0:00:22
Average standard deviation of split frequencies: 0.008368
645500 -- (-428.470) [-429.166] (-428.041) (-429.025) * (-429.100) (-427.391) (-430.389) [-429.890] -- 0:00:21
646000 -- (-429.655) [-428.915] (-429.284) (-429.358) * (-432.683) (-429.674) [-428.544] (-429.877) -- 0:00:21
646500 -- (-433.064) (-428.691) [-430.381] (-430.241) * (-430.363) [-428.754] (-428.633) (-430.106) -- 0:00:21
647000 -- (-429.173) (-427.574) [-428.526] (-429.077) * (-431.450) (-429.856) (-427.757) [-428.005] -- 0:00:21
647500 -- (-428.923) [-428.059] (-430.217) (-432.728) * (-430.372) (-434.258) (-427.705) [-429.348] -- 0:00:21
648000 -- (-427.493) [-429.178] (-431.534) (-430.961) * [-430.061] (-428.636) (-432.017) (-429.211) -- 0:00:21
648500 -- (-428.407) [-428.059] (-429.986) (-434.266) * (-431.848) [-428.441] (-431.406) (-428.724) -- 0:00:21
649000 -- (-432.437) (-431.348) [-427.927] (-429.645) * (-429.244) (-428.689) [-428.978] (-429.441) -- 0:00:21
649500 -- (-428.193) [-429.804] (-429.667) (-428.523) * (-429.497) (-431.706) [-429.266] (-427.865) -- 0:00:21
650000 -- [-428.304] (-429.777) (-428.380) (-428.445) * (-431.863) (-431.051) (-428.957) [-428.922] -- 0:00:21
Average standard deviation of split frequencies: 0.008018
650500 -- (-434.739) [-429.712] (-428.465) (-431.455) * (-430.968) (-433.597) (-428.718) [-429.214] -- 0:00:21
651000 -- (-430.549) [-429.411] (-432.775) (-433.839) * (-432.406) [-428.992] (-427.799) (-428.580) -- 0:00:21
651500 -- (-429.713) [-428.755] (-429.519) (-432.098) * [-428.435] (-427.646) (-431.410) (-429.552) -- 0:00:21
652000 -- (-428.684) (-430.470) (-428.756) [-429.235] * [-429.324] (-428.947) (-428.111) (-432.380) -- 0:00:21
652500 -- (-429.034) (-431.517) (-432.101) [-429.027] * (-428.308) (-430.289) (-428.918) [-431.076] -- 0:00:21
653000 -- (-428.272) (-430.336) [-435.075] (-432.103) * [-428.225] (-429.604) (-429.196) (-432.489) -- 0:00:21
653500 -- (-431.149) (-430.217) [-437.168] (-429.684) * [-429.288] (-429.758) (-428.836) (-435.752) -- 0:00:21
654000 -- (-431.804) (-430.250) (-429.417) [-428.571] * [-430.007] (-429.901) (-430.361) (-436.620) -- 0:00:21
654500 -- [-431.064] (-428.038) (-428.406) (-429.452) * (-429.940) [-430.560] (-431.594) (-427.750) -- 0:00:21
655000 -- [-429.202] (-431.227) (-428.064) (-428.594) * (-430.232) (-429.074) (-433.880) [-431.014] -- 0:00:21
Average standard deviation of split frequencies: 0.008048
655500 -- [-428.703] (-429.950) (-429.120) (-431.640) * [-427.613] (-429.857) (-431.394) (-428.484) -- 0:00:21
656000 -- (-432.255) (-428.039) (-433.962) [-431.192] * (-429.321) (-428.789) [-428.603] (-433.478) -- 0:00:20
656500 -- (-430.218) [-429.794] (-432.155) (-429.974) * [-428.660] (-429.918) (-428.378) (-429.451) -- 0:00:21
657000 -- (-432.055) (-432.012) [-430.835] (-429.286) * [-433.118] (-433.152) (-428.573) (-431.577) -- 0:00:21
657500 -- (-428.731) (-432.560) (-428.282) [-428.878] * (-429.973) (-428.551) (-429.234) [-429.584] -- 0:00:21
658000 -- [-428.958] (-433.843) (-427.578) (-428.646) * (-428.630) (-429.026) [-428.788] (-432.503) -- 0:00:21
658500 -- [-430.182] (-433.459) (-429.247) (-428.321) * (-428.557) (-429.862) (-436.129) [-431.491] -- 0:00:21
659000 -- [-430.510] (-429.989) (-429.392) (-432.110) * (-428.722) (-428.036) [-431.216] (-431.256) -- 0:00:21
659500 -- (-434.608) (-430.014) [-432.563] (-431.713) * (-428.439) (-433.422) [-427.680] (-428.020) -- 0:00:21
660000 -- (-427.359) (-431.417) [-427.592] (-430.193) * (-431.044) (-431.469) (-429.153) [-428.774] -- 0:00:21
Average standard deviation of split frequencies: 0.009276
660500 -- (-430.572) (-429.640) [-429.084] (-429.215) * (-427.823) (-432.196) [-429.075] (-428.394) -- 0:00:21
661000 -- (-428.117) (-431.233) (-431.690) [-429.103] * [-429.532] (-428.315) (-428.760) (-427.997) -- 0:00:21
661500 -- [-428.453] (-431.045) (-431.718) (-428.298) * (-430.338) (-430.482) (-429.366) [-428.241] -- 0:00:20
662000 -- [-427.313] (-432.040) (-428.606) (-428.347) * [-429.991] (-432.416) (-430.375) (-430.801) -- 0:00:20
662500 -- (-428.033) (-431.670) [-428.680] (-429.195) * (-429.736) (-429.151) [-428.335] (-429.961) -- 0:00:20
663000 -- (-427.697) (-429.324) [-430.447] (-429.019) * (-430.853) (-432.265) (-427.400) [-430.146] -- 0:00:20
663500 -- [-429.071] (-430.932) (-430.994) (-429.998) * (-428.625) [-435.125] (-430.208) (-432.921) -- 0:00:20
664000 -- [-427.614] (-431.325) (-429.089) (-428.585) * (-428.632) (-431.473) [-429.858] (-428.732) -- 0:00:20
664500 -- (-428.795) (-429.247) [-431.628] (-430.715) * [-429.684] (-431.630) (-429.525) (-429.089) -- 0:00:20
665000 -- [-429.796] (-430.432) (-434.866) (-433.572) * [-430.440] (-428.718) (-429.301) (-432.833) -- 0:00:20
Average standard deviation of split frequencies: 0.009532
665500 -- (-429.614) [-428.573] (-430.978) (-429.829) * [-429.616] (-430.709) (-429.851) (-427.786) -- 0:00:20
666000 -- (-429.694) (-428.216) [-430.010] (-429.751) * (-429.210) (-430.119) [-432.746] (-427.823) -- 0:00:20
666500 -- (-428.955) [-428.662] (-437.873) (-428.943) * [-429.383] (-430.262) (-431.489) (-427.629) -- 0:00:20
667000 -- (-434.272) [-427.765] (-428.212) (-431.005) * (-429.656) [-430.145] (-432.640) (-427.664) -- 0:00:20
667500 -- (-433.820) [-428.158] (-427.907) (-429.518) * (-431.750) [-429.470] (-429.470) (-428.990) -- 0:00:20
668000 -- (-430.179) [-431.390] (-428.838) (-428.500) * (-432.841) (-431.005) [-429.068] (-428.754) -- 0:00:20
668500 -- (-435.725) (-429.808) (-431.344) [-427.382] * (-428.728) (-429.981) (-430.735) [-427.762] -- 0:00:20
669000 -- (-430.795) (-428.776) (-433.306) [-429.484] * (-428.281) (-432.301) (-431.066) [-427.380] -- 0:00:20
669500 -- [-430.609] (-428.689) (-429.368) (-428.305) * [-430.189] (-430.053) (-428.228) (-428.015) -- 0:00:20
670000 -- (-430.809) [-430.719] (-428.385) (-430.711) * (-433.238) (-430.428) (-428.562) [-428.064] -- 0:00:20
Average standard deviation of split frequencies: 0.010028
670500 -- [-428.240] (-429.636) (-428.673) (-430.050) * (-434.106) (-431.628) (-429.181) [-428.466] -- 0:00:20
671000 -- (-427.400) (-428.215) [-431.880] (-432.688) * (-428.352) (-430.334) [-429.663] (-429.983) -- 0:00:20
671500 -- [-427.849] (-429.244) (-432.542) (-428.966) * (-431.174) (-427.871) (-428.326) [-429.587] -- 0:00:20
672000 -- (-430.457) [-428.366] (-431.012) (-427.494) * [-434.697] (-429.513) (-428.894) (-427.977) -- 0:00:20
672500 -- (-430.637) (-427.967) (-432.184) [-428.729] * (-430.478) (-429.608) [-429.085] (-429.404) -- 0:00:20
673000 -- [-429.483] (-429.662) (-428.220) (-428.893) * (-428.116) [-429.394] (-430.361) (-430.344) -- 0:00:20
673500 -- (-428.122) (-429.181) [-429.175] (-431.979) * (-429.902) (-431.991) [-431.003] (-430.054) -- 0:00:20
674000 -- (-430.415) [-429.463] (-428.464) (-432.471) * (-429.503) [-432.958] (-431.734) (-430.074) -- 0:00:20
674500 -- (-432.028) (-429.607) (-431.840) [-430.649] * [-428.624] (-432.827) (-431.275) (-428.877) -- 0:00:20
675000 -- (-430.612) [-429.733] (-431.211) (-429.776) * (-430.256) (-430.453) [-428.728] (-428.206) -- 0:00:20
Average standard deviation of split frequencies: 0.010181
675500 -- (-429.369) (-427.717) [-430.034] (-429.743) * [-429.251] (-434.052) (-429.366) (-428.223) -- 0:00:20
676000 -- [-429.971] (-432.610) (-437.790) (-429.515) * (-431.956) [-429.668] (-428.968) (-428.161) -- 0:00:20
676500 -- (-428.899) [-432.351] (-435.405) (-428.787) * (-430.323) (-428.718) (-429.772) [-430.247] -- 0:00:20
677000 -- (-434.085) (-429.997) (-430.750) [-432.320] * (-428.348) (-429.500) (-430.250) [-429.507] -- 0:00:20
677500 -- [-427.465] (-429.587) (-432.114) (-430.988) * (-428.815) (-429.145) [-428.734] (-433.642) -- 0:00:19
678000 -- [-427.916] (-430.683) (-431.256) (-429.760) * (-428.218) (-429.369) (-428.350) [-427.605] -- 0:00:19
678500 -- (-428.697) [-431.522] (-432.933) (-428.817) * (-430.604) (-428.490) (-429.483) [-428.438] -- 0:00:19
679000 -- (-428.823) [-427.932] (-432.108) (-431.950) * (-432.843) [-432.332] (-430.753) (-428.866) -- 0:00:19
679500 -- (-429.745) [-427.777] (-430.388) (-433.375) * [-429.483] (-428.772) (-431.057) (-431.015) -- 0:00:19
680000 -- (-429.619) (-429.887) (-429.003) [-429.490] * (-428.375) [-429.118] (-430.355) (-429.638) -- 0:00:19
Average standard deviation of split frequencies: 0.009881
680500 -- (-429.634) (-428.765) (-429.481) [-428.000] * (-430.745) (-432.859) [-430.253] (-431.822) -- 0:00:19
681000 -- (-428.550) [-431.926] (-428.520) (-429.182) * [-430.643] (-434.200) (-427.440) (-434.108) -- 0:00:19
681500 -- (-427.566) (-429.454) (-432.740) [-428.315] * (-429.921) (-434.839) (-429.254) [-429.039] -- 0:00:19
682000 -- (-430.829) (-428.218) (-431.606) [-428.041] * (-429.047) (-432.039) (-428.336) [-428.869] -- 0:00:19
682500 -- (-428.493) (-429.030) (-433.022) [-428.792] * (-428.885) (-432.223) (-428.560) [-428.230] -- 0:00:19
683000 -- (-431.202) (-430.655) (-428.493) [-432.909] * (-428.655) (-429.527) [-429.567] (-431.113) -- 0:00:19
683500 -- (-429.636) [-432.096] (-429.076) (-432.398) * (-428.054) (-436.139) [-432.703] (-430.733) -- 0:00:19
684000 -- (-432.290) [-430.242] (-428.938) (-436.697) * (-427.817) (-432.479) (-431.634) [-427.481] -- 0:00:19
684500 -- (-436.798) (-429.339) (-429.782) [-434.390] * [-427.777] (-431.380) (-429.522) (-428.063) -- 0:00:19
685000 -- [-429.175] (-431.295) (-429.691) (-434.764) * (-428.146) (-430.531) (-433.920) [-428.425] -- 0:00:19
Average standard deviation of split frequencies: 0.010537
685500 -- (-427.817) (-429.513) [-428.647] (-431.806) * [-429.860] (-428.169) (-431.144) (-430.806) -- 0:00:19
686000 -- (-427.639) [-432.720] (-428.265) (-432.042) * (-432.958) (-431.228) [-427.659] (-429.653) -- 0:00:19
686500 -- [-429.354] (-428.327) (-430.574) (-436.737) * (-431.203) (-430.908) (-429.100) [-427.788] -- 0:00:19
687000 -- (-432.432) (-429.190) (-429.490) [-428.482] * (-430.273) (-427.851) (-432.295) [-428.403] -- 0:00:19
687500 -- (-432.681) [-428.409] (-430.238) (-428.347) * (-429.193) (-429.012) (-431.256) [-428.383] -- 0:00:19
688000 -- (-433.546) [-430.104] (-430.490) (-429.003) * (-429.644) (-432.972) (-432.829) [-430.542] -- 0:00:19
688500 -- (-429.938) [-432.685] (-429.009) (-429.082) * [-430.226] (-432.780) (-428.147) (-434.223) -- 0:00:19
689000 -- (-432.444) (-429.272) [-428.267] (-431.476) * (-427.992) [-427.489] (-428.723) (-427.743) -- 0:00:19
689500 -- (-433.654) [-427.811] (-429.066) (-431.793) * (-428.339) [-428.458] (-427.614) (-430.092) -- 0:00:19
690000 -- (-429.497) (-429.480) [-429.885] (-430.635) * (-430.993) (-429.451) (-429.362) [-427.958] -- 0:00:19
Average standard deviation of split frequencies: 0.010602
690500 -- (-428.976) (-436.643) (-428.402) [-427.937] * (-429.648) (-428.596) (-428.630) [-428.481] -- 0:00:19
691000 -- [-429.068] (-430.953) (-428.685) (-429.509) * [-429.500] (-429.480) (-429.890) (-429.199) -- 0:00:19
691500 -- [-430.267] (-428.070) (-431.414) (-429.438) * (-429.776) (-433.868) [-428.915] (-431.880) -- 0:00:19
692000 -- (-429.943) [-429.377] (-431.866) (-430.558) * [-430.767] (-432.077) (-429.773) (-432.639) -- 0:00:19
692500 -- [-429.599] (-429.529) (-431.700) (-428.476) * (-428.471) (-433.402) [-430.899] (-429.392) -- 0:00:19
693000 -- (-429.486) (-429.039) (-430.141) [-428.522] * (-428.202) [-430.204] (-431.074) (-431.314) -- 0:00:19
693500 -- (-428.449) (-428.455) (-437.522) [-427.648] * (-428.911) [-428.457] (-431.451) (-430.190) -- 0:00:19
694000 -- [-427.460] (-428.826) (-436.603) (-430.488) * (-429.155) (-431.889) [-428.104] (-430.420) -- 0:00:18
694500 -- (-429.825) (-427.551) [-431.703] (-430.683) * (-428.700) (-429.824) (-428.334) [-429.169] -- 0:00:18
695000 -- (-428.066) [-430.932] (-433.722) (-428.752) * (-428.943) (-435.171) (-430.121) [-428.840] -- 0:00:18
Average standard deviation of split frequencies: 0.009889
695500 -- [-428.263] (-429.340) (-432.879) (-430.096) * [-427.938] (-433.911) (-431.085) (-430.921) -- 0:00:18
696000 -- (-429.687) [-428.823] (-428.185) (-428.029) * (-428.078) (-429.967) [-431.855] (-429.072) -- 0:00:18
696500 -- (-434.690) (-427.530) (-430.167) [-427.977] * (-428.327) [-428.480] (-432.613) (-428.057) -- 0:00:18
697000 -- (-430.985) (-428.998) (-428.984) [-431.275] * [-427.468] (-430.602) (-434.992) (-429.750) -- 0:00:18
697500 -- (-431.087) (-429.698) (-430.317) [-435.429] * [-427.298] (-431.247) (-430.712) (-430.349) -- 0:00:18
698000 -- (-429.336) (-430.099) [-431.890] (-431.571) * [-429.586] (-431.142) (-431.596) (-433.051) -- 0:00:18
698500 -- (-431.560) (-430.472) (-428.999) [-429.631] * (-429.257) (-433.834) [-430.240] (-430.585) -- 0:00:18
699000 -- (-430.700) [-428.382] (-429.366) (-433.948) * [-429.713] (-431.601) (-429.705) (-428.988) -- 0:00:18
699500 -- (-429.322) (-431.068) (-429.095) [-434.734] * (-429.361) (-429.817) (-428.386) [-428.710] -- 0:00:18
700000 -- (-432.062) (-429.708) [-428.738] (-430.732) * (-431.251) (-428.158) (-429.982) [-430.457] -- 0:00:18
Average standard deviation of split frequencies: 0.009419
700500 -- (-431.550) (-429.096) [-431.959] (-432.828) * (-432.471) (-429.403) (-429.662) [-428.957] -- 0:00:18
701000 -- (-430.166) [-427.816] (-429.474) (-429.775) * (-432.619) (-430.315) (-430.979) [-429.636] -- 0:00:18
701500 -- [-429.474] (-432.198) (-430.492) (-428.869) * (-429.267) (-430.547) [-428.581] (-430.763) -- 0:00:18
702000 -- (-428.317) [-429.779] (-430.137) (-427.909) * [-430.684] (-431.794) (-430.145) (-429.234) -- 0:00:18
702500 -- (-428.745) (-428.511) [-430.182] (-428.637) * (-430.152) (-427.956) (-429.511) [-433.637] -- 0:00:18
703000 -- (-427.600) [-427.823] (-429.774) (-431.468) * [-431.609] (-429.353) (-428.807) (-430.171) -- 0:00:18
703500 -- [-429.754] (-430.830) (-432.007) (-430.701) * (-430.237) (-432.089) [-428.203] (-430.127) -- 0:00:18
704000 -- (-427.801) (-429.791) [-428.583] (-429.088) * (-437.738) [-430.704] (-428.290) (-431.441) -- 0:00:18
704500 -- (-431.286) (-427.710) (-431.884) [-431.256] * (-429.831) (-429.263) [-427.872] (-432.776) -- 0:00:18
705000 -- (-430.273) (-429.028) [-431.218] (-431.135) * (-433.198) (-429.734) [-427.791] (-428.394) -- 0:00:18
Average standard deviation of split frequencies: 0.009515
705500 -- (-430.386) [-431.377] (-428.158) (-431.299) * (-427.976) (-429.369) [-427.621] (-428.327) -- 0:00:18
706000 -- (-430.300) [-430.478] (-428.557) (-429.512) * (-428.093) (-430.298) (-432.082) [-428.623] -- 0:00:18
706500 -- (-428.570) [-430.360] (-429.341) (-428.239) * (-429.212) (-427.662) (-428.625) [-429.102] -- 0:00:18
707000 -- [-431.959] (-431.937) (-428.157) (-428.076) * (-428.532) (-431.325) [-430.263] (-429.476) -- 0:00:18
707500 -- (-428.348) [-431.156] (-432.986) (-430.088) * (-431.861) (-428.695) (-431.419) [-430.214] -- 0:00:18
708000 -- (-429.639) (-427.873) (-427.988) [-430.885] * (-429.504) [-428.035] (-428.068) (-429.248) -- 0:00:18
708500 -- [-427.632] (-430.512) (-429.591) (-429.622) * (-430.376) (-427.544) [-429.043] (-431.980) -- 0:00:18
709000 -- (-427.421) (-429.152) (-429.313) [-428.596] * (-429.449) (-428.755) [-432.243] (-431.186) -- 0:00:18
709500 -- (-432.746) (-431.406) (-431.352) [-427.968] * (-428.513) (-430.828) [-427.814] (-428.982) -- 0:00:18
710000 -- (-428.426) (-428.920) [-429.198] (-431.597) * (-433.135) [-427.833] (-428.824) (-429.336) -- 0:00:17
Average standard deviation of split frequencies: 0.009242
710500 -- (-429.314) (-430.451) (-428.693) [-430.090] * (-432.190) [-428.221] (-429.011) (-432.244) -- 0:00:17
711000 -- (-431.663) (-431.268) [-432.821] (-430.535) * (-431.634) (-429.193) (-431.112) [-428.740] -- 0:00:17
711500 -- (-438.013) (-430.136) [-430.303] (-428.049) * (-433.793) [-429.336] (-428.355) (-429.333) -- 0:00:17
712000 -- (-428.758) (-429.036) [-429.545] (-429.665) * (-432.408) [-428.879] (-427.662) (-430.601) -- 0:00:17
712500 -- [-427.741] (-427.949) (-431.084) (-428.511) * [-429.988] (-433.377) (-427.985) (-433.509) -- 0:00:17
713000 -- (-429.442) [-429.936] (-435.365) (-428.856) * (-429.809) (-430.668) (-433.136) [-431.183] -- 0:00:17
713500 -- (-432.820) [-428.449] (-431.294) (-429.072) * (-432.072) [-429.700] (-430.465) (-430.482) -- 0:00:17
714000 -- (-429.611) (-428.155) (-428.936) [-428.751] * (-429.094) (-429.356) [-428.189] (-431.189) -- 0:00:17
714500 -- (-432.402) (-431.808) (-434.479) [-428.534] * (-430.266) (-432.208) [-428.058] (-430.974) -- 0:00:17
715000 -- (-429.226) (-428.328) (-428.498) [-429.581] * [-427.478] (-430.634) (-429.060) (-428.711) -- 0:00:17
Average standard deviation of split frequencies: 0.009393
715500 -- (-430.338) [-429.420] (-428.193) (-427.728) * (-427.658) (-431.887) [-431.584] (-428.424) -- 0:00:17
716000 -- (-427.478) [-429.136] (-428.816) (-428.606) * (-437.925) (-429.244) [-427.737] (-430.019) -- 0:00:17
716500 -- (-431.961) (-429.091) [-427.512] (-430.295) * (-429.131) (-428.397) [-429.392] (-430.321) -- 0:00:17
717000 -- (-429.943) [-428.154] (-428.517) (-427.934) * (-428.066) [-428.612] (-431.079) (-434.696) -- 0:00:17
717500 -- (-432.011) (-428.730) [-428.287] (-430.694) * [-430.059] (-429.645) (-429.148) (-429.234) -- 0:00:17
718000 -- (-433.053) [-429.097] (-428.593) (-428.424) * [-428.731] (-427.757) (-430.899) (-428.612) -- 0:00:17
718500 -- (-428.321) [-427.394] (-428.752) (-429.985) * (-431.430) (-427.458) [-431.239] (-428.206) -- 0:00:17
719000 -- [-427.480] (-427.402) (-429.266) (-429.691) * (-432.856) (-427.635) [-428.389] (-429.422) -- 0:00:17
719500 -- (-430.464) [-433.985] (-429.097) (-430.341) * (-433.576) [-427.557] (-429.391) (-428.291) -- 0:00:17
720000 -- (-430.348) (-434.019) [-430.684] (-429.855) * (-432.026) (-427.999) [-428.981] (-428.953) -- 0:00:17
Average standard deviation of split frequencies: 0.009289
720500 -- (-432.669) (-435.364) [-429.029] (-428.784) * (-434.410) (-429.377) [-428.802] (-433.019) -- 0:00:17
721000 -- (-429.427) (-431.326) (-429.535) [-428.786] * [-432.552] (-432.842) (-429.916) (-429.408) -- 0:00:17
721500 -- (-429.895) [-432.172] (-429.564) (-427.896) * (-440.336) (-431.033) (-429.110) [-430.725] -- 0:00:17
722000 -- (-431.537) [-429.869] (-432.094) (-428.661) * (-430.209) (-431.275) (-427.377) [-427.470] -- 0:00:17
722500 -- [-431.821] (-428.092) (-428.406) (-434.548) * [-430.364] (-428.248) (-430.136) (-427.526) -- 0:00:17
723000 -- [-428.972] (-427.830) (-429.584) (-428.003) * (-428.963) (-431.794) [-429.962] (-429.962) -- 0:00:17
723500 -- (-433.880) (-430.476) [-428.604] (-427.791) * [-430.591] (-430.042) (-431.780) (-427.797) -- 0:00:17
724000 -- (-428.079) [-431.755] (-435.684) (-428.841) * (-430.830) [-429.941] (-432.432) (-429.791) -- 0:00:17
724500 -- (-427.904) (-430.424) (-434.601) [-430.572] * (-431.501) [-431.408] (-432.045) (-430.461) -- 0:00:17
725000 -- [-428.444] (-431.179) (-433.499) (-430.162) * (-431.625) (-429.907) [-428.288] (-431.078) -- 0:00:17
Average standard deviation of split frequencies: 0.009393
725500 -- (-428.818) [-431.910] (-443.041) (-431.515) * (-429.036) (-432.198) (-428.129) [-429.566] -- 0:00:17
726000 -- (-431.046) (-431.178) (-435.313) [-428.978] * [-428.675] (-428.349) (-428.201) (-434.432) -- 0:00:16
726500 -- [-427.819] (-430.841) (-435.056) (-429.991) * (-428.381) (-428.946) (-429.343) [-431.150] -- 0:00:16
727000 -- [-429.931] (-429.655) (-430.876) (-428.220) * (-429.673) (-428.523) (-428.156) [-433.644] -- 0:00:16
727500 -- (-429.025) (-429.523) (-431.315) [-428.330] * [-430.235] (-430.960) (-429.071) (-428.226) -- 0:00:16
728000 -- (-429.601) (-428.058) [-429.477] (-430.788) * (-435.529) [-430.501] (-431.048) (-429.741) -- 0:00:16
728500 -- (-428.493) (-429.103) (-427.902) [-429.437] * (-432.082) (-429.983) (-431.613) [-428.974] -- 0:00:16
729000 -- [-429.317] (-428.002) (-427.573) (-428.233) * (-430.097) (-431.386) (-432.517) [-431.072] -- 0:00:16
729500 -- (-430.898) (-428.001) (-427.570) [-428.135] * (-428.454) (-430.159) [-430.105] (-429.692) -- 0:00:16
730000 -- [-428.535] (-433.977) (-428.788) (-428.487) * (-430.914) (-429.121) (-429.846) [-436.352] -- 0:00:16
Average standard deviation of split frequencies: 0.008946
730500 -- (-427.735) (-433.049) (-428.820) [-429.523] * (-432.104) (-430.981) [-430.107] (-427.758) -- 0:00:16
731000 -- (-428.697) (-430.719) (-430.725) [-430.690] * (-428.023) (-429.999) [-430.222] (-428.653) -- 0:00:16
731500 -- (-427.713) (-427.525) [-431.244] (-431.022) * [-428.545] (-429.942) (-429.477) (-429.288) -- 0:00:16
732000 -- (-431.141) (-428.246) (-429.706) [-427.876] * (-428.517) [-428.049] (-432.469) (-429.798) -- 0:00:16
732500 -- (-434.195) (-428.355) [-427.823] (-430.109) * [-431.183] (-429.320) (-432.023) (-428.263) -- 0:00:16
733000 -- (-437.282) (-430.853) [-429.155] (-431.696) * (-430.911) (-429.183) [-427.620] (-428.705) -- 0:00:16
733500 -- (-432.833) (-431.864) [-430.599] (-430.264) * (-430.168) (-429.958) (-427.702) [-427.426] -- 0:00:16
734000 -- (-433.242) (-428.036) [-430.958] (-431.064) * (-429.827) (-434.952) (-428.477) [-429.644] -- 0:00:16
734500 -- [-435.940] (-429.233) (-431.644) (-430.137) * (-428.376) (-432.250) [-429.081] (-431.144) -- 0:00:16
735000 -- (-428.730) [-431.886] (-429.002) (-428.461) * (-428.483) (-431.366) [-429.326] (-431.267) -- 0:00:16
Average standard deviation of split frequencies: 0.008540
735500 -- (-429.733) [-427.776] (-428.380) (-427.830) * (-427.778) (-428.100) [-433.869] (-428.508) -- 0:00:16
736000 -- [-429.733] (-430.739) (-430.066) (-428.892) * (-429.833) (-429.214) (-430.363) [-428.030] -- 0:00:16
736500 -- [-431.460] (-431.069) (-428.351) (-430.288) * [-432.425] (-430.714) (-430.882) (-430.563) -- 0:00:16
737000 -- (-432.598) (-432.829) [-429.759] (-429.500) * [-429.372] (-433.009) (-433.340) (-429.864) -- 0:00:16
737500 -- [-428.932] (-429.948) (-433.724) (-431.984) * (-429.149) (-429.496) [-427.814] (-428.735) -- 0:00:16
738000 -- (-430.005) [-428.742] (-434.721) (-433.141) * (-432.312) (-428.614) (-430.077) [-429.887] -- 0:00:16
738500 -- (-431.874) [-430.836] (-434.952) (-431.098) * [-429.318] (-428.247) (-428.502) (-429.258) -- 0:00:16
739000 -- (-428.314) [-431.488] (-427.450) (-427.679) * (-428.547) [-431.936] (-428.272) (-430.965) -- 0:00:16
739500 -- (-429.444) (-431.489) (-428.327) [-429.336] * (-429.433) [-430.429] (-432.776) (-428.179) -- 0:00:16
740000 -- (-429.831) [-430.757] (-429.115) (-427.881) * (-430.964) (-430.918) (-429.568) [-431.265] -- 0:00:16
Average standard deviation of split frequencies: 0.008613
740500 -- (-428.544) (-432.596) (-431.076) [-428.030] * (-429.314) (-437.626) [-429.443] (-430.796) -- 0:00:16
741000 -- (-429.433) (-430.997) (-430.594) [-427.484] * [-429.135] (-433.992) (-431.736) (-432.498) -- 0:00:16
741500 -- [-427.637] (-430.088) (-428.707) (-431.201) * (-428.642) [-428.972] (-429.480) (-428.765) -- 0:00:16
742000 -- (-432.280) (-431.281) [-428.509] (-429.137) * (-430.457) [-428.526] (-428.155) (-428.592) -- 0:00:15
742500 -- (-436.695) [-429.925] (-430.916) (-432.382) * [-428.176] (-432.178) (-431.317) (-430.345) -- 0:00:15
743000 -- (-436.361) (-429.860) (-433.186) [-428.402] * (-429.759) (-428.278) (-427.554) [-428.936] -- 0:00:15
743500 -- [-429.578] (-429.400) (-432.826) (-429.997) * (-431.809) (-428.329) [-428.464] (-428.560) -- 0:00:15
744000 -- (-430.464) (-432.235) [-429.652] (-430.335) * [-433.506] (-428.913) (-428.857) (-429.835) -- 0:00:15
744500 -- (-430.293) (-430.351) [-430.220] (-431.372) * [-430.565] (-429.427) (-429.790) (-429.080) -- 0:00:15
745000 -- (-431.513) [-428.250] (-432.739) (-430.115) * (-427.568) (-428.138) (-427.780) [-428.705] -- 0:00:15
Average standard deviation of split frequencies: 0.008552
745500 -- (-439.621) (-429.126) (-430.097) [-430.065] * [-430.252] (-428.112) (-435.832) (-427.854) -- 0:00:15
746000 -- (-430.290) (-432.175) (-430.455) [-431.248] * [-429.414] (-428.954) (-428.396) (-428.040) -- 0:00:15
746500 -- [-428.729] (-430.018) (-429.548) (-430.262) * [-429.356] (-430.325) (-427.889) (-428.722) -- 0:00:15
747000 -- [-428.501] (-429.053) (-428.545) (-428.828) * [-428.364] (-428.161) (-428.793) (-427.795) -- 0:00:15
747500 -- (-429.856) (-431.786) [-432.504] (-427.715) * (-433.295) (-430.606) (-431.045) [-429.486] -- 0:00:15
748000 -- (-431.389) [-429.673] (-430.072) (-428.707) * (-433.254) [-428.028] (-430.448) (-429.763) -- 0:00:15
748500 -- (-429.586) [-429.559] (-428.786) (-427.643) * (-431.708) [-428.589] (-430.924) (-429.869) -- 0:00:15
749000 -- (-427.761) (-428.159) [-428.391] (-430.821) * (-428.478) [-430.389] (-429.677) (-432.598) -- 0:00:15
749500 -- (-428.809) (-429.026) (-432.139) [-430.669] * (-433.107) [-428.262] (-427.796) (-432.880) -- 0:00:15
750000 -- (-428.455) (-428.983) (-432.843) [-435.761] * [-428.574] (-429.896) (-427.774) (-431.246) -- 0:00:15
Average standard deviation of split frequencies: 0.008708
750500 -- (-428.774) (-427.303) [-429.109] (-431.088) * [-428.686] (-430.717) (-429.591) (-430.314) -- 0:00:15
751000 -- (-429.774) (-429.257) (-428.810) [-429.319] * [-428.103] (-429.109) (-428.931) (-429.106) -- 0:00:15
751500 -- [-428.836] (-428.972) (-432.970) (-431.393) * (-428.297) [-428.665] (-430.587) (-427.920) -- 0:00:15
752000 -- (-429.132) [-429.313] (-428.273) (-428.958) * (-430.940) (-429.340) [-430.500] (-430.472) -- 0:00:15
752500 -- (-428.286) (-428.757) [-430.476] (-429.182) * [-428.731] (-430.274) (-432.199) (-428.281) -- 0:00:15
753000 -- (-430.777) (-427.702) (-429.652) [-433.473] * (-430.882) (-430.803) (-429.900) [-429.550] -- 0:00:15
753500 -- (-430.832) (-430.634) [-429.479] (-434.003) * [-428.104] (-432.331) (-428.475) (-431.698) -- 0:00:15
754000 -- [-428.082] (-428.624) (-431.025) (-428.759) * (-428.314) [-428.183] (-428.437) (-428.482) -- 0:00:15
754500 -- (-428.103) (-430.348) (-431.094) [-428.447] * (-429.716) (-428.329) [-430.393] (-428.444) -- 0:00:15
755000 -- (-428.996) (-430.757) [-432.279] (-429.593) * (-429.478) [-429.042] (-428.390) (-427.881) -- 0:00:15
Average standard deviation of split frequencies: 0.008563
755500 -- (-432.427) (-429.975) [-429.070] (-428.902) * (-427.889) [-427.975] (-429.100) (-433.061) -- 0:00:15
756000 -- (-432.820) [-428.254] (-429.607) (-428.789) * (-428.201) [-432.116] (-428.207) (-430.340) -- 0:00:15
756500 -- [-429.853] (-427.762) (-428.912) (-429.556) * (-429.239) (-430.112) (-429.364) [-432.418] -- 0:00:15
757000 -- (-432.536) [-427.733] (-429.529) (-434.426) * (-429.675) [-432.535] (-429.864) (-430.216) -- 0:00:15
757500 -- (-428.595) (-431.671) [-429.757] (-430.874) * (-427.724) [-427.775] (-429.362) (-430.365) -- 0:00:15
758000 -- [-429.788] (-431.040) (-428.536) (-428.349) * (-430.132) (-428.197) (-428.589) [-429.203] -- 0:00:15
758500 -- (-428.302) (-429.566) [-429.265] (-427.687) * (-428.287) (-432.188) [-428.581] (-429.057) -- 0:00:14
759000 -- (-427.941) (-431.291) (-428.964) [-427.795] * [-428.829] (-430.974) (-429.423) (-430.261) -- 0:00:14
759500 -- (-429.248) (-431.576) [-429.548] (-431.577) * [-431.539] (-429.916) (-431.314) (-429.164) -- 0:00:14
760000 -- (-431.197) [-431.051] (-434.182) (-430.738) * [-430.246] (-430.035) (-427.977) (-429.935) -- 0:00:14
Average standard deviation of split frequencies: 0.008924
760500 -- (-431.947) (-427.740) [-428.798] (-430.552) * (-431.186) [-428.641] (-427.855) (-431.887) -- 0:00:14
761000 -- (-429.276) [-430.015] (-429.719) (-430.341) * [-429.517] (-430.221) (-428.962) (-431.001) -- 0:00:14
761500 -- (-429.441) [-428.151] (-427.898) (-429.700) * (-430.570) (-431.507) (-429.721) [-431.055] -- 0:00:14
762000 -- (-429.303) (-428.886) (-430.017) [-428.034] * (-428.336) [-429.612] (-435.031) (-429.335) -- 0:00:14
762500 -- (-430.102) [-428.887] (-429.543) (-432.245) * (-429.456) (-428.786) [-429.691] (-428.737) -- 0:00:14
763000 -- (-429.912) (-429.827) (-429.329) [-428.641] * (-433.848) (-428.606) (-432.795) [-428.412] -- 0:00:14
763500 -- [-429.004] (-428.682) (-431.669) (-433.362) * (-430.303) [-429.128] (-430.647) (-427.688) -- 0:00:14
764000 -- (-429.850) (-435.662) (-433.465) [-427.826] * (-429.143) (-430.798) [-429.350] (-430.907) -- 0:00:14
764500 -- (-429.119) (-435.921) (-432.038) [-428.088] * (-429.642) (-430.619) [-428.081] (-430.252) -- 0:00:14
765000 -- (-431.906) [-432.134] (-430.404) (-427.318) * (-429.157) (-432.153) (-429.002) [-429.961] -- 0:00:14
Average standard deviation of split frequencies: 0.009231
765500 -- (-428.811) [-429.096] (-430.526) (-428.988) * (-431.250) (-428.604) [-431.364] (-427.805) -- 0:00:14
766000 -- (-432.260) [-429.621] (-428.066) (-428.624) * (-429.136) (-431.481) (-431.470) [-428.189] -- 0:00:14
766500 -- (-427.643) (-428.807) [-427.596] (-432.193) * (-428.596) (-428.154) (-427.985) [-428.311] -- 0:00:14
767000 -- [-428.765] (-430.275) (-427.819) (-427.726) * [-428.430] (-429.953) (-429.801) (-431.413) -- 0:00:14
767500 -- (-433.812) [-427.729] (-430.072) (-428.385) * (-428.901) (-430.020) (-430.518) [-428.419] -- 0:00:14
768000 -- (-433.457) (-431.737) [-433.997] (-428.663) * [-428.232] (-431.271) (-429.599) (-430.612) -- 0:00:14
768500 -- (-431.120) (-430.481) [-429.905] (-428.824) * (-429.346) (-428.385) (-432.685) [-430.711] -- 0:00:14
769000 -- (-430.876) [-428.740] (-428.354) (-429.733) * [-431.031] (-430.372) (-430.196) (-431.237) -- 0:00:14
769500 -- (-430.830) (-428.305) (-428.833) [-430.704] * [-428.530] (-428.234) (-432.047) (-431.999) -- 0:00:14
770000 -- (-432.102) [-430.174] (-429.741) (-431.989) * (-429.059) (-428.673) (-433.545) [-430.416] -- 0:00:14
Average standard deviation of split frequencies: 0.009338
770500 -- (-429.062) (-428.529) [-429.306] (-433.597) * (-428.812) [-428.263] (-429.951) (-431.393) -- 0:00:14
771000 -- [-429.286] (-430.489) (-429.202) (-428.480) * [-431.582] (-428.985) (-430.908) (-430.829) -- 0:00:14
771500 -- (-435.450) [-429.825] (-429.089) (-428.193) * [-429.874] (-429.783) (-430.790) (-433.395) -- 0:00:14
772000 -- [-430.655] (-429.078) (-429.831) (-430.303) * (-430.549) (-429.362) [-427.481] (-429.770) -- 0:00:14
772500 -- (-428.864) (-429.268) (-431.361) [-429.329] * (-429.243) [-428.665] (-428.352) (-432.964) -- 0:00:14
773000 -- (-431.289) (-428.836) (-433.474) [-427.929] * [-428.174] (-428.128) (-432.604) (-429.328) -- 0:00:14
773500 -- (-428.905) (-429.801) (-432.756) [-429.779] * (-428.375) (-428.879) (-431.541) [-430.710] -- 0:00:14
774000 -- [-427.829] (-430.318) (-432.027) (-430.465) * (-429.335) (-429.224) [-429.014] (-433.983) -- 0:00:14
774500 -- (-428.460) (-429.974) (-431.191) [-430.071] * (-428.589) (-435.728) [-428.795] (-428.783) -- 0:00:13
775000 -- [-427.722] (-433.570) (-429.282) (-428.661) * [-428.687] (-429.600) (-432.030) (-433.439) -- 0:00:13
Average standard deviation of split frequencies: 0.009436
775500 -- (-429.129) (-430.627) [-429.169] (-429.777) * (-428.851) (-428.764) [-427.883] (-430.717) -- 0:00:13
776000 -- [-427.550] (-431.217) (-429.280) (-428.717) * (-429.820) (-428.297) [-427.969] (-430.771) -- 0:00:13
776500 -- (-428.726) (-429.719) (-428.615) [-430.993] * (-430.203) (-429.872) (-428.986) [-428.079] -- 0:00:13
777000 -- (-429.121) (-428.851) (-432.106) [-428.559] * (-431.111) (-429.476) (-435.787) [-427.719] -- 0:00:13
777500 -- (-429.994) (-427.512) (-429.532) [-431.458] * (-428.874) (-430.299) [-427.739] (-432.104) -- 0:00:13
778000 -- (-430.971) (-428.319) [-428.975] (-428.118) * (-428.165) (-435.793) [-429.617] (-431.160) -- 0:00:13
778500 -- (-430.788) (-432.032) (-430.096) [-429.392] * [-428.373] (-431.391) (-431.816) (-428.611) -- 0:00:13
779000 -- (-432.233) (-428.883) [-428.719] (-429.716) * [-427.956] (-428.879) (-429.541) (-428.990) -- 0:00:13
779500 -- (-431.528) (-431.156) [-428.431] (-431.520) * (-428.571) (-428.955) (-431.679) [-430.615] -- 0:00:13
780000 -- (-433.809) (-433.281) [-428.794] (-433.417) * (-428.727) (-427.617) [-433.873] (-428.781) -- 0:00:13
Average standard deviation of split frequencies: 0.009501
780500 -- (-433.353) [-429.263] (-428.806) (-430.624) * [-428.029] (-428.891) (-434.467) (-428.174) -- 0:00:13
781000 -- (-427.951) [-430.662] (-429.806) (-430.567) * (-429.605) (-431.125) (-430.388) [-427.979] -- 0:00:13
781500 -- (-431.878) [-427.881] (-429.949) (-428.367) * (-428.100) (-428.795) [-429.101] (-427.857) -- 0:00:13
782000 -- (-428.676) (-430.786) (-430.110) [-428.117] * [-430.305] (-429.413) (-431.129) (-428.674) -- 0:00:13
782500 -- [-428.576] (-433.156) (-430.771) (-433.306) * [-428.711] (-429.527) (-433.540) (-432.646) -- 0:00:13
783000 -- (-428.594) [-428.423] (-431.362) (-429.631) * [-428.432] (-429.657) (-428.804) (-428.940) -- 0:00:13
783500 -- [-430.248] (-432.389) (-430.224) (-430.279) * [-430.176] (-436.245) (-427.682) (-428.082) -- 0:00:13
784000 -- (-429.103) (-430.034) (-430.958) [-429.286] * (-434.037) (-431.229) [-431.102] (-432.221) -- 0:00:13
784500 -- [-429.368] (-429.883) (-429.761) (-430.164) * (-428.104) (-430.448) (-428.467) [-432.042] -- 0:00:13
785000 -- [-428.362] (-433.037) (-431.513) (-428.737) * [-430.040] (-427.388) (-429.144) (-429.170) -- 0:00:13
Average standard deviation of split frequencies: 0.008876
785500 -- (-431.064) (-431.646) (-432.793) [-429.356] * (-428.856) [-428.547] (-428.014) (-429.594) -- 0:00:13
786000 -- (-427.734) (-438.206) (-429.848) [-427.985] * [-431.270] (-430.099) (-428.981) (-432.679) -- 0:00:13
786500 -- [-430.090] (-433.104) (-429.156) (-430.400) * [-432.696] (-431.021) (-427.767) (-430.342) -- 0:00:13
787000 -- (-429.270) (-438.986) (-428.913) [-428.275] * (-430.669) [-429.501] (-429.687) (-429.400) -- 0:00:13
787500 -- (-432.202) [-427.979] (-429.568) (-427.703) * [-428.884] (-429.094) (-428.587) (-432.257) -- 0:00:13
788000 -- [-428.722] (-430.513) (-432.050) (-429.007) * (-430.808) (-428.770) [-429.135] (-431.318) -- 0:00:13
788500 -- (-435.619) (-428.460) [-430.230] (-430.483) * (-430.817) [-434.992] (-432.921) (-430.500) -- 0:00:13
789000 -- [-432.426] (-430.526) (-428.945) (-427.908) * (-432.257) (-432.447) (-428.667) [-429.185] -- 0:00:13
789500 -- (-428.857) (-428.891) (-429.108) [-429.319] * [-430.753] (-430.250) (-432.337) (-427.981) -- 0:00:13
790000 -- (-429.325) (-430.896) [-427.605] (-433.176) * (-428.477) [-430.564] (-427.584) (-429.556) -- 0:00:13
Average standard deviation of split frequencies: 0.009102
790500 -- (-434.517) [-430.375] (-430.564) (-431.916) * (-431.570) (-432.284) [-427.621] (-428.191) -- 0:00:12
791000 -- (-428.137) [-427.497] (-430.273) (-429.962) * (-429.453) (-436.738) [-431.805] (-428.694) -- 0:00:12
791500 -- [-431.046] (-436.643) (-430.565) (-428.741) * (-430.070) (-433.517) (-432.071) [-428.839] -- 0:00:12
792000 -- (-434.934) [-428.773] (-430.200) (-432.937) * (-432.717) (-431.315) (-431.901) [-429.378] -- 0:00:12
792500 -- [-430.094] (-428.063) (-428.255) (-429.721) * (-429.857) (-431.600) [-430.097] (-428.546) -- 0:00:12
793000 -- (-432.178) (-428.987) [-427.946] (-430.143) * (-429.786) (-431.109) (-430.385) [-429.118] -- 0:00:12
793500 -- [-432.866] (-429.924) (-427.506) (-430.335) * (-431.012) [-429.204] (-429.188) (-429.060) -- 0:00:12
794000 -- (-429.306) (-428.896) (-427.434) [-431.514] * (-430.989) (-427.499) [-430.361] (-430.259) -- 0:00:12
794500 -- (-429.795) [-427.753] (-429.841) (-430.278) * (-429.814) [-428.645] (-428.384) (-429.802) -- 0:00:12
795000 -- [-430.184] (-429.227) (-428.655) (-430.747) * (-428.717) (-430.331) [-429.204] (-429.240) -- 0:00:12
Average standard deviation of split frequencies: 0.008923
795500 -- (-431.259) (-430.606) (-429.529) [-431.041] * (-431.268) (-433.674) (-429.634) [-430.483] -- 0:00:12
796000 -- (-429.287) (-430.720) (-430.852) [-427.515] * [-427.573] (-431.318) (-429.191) (-430.149) -- 0:00:12
796500 -- [-429.084] (-428.624) (-428.340) (-430.659) * (-427.740) [-429.059] (-432.264) (-427.311) -- 0:00:12
797000 -- (-427.625) (-428.305) (-430.595) [-430.339] * [-427.948] (-429.188) (-428.573) (-428.305) -- 0:00:12
797500 -- (-431.176) [-429.600] (-429.749) (-429.994) * (-428.100) (-431.696) [-429.131] (-432.455) -- 0:00:12
798000 -- (-432.373) (-430.250) (-428.200) [-429.449] * (-428.243) (-430.292) [-431.494] (-430.064) -- 0:00:12
798500 -- (-431.306) (-430.790) (-433.239) [-428.926] * (-429.650) (-429.164) (-433.125) [-431.748] -- 0:00:12
799000 -- [-431.128] (-427.866) (-429.578) (-434.093) * (-430.073) (-427.874) (-433.516) [-431.422] -- 0:00:12
799500 -- (-429.747) [-427.584] (-430.749) (-429.879) * [-429.948] (-430.643) (-432.313) (-429.411) -- 0:00:12
800000 -- (-428.388) (-432.582) [-432.445] (-428.437) * (-438.185) (-432.078) [-430.013] (-428.006) -- 0:00:12
Average standard deviation of split frequencies: 0.009028
800500 -- (-431.408) (-431.376) [-430.681] (-429.921) * [-428.493] (-430.841) (-431.049) (-431.258) -- 0:00:12
801000 -- (-431.466) (-428.877) [-431.113] (-433.525) * (-430.865) [-430.368] (-428.018) (-427.511) -- 0:00:12
801500 -- (-431.285) (-428.392) (-429.383) [-429.187] * (-429.913) (-430.340) [-429.599] (-427.772) -- 0:00:12
802000 -- (-431.376) (-429.516) (-429.961) [-428.653] * (-430.046) [-430.021] (-428.725) (-427.789) -- 0:00:12
802500 -- (-431.266) (-432.825) (-432.434) [-428.527] * (-433.188) [-432.852] (-428.863) (-428.486) -- 0:00:12
803000 -- (-429.169) [-428.942] (-430.591) (-429.570) * (-428.955) (-434.714) (-428.021) [-428.299] -- 0:00:12
803500 -- (-435.158) (-434.004) (-431.037) [-430.231] * [-430.377] (-429.589) (-430.171) (-427.365) -- 0:00:12
804000 -- (-428.090) (-432.529) (-429.911) [-430.151] * (-430.259) (-429.937) (-429.128) [-429.648] -- 0:00:12
804500 -- [-429.959] (-431.641) (-428.223) (-431.175) * (-432.194) (-433.161) [-430.885] (-429.546) -- 0:00:12
805000 -- (-428.360) (-430.931) [-430.713] (-428.818) * (-432.300) [-430.918] (-428.935) (-428.846) -- 0:00:12
Average standard deviation of split frequencies: 0.009241
805500 -- (-429.011) [-428.944] (-429.419) (-429.924) * (-431.150) [-433.873] (-430.255) (-427.941) -- 0:00:12
806000 -- (-428.883) (-428.910) [-429.560] (-428.513) * (-427.786) (-431.867) [-428.138] (-428.125) -- 0:00:12
806500 -- (-431.612) [-427.966] (-427.914) (-429.082) * (-427.788) (-432.230) [-429.521] (-428.112) -- 0:00:11
807000 -- [-432.510] (-429.862) (-428.024) (-428.279) * (-428.481) (-429.153) [-431.921] (-429.030) -- 0:00:11
807500 -- (-434.371) [-428.002] (-427.737) (-429.959) * (-429.224) (-429.895) (-430.780) [-429.269] -- 0:00:11
808000 -- (-427.895) [-429.889] (-432.003) (-429.524) * [-430.775] (-431.713) (-429.829) (-434.399) -- 0:00:11
808500 -- (-430.439) (-429.656) [-428.280] (-429.404) * (-430.235) (-431.037) (-429.814) [-429.648] -- 0:00:11
809000 -- (-430.569) (-427.784) [-428.194] (-430.045) * [-430.917] (-427.448) (-429.703) (-431.488) -- 0:00:11
809500 -- [-429.652] (-430.415) (-427.510) (-429.414) * (-431.427) (-428.779) (-429.837) [-429.514] -- 0:00:11
810000 -- (-428.511) [-433.686] (-427.583) (-428.616) * [-430.809] (-429.838) (-428.346) (-428.545) -- 0:00:11
Average standard deviation of split frequencies: 0.009071
810500 -- [-428.944] (-429.558) (-430.260) (-429.159) * (-430.899) (-429.598) (-428.896) [-428.743] -- 0:00:11
811000 -- [-428.056] (-428.834) (-430.871) (-428.875) * (-431.436) [-428.614] (-429.050) (-430.099) -- 0:00:11
811500 -- (-430.641) (-428.793) (-433.578) [-430.401] * [-429.372] (-428.312) (-428.586) (-429.929) -- 0:00:11
812000 -- (-430.537) (-431.573) (-433.537) [-430.099] * (-431.658) (-431.309) [-427.626] (-434.382) -- 0:00:11
812500 -- (-429.823) [-429.809] (-429.509) (-428.190) * (-427.398) (-434.028) (-427.633) [-429.983] -- 0:00:11
813000 -- [-428.878] (-430.382) (-428.175) (-429.720) * (-429.882) [-430.481] (-427.807) (-430.590) -- 0:00:11
813500 -- (-429.462) [-432.722] (-434.631) (-430.178) * (-430.064) (-432.306) [-427.622] (-430.051) -- 0:00:11
814000 -- (-429.718) (-431.431) (-433.676) [-429.138] * (-430.491) [-430.141] (-428.915) (-432.030) -- 0:00:11
814500 -- [-428.785] (-431.913) (-429.891) (-428.165) * (-429.961) [-432.294] (-428.890) (-429.339) -- 0:00:11
815000 -- (-432.169) [-428.132] (-429.151) (-428.770) * (-429.391) [-429.833] (-428.377) (-429.266) -- 0:00:11
Average standard deviation of split frequencies: 0.009128
815500 -- [-427.665] (-428.105) (-427.857) (-428.106) * (-429.421) [-430.124] (-428.955) (-428.785) -- 0:00:11
816000 -- (-427.718) (-428.033) [-427.586] (-430.883) * (-433.175) [-428.876] (-429.470) (-429.699) -- 0:00:11
816500 -- [-428.644] (-428.271) (-429.303) (-429.537) * (-437.511) (-431.873) [-430.837] (-427.913) -- 0:00:11
817000 -- (-428.709) (-428.091) (-428.266) [-429.597] * [-431.084] (-430.603) (-433.588) (-433.115) -- 0:00:11
817500 -- (-430.299) [-428.591] (-431.526) (-434.243) * (-429.764) [-431.127] (-431.534) (-431.427) -- 0:00:11
818000 -- [-433.910] (-430.130) (-433.445) (-428.680) * [-431.634] (-429.121) (-429.680) (-433.105) -- 0:00:11
818500 -- (-432.564) [-430.551] (-428.239) (-432.665) * (-428.777) (-428.815) (-428.039) [-428.646] -- 0:00:11
819000 -- (-434.513) (-427.906) [-428.105] (-435.641) * (-429.557) [-429.235] (-429.026) (-430.993) -- 0:00:11
819500 -- [-430.011] (-428.718) (-429.788) (-431.587) * (-429.104) [-427.454] (-431.689) (-429.836) -- 0:00:11
820000 -- (-431.352) [-430.758] (-429.492) (-433.906) * (-427.813) (-430.575) (-431.003) [-431.073] -- 0:00:11
Average standard deviation of split frequencies: 0.008808
820500 -- (-430.343) [-430.623] (-429.958) (-430.102) * (-429.177) (-430.846) [-428.506] (-427.578) -- 0:00:11
821000 -- (-431.123) (-430.919) (-430.570) [-433.183] * [-431.103] (-434.678) (-428.468) (-428.285) -- 0:00:11
821500 -- (-432.596) [-429.416] (-432.149) (-431.587) * [-429.662] (-428.893) (-429.079) (-429.963) -- 0:00:11
822000 -- (-432.102) [-428.946] (-427.533) (-429.667) * [-430.647] (-428.497) (-431.285) (-429.534) -- 0:00:11
822500 -- (-431.684) (-429.929) [-431.046] (-429.874) * (-431.563) [-430.104] (-429.689) (-427.545) -- 0:00:11
823000 -- (-430.043) [-427.316] (-429.175) (-431.521) * (-429.723) (-428.205) [-429.371] (-429.218) -- 0:00:10
823500 -- [-428.308] (-432.364) (-430.307) (-429.656) * [-428.694] (-429.327) (-427.768) (-429.139) -- 0:00:10
824000 -- (-429.422) (-431.492) (-431.949) [-432.691] * (-434.627) (-429.000) (-429.028) [-428.708] -- 0:00:10
824500 -- (-431.099) [-429.219] (-431.379) (-431.360) * (-430.657) [-429.305] (-427.499) (-429.436) -- 0:00:10
825000 -- (-428.558) (-429.645) [-428.819] (-428.725) * (-430.931) [-428.279] (-429.705) (-432.979) -- 0:00:10
Average standard deviation of split frequencies: 0.008218
825500 -- (-429.898) (-431.095) [-428.228] (-428.926) * (-431.516) [-430.519] (-435.104) (-430.358) -- 0:00:10
826000 -- (-429.632) (-430.501) (-429.670) [-429.057] * (-430.452) (-430.396) [-430.129] (-429.571) -- 0:00:10
826500 -- [-430.757] (-428.269) (-428.929) (-428.637) * (-429.673) [-430.026] (-431.179) (-432.913) -- 0:00:10
827000 -- (-428.457) (-428.227) [-428.733] (-429.612) * [-428.594] (-428.966) (-431.752) (-430.879) -- 0:00:10
827500 -- (-429.922) [-429.572] (-433.015) (-430.018) * (-428.052) (-431.912) (-431.338) [-429.570] -- 0:00:10
828000 -- [-431.667] (-428.638) (-433.571) (-432.194) * [-428.000] (-428.937) (-431.838) (-431.877) -- 0:00:10
828500 -- (-429.302) [-430.434] (-430.444) (-429.797) * (-428.327) [-427.807] (-429.992) (-429.086) -- 0:00:10
829000 -- (-428.598) (-429.574) (-428.403) [-428.569] * [-430.960] (-430.992) (-430.959) (-428.692) -- 0:00:10
829500 -- (-428.080) [-428.807] (-428.899) (-428.027) * (-428.397) (-429.756) [-430.565] (-428.988) -- 0:00:10
830000 -- [-429.809] (-429.849) (-431.202) (-431.796) * (-428.694) (-436.331) [-432.851] (-428.890) -- 0:00:10
Average standard deviation of split frequencies: 0.007869
830500 -- [-429.058] (-430.604) (-431.245) (-429.489) * (-427.530) [-428.752] (-431.560) (-430.257) -- 0:00:10
831000 -- (-430.160) (-429.742) [-430.767] (-430.705) * [-428.912] (-427.589) (-430.732) (-429.286) -- 0:00:10
831500 -- (-430.525) (-429.471) (-430.725) [-430.992] * (-428.612) [-430.133] (-430.119) (-427.974) -- 0:00:10
832000 -- (-436.273) (-429.386) (-428.710) [-429.201] * (-430.878) (-429.139) [-433.740] (-429.959) -- 0:00:10
832500 -- (-430.752) (-430.298) [-427.411] (-430.432) * (-429.447) (-428.781) [-429.633] (-427.551) -- 0:00:10
833000 -- (-430.478) (-429.238) [-431.006] (-430.448) * [-427.473] (-427.411) (-430.004) (-427.443) -- 0:00:10
833500 -- (-429.380) (-428.686) (-431.664) [-430.154] * [-427.736] (-429.769) (-427.741) (-427.991) -- 0:00:10
834000 -- [-429.525] (-427.957) (-431.601) (-429.470) * [-427.772] (-432.284) (-428.348) (-429.527) -- 0:00:10
834500 -- [-428.934] (-429.583) (-432.275) (-430.899) * (-433.841) (-430.354) (-429.913) [-429.455] -- 0:00:10
835000 -- (-430.374) [-429.020] (-432.877) (-429.156) * (-431.384) (-430.446) [-431.295] (-430.039) -- 0:00:10
Average standard deviation of split frequencies: 0.007481
835500 -- (-429.941) (-433.409) (-427.596) [-427.603] * [-431.435] (-429.911) (-431.134) (-428.045) -- 0:00:10
836000 -- (-427.449) (-428.033) (-428.925) [-429.841] * [-427.894] (-429.871) (-430.782) (-430.784) -- 0:00:10
836500 -- (-427.788) [-430.712] (-428.055) (-430.724) * (-431.963) (-434.885) [-427.808] (-428.610) -- 0:00:10
837000 -- [-430.511] (-430.812) (-428.233) (-437.343) * (-429.789) (-431.076) [-429.362] (-431.105) -- 0:00:10
837500 -- (-429.330) (-429.683) (-429.436) [-429.317] * (-432.282) (-432.020) (-429.147) [-431.020] -- 0:00:10
838000 -- (-431.027) (-430.360) (-431.428) [-429.865] * (-428.158) [-428.229] (-431.107) (-428.061) -- 0:00:10
838500 -- [-428.240] (-428.004) (-430.465) (-429.079) * (-431.246) (-429.723) (-430.854) [-428.568] -- 0:00:10
839000 -- (-430.558) (-428.483) [-433.538] (-430.294) * [-427.835] (-430.567) (-432.596) (-428.848) -- 0:00:09
839500 -- (-434.722) (-429.716) [-427.813] (-427.400) * (-427.297) (-428.658) (-428.944) [-427.606] -- 0:00:09
840000 -- (-429.579) (-431.723) (-429.788) [-429.521] * (-433.652) (-429.669) (-427.910) [-428.977] -- 0:00:09
Average standard deviation of split frequencies: 0.007252
840500 -- (-429.441) [-429.765] (-429.065) (-428.726) * (-428.869) (-432.676) [-428.872] (-427.362) -- 0:00:09
841000 -- (-429.683) (-428.735) [-428.241] (-427.805) * (-427.689) (-429.613) (-430.537) [-428.105] -- 0:00:09
841500 -- (-428.181) [-428.790] (-430.364) (-429.436) * (-430.874) (-428.743) (-429.178) [-427.640] -- 0:00:09
842000 -- (-429.371) [-429.477] (-428.585) (-429.640) * [-429.737] (-429.382) (-430.933) (-428.840) -- 0:00:09
842500 -- (-429.162) [-430.867] (-428.503) (-433.394) * [-428.936] (-429.929) (-429.768) (-429.462) -- 0:00:09
843000 -- (-428.765) (-431.783) (-429.118) [-428.955] * (-429.441) [-430.923] (-429.239) (-428.576) -- 0:00:09
843500 -- (-431.035) (-428.488) (-430.508) [-430.264] * (-432.569) (-429.180) (-430.853) [-427.754] -- 0:00:09
844000 -- (-429.967) (-431.543) (-427.862) [-428.496] * (-430.432) (-430.146) (-431.990) [-428.491] -- 0:00:09
844500 -- (-430.423) (-430.654) [-428.228] (-429.431) * (-429.019) (-431.648) [-431.973] (-431.205) -- 0:00:09
845000 -- (-430.230) (-428.642) (-433.378) [-431.005] * (-431.291) [-429.969] (-430.539) (-429.113) -- 0:00:09
Average standard deviation of split frequencies: 0.006909
845500 -- (-429.984) (-429.816) (-428.422) [-430.248] * [-430.830] (-429.907) (-428.901) (-430.728) -- 0:00:09
846000 -- [-429.379] (-429.410) (-429.838) (-430.071) * (-431.764) (-427.783) (-427.682) [-430.261] -- 0:00:09
846500 -- [-429.342] (-428.458) (-430.113) (-429.449) * (-432.402) (-428.862) [-429.528] (-431.776) -- 0:00:09
847000 -- (-430.655) (-429.468) (-430.241) [-429.302] * [-429.438] (-429.638) (-430.371) (-431.402) -- 0:00:09
847500 -- (-431.020) (-429.905) [-430.225] (-430.730) * (-431.581) [-430.604] (-430.241) (-433.091) -- 0:00:09
848000 -- (-433.076) (-432.576) [-432.216] (-429.870) * [-430.965] (-432.750) (-430.605) (-430.017) -- 0:00:09
848500 -- (-428.752) [-428.879] (-431.267) (-431.922) * (-427.751) (-429.691) [-429.292] (-428.197) -- 0:00:09
849000 -- (-431.554) (-432.817) (-433.124) [-434.516] * (-428.644) (-428.144) (-429.979) [-430.415] -- 0:00:09
849500 -- (-436.561) [-430.394] (-429.725) (-432.803) * (-436.414) (-430.397) [-428.058] (-428.518) -- 0:00:09
850000 -- (-429.969) (-429.017) (-436.800) [-428.202] * (-433.131) (-429.282) [-428.943] (-428.716) -- 0:00:09
Average standard deviation of split frequencies: 0.007389
850500 -- (-429.291) (-433.236) (-434.308) [-428.629] * (-430.056) (-427.753) [-428.614] (-432.240) -- 0:00:09
851000 -- (-434.164) [-429.279] (-431.606) (-430.488) * (-431.227) [-428.301] (-430.363) (-429.543) -- 0:00:09
851500 -- (-429.106) [-429.250] (-430.157) (-431.319) * (-429.658) (-430.155) [-431.815] (-428.282) -- 0:00:09
852000 -- (-429.933) [-429.976] (-434.623) (-430.141) * [-428.610] (-429.192) (-432.271) (-428.192) -- 0:00:09
852500 -- (-429.248) (-435.997) [-428.408] (-428.318) * (-430.915) (-429.339) (-430.714) [-429.246] -- 0:00:09
853000 -- (-430.630) (-428.577) (-431.024) [-427.771] * [-430.993] (-434.289) (-430.733) (-433.276) -- 0:00:09
853500 -- (-427.468) [-427.440] (-429.929) (-435.010) * [-427.364] (-434.656) (-429.272) (-429.537) -- 0:00:09
854000 -- (-427.455) (-428.413) (-434.784) [-428.619] * [-428.416] (-429.665) (-431.739) (-429.982) -- 0:00:09
854500 -- (-432.054) (-431.050) [-427.781] (-427.712) * (-429.927) (-430.604) (-429.724) [-429.633] -- 0:00:09
855000 -- [-428.478] (-436.488) (-428.713) (-427.674) * [-428.718] (-428.858) (-427.927) (-428.548) -- 0:00:08
Average standard deviation of split frequencies: 0.007012
855500 -- (-428.774) (-429.829) [-431.519] (-429.429) * (-427.914) (-428.833) [-429.255] (-427.864) -- 0:00:08
856000 -- (-427.446) (-428.384) [-431.384] (-432.737) * (-428.009) [-429.954] (-431.266) (-429.514) -- 0:00:08
856500 -- (-429.189) [-428.370] (-429.309) (-429.011) * (-428.603) (-434.077) (-428.768) [-430.301] -- 0:00:08
857000 -- (-432.371) (-427.798) [-432.435] (-427.581) * (-433.512) (-436.664) (-431.230) [-430.144] -- 0:00:08
857500 -- (-429.566) (-430.741) [-429.552] (-428.518) * [-430.418] (-429.039) (-429.053) (-428.697) -- 0:00:08
858000 -- (-427.753) (-428.822) (-433.087) [-432.928] * (-429.498) (-427.847) [-428.378] (-429.580) -- 0:00:08
858500 -- (-428.686) (-428.243) (-432.927) [-431.191] * [-430.020] (-428.090) (-428.426) (-431.359) -- 0:00:08
859000 -- (-429.118) (-428.781) (-432.551) [-430.889] * [-429.655] (-430.840) (-429.341) (-434.481) -- 0:00:08
859500 -- (-428.974) (-428.721) [-428.828] (-430.258) * (-430.445) (-430.819) (-430.582) [-428.881] -- 0:00:08
860000 -- (-429.281) (-429.695) (-429.994) [-428.309] * (-429.071) (-432.212) (-429.214) [-428.308] -- 0:00:08
Average standard deviation of split frequencies: 0.006646
860500 -- (-430.231) (-430.584) [-428.716] (-429.975) * (-429.677) (-428.310) [-428.810] (-430.382) -- 0:00:08
861000 -- (-430.168) (-432.848) [-432.026] (-428.477) * (-428.933) (-429.635) [-427.770] (-428.899) -- 0:00:08
861500 -- [-432.487] (-428.378) (-428.556) (-433.209) * (-432.073) [-430.144] (-428.735) (-429.405) -- 0:00:08
862000 -- (-428.524) (-429.059) [-431.672] (-429.818) * [-431.737] (-431.017) (-428.936) (-428.982) -- 0:00:08
862500 -- (-429.315) (-431.322) [-431.611] (-434.215) * [-431.014] (-430.412) (-431.758) (-430.455) -- 0:00:08
863000 -- (-434.137) [-427.993] (-429.681) (-429.600) * [-429.892] (-430.091) (-429.488) (-429.821) -- 0:00:08
863500 -- (-433.956) (-429.277) [-429.592] (-430.232) * (-430.689) [-431.691] (-430.337) (-429.054) -- 0:00:08
864000 -- (-428.377) (-427.686) (-428.643) [-430.683] * (-431.440) (-429.395) (-430.922) [-428.760] -- 0:00:08
864500 -- (-430.681) (-427.548) [-430.998] (-428.245) * (-435.576) (-434.195) (-430.523) [-427.984] -- 0:00:08
865000 -- (-429.864) (-428.510) [-428.941] (-429.117) * (-429.031) (-431.481) [-430.567] (-429.053) -- 0:00:08
Average standard deviation of split frequencies: 0.006605
865500 -- (-428.929) [-433.885] (-428.633) (-430.670) * (-428.563) [-431.656] (-431.807) (-427.870) -- 0:00:08
866000 -- (-428.301) (-432.567) [-429.365] (-431.552) * [-429.129] (-430.585) (-429.367) (-433.960) -- 0:00:08
866500 -- (-427.794) (-431.797) [-429.128] (-428.808) * (-430.388) [-430.488] (-431.071) (-431.445) -- 0:00:08
867000 -- [-428.931] (-434.686) (-428.213) (-431.558) * [-429.277] (-428.832) (-429.957) (-429.336) -- 0:00:08
867500 -- (-429.162) (-432.278) (-430.694) [-428.980] * (-429.384) (-431.520) [-428.653] (-429.118) -- 0:00:08
868000 -- (-430.553) (-428.934) [-430.823] (-428.238) * (-427.550) (-429.105) (-433.567) [-430.031] -- 0:00:08
868500 -- [-432.222] (-428.024) (-431.555) (-431.533) * [-428.728] (-428.931) (-428.073) (-431.837) -- 0:00:08
869000 -- (-427.824) (-430.122) (-429.641) [-432.014] * (-430.534) (-431.036) [-428.141] (-428.721) -- 0:00:08
869500 -- (-428.590) (-428.688) [-429.623] (-431.552) * (-431.683) [-431.951] (-428.782) (-430.932) -- 0:00:08
870000 -- [-429.728] (-429.627) (-428.947) (-431.378) * (-431.400) (-428.613) [-430.285] (-431.105) -- 0:00:08
Average standard deviation of split frequencies: 0.006822
870500 -- (-431.950) (-431.426) (-428.243) [-429.981] * (-430.932) (-430.828) [-428.396] (-429.358) -- 0:00:08
871000 -- (-427.632) (-434.419) (-430.493) [-429.184] * (-430.215) [-429.672] (-427.648) (-430.649) -- 0:00:07
871500 -- [-427.380] (-431.589) (-430.099) (-431.195) * (-431.194) [-429.953] (-428.023) (-434.910) -- 0:00:07
872000 -- [-429.017] (-427.940) (-429.028) (-430.397) * [-428.722] (-429.276) (-429.641) (-428.643) -- 0:00:07
872500 -- (-431.882) [-428.564] (-429.799) (-428.336) * (-430.306) [-429.239] (-428.190) (-431.051) -- 0:00:07
873000 -- [-428.612] (-430.179) (-428.051) (-431.624) * [-428.913] (-429.304) (-428.811) (-432.033) -- 0:00:07
873500 -- (-429.779) [-430.535] (-431.075) (-428.797) * [-432.892] (-430.915) (-428.685) (-431.088) -- 0:00:07
874000 -- (-430.790) (-430.782) (-431.603) [-428.293] * (-429.508) (-427.312) (-428.448) [-432.422] -- 0:00:07
874500 -- (-429.249) (-429.849) [-428.429] (-430.772) * (-430.424) [-430.014] (-429.186) (-428.039) -- 0:00:07
875000 -- (-433.916) (-427.478) [-428.617] (-429.908) * (-433.356) (-431.884) (-432.053) [-429.021] -- 0:00:07
Average standard deviation of split frequencies: 0.006924
875500 -- (-432.458) (-433.705) (-428.765) [-429.883] * (-430.887) (-429.890) [-429.712] (-429.601) -- 0:00:07
876000 -- (-429.727) [-428.009] (-430.122) (-427.773) * (-433.522) (-430.117) [-427.336] (-429.921) -- 0:00:07
876500 -- (-431.098) [-429.534] (-428.566) (-429.380) * (-429.397) [-431.379] (-432.421) (-429.495) -- 0:00:07
877000 -- (-432.239) (-430.647) [-431.325] (-431.133) * (-428.754) (-430.448) (-432.493) [-428.495] -- 0:00:07
877500 -- (-432.950) (-433.279) [-430.510] (-428.871) * (-431.385) [-427.884] (-429.810) (-428.691) -- 0:00:07
878000 -- (-431.209) [-431.195] (-428.343) (-428.848) * [-430.023] (-429.054) (-428.709) (-428.369) -- 0:00:07
878500 -- (-435.287) [-429.422] (-428.172) (-428.344) * [-429.256] (-428.667) (-429.367) (-427.842) -- 0:00:07
879000 -- [-431.605] (-428.161) (-431.861) (-428.039) * (-428.738) [-428.220] (-429.610) (-427.680) -- 0:00:07
879500 -- (-427.930) (-427.659) [-428.919] (-432.421) * (-428.776) (-429.484) [-427.794] (-430.247) -- 0:00:07
880000 -- (-427.941) (-428.519) [-431.417] (-427.709) * (-431.738) (-427.800) [-427.782] (-428.724) -- 0:00:07
Average standard deviation of split frequencies: 0.006923
880500 -- [-428.473] (-429.000) (-432.203) (-428.518) * (-432.137) (-429.485) (-429.497) [-428.042] -- 0:00:07
881000 -- (-430.422) (-428.141) (-432.682) [-429.679] * (-434.195) (-429.597) (-429.958) [-429.609] -- 0:00:07
881500 -- (-431.522) (-429.318) [-429.338] (-427.719) * (-428.991) [-429.628] (-430.154) (-429.004) -- 0:00:07
882000 -- [-430.779] (-430.490) (-431.793) (-427.797) * (-430.018) [-427.565] (-432.643) (-430.389) -- 0:00:07
882500 -- [-431.170] (-432.036) (-429.929) (-427.797) * (-427.618) (-427.562) (-433.404) [-427.973] -- 0:00:07
883000 -- (-434.917) [-427.408] (-432.643) (-427.796) * (-429.713) (-428.307) (-428.248) [-428.375] -- 0:00:07
883500 -- (-429.659) [-429.730] (-431.444) (-429.944) * (-427.463) [-428.812] (-428.733) (-428.264) -- 0:00:07
884000 -- (-431.494) [-430.832] (-429.349) (-430.579) * (-428.234) (-429.605) [-429.748] (-429.531) -- 0:00:07
884500 -- (-432.385) (-431.649) [-429.962] (-431.633) * (-428.450) [-432.788] (-429.032) (-429.516) -- 0:00:07
885000 -- (-428.818) (-428.867) (-429.190) [-429.246] * [-427.528] (-431.383) (-427.467) (-428.351) -- 0:00:07
Average standard deviation of split frequencies: 0.007094
885500 -- (-430.133) [-427.523] (-428.623) (-433.823) * (-428.713) [-428.351] (-432.758) (-431.529) -- 0:00:07
886000 -- (-430.133) [-427.924] (-429.644) (-431.404) * (-427.684) (-428.829) (-429.092) [-428.359] -- 0:00:07
886500 -- (-431.032) (-429.965) (-430.470) [-429.833] * [-430.848] (-427.880) (-429.814) (-432.500) -- 0:00:07
887000 -- (-428.341) (-430.653) (-429.048) [-429.528] * (-428.597) (-428.484) [-429.895] (-431.307) -- 0:00:07
887500 -- [-430.191] (-430.721) (-430.067) (-428.627) * (-428.359) (-431.269) (-429.605) [-433.358] -- 0:00:06
888000 -- (-429.122) (-430.945) (-430.600) [-428.467] * [-429.361] (-429.867) (-428.283) (-429.359) -- 0:00:06
888500 -- (-428.869) (-428.580) (-429.828) [-428.521] * [-429.052] (-428.750) (-430.208) (-428.782) -- 0:00:06
889000 -- (-428.795) [-427.775] (-432.229) (-430.250) * [-430.095] (-430.493) (-428.698) (-428.776) -- 0:00:06
889500 -- (-427.525) (-430.615) (-429.056) [-427.618] * (-429.210) (-431.102) (-427.747) [-429.338] -- 0:00:06
890000 -- (-431.126) (-429.487) [-430.485] (-431.175) * (-428.468) (-432.539) (-430.838) [-432.736] -- 0:00:06
Average standard deviation of split frequencies: 0.006845
890500 -- [-428.713] (-429.187) (-433.305) (-429.423) * (-430.300) (-430.047) [-427.859] (-427.878) -- 0:00:06
891000 -- [-429.291] (-431.084) (-429.176) (-430.523) * (-428.788) (-430.788) [-427.800] (-432.323) -- 0:00:06
891500 -- (-431.653) (-429.503) (-428.711) [-430.975] * [-429.419] (-430.888) (-431.963) (-432.093) -- 0:00:06
892000 -- (-429.467) (-428.910) [-427.588] (-428.940) * (-431.016) [-429.490] (-429.528) (-433.570) -- 0:00:06
892500 -- (-429.622) (-427.778) [-428.411] (-430.155) * (-430.931) [-428.020] (-432.607) (-428.764) -- 0:00:06
893000 -- (-429.123) [-429.161] (-429.925) (-428.473) * (-429.857) (-432.847) (-429.085) [-429.461] -- 0:00:06
893500 -- (-427.897) [-427.991] (-429.955) (-429.062) * (-429.633) (-433.283) (-427.902) [-427.856] -- 0:00:06
894000 -- (-430.897) [-428.363] (-428.343) (-428.083) * (-428.989) (-429.085) [-427.654] (-428.745) -- 0:00:06
894500 -- (-429.829) (-431.639) (-433.256) [-430.837] * (-428.691) [-429.152] (-429.130) (-434.146) -- 0:00:06
895000 -- [-429.888] (-432.526) (-429.338) (-429.878) * [-428.864] (-431.116) (-431.085) (-428.614) -- 0:00:06
Average standard deviation of split frequencies: 0.006384
895500 -- (-427.840) (-433.454) (-427.955) [-429.614] * (-427.639) (-432.609) (-429.280) [-431.658] -- 0:00:06
896000 -- (-429.959) [-428.564] (-428.561) (-428.823) * (-433.510) [-431.736] (-429.151) (-431.493) -- 0:00:06
896500 -- (-429.102) [-429.323] (-428.616) (-431.252) * (-432.931) (-431.174) (-431.493) [-429.988] -- 0:00:06
897000 -- (-429.079) [-428.565] (-433.639) (-430.675) * [-428.433] (-433.562) (-434.239) (-429.986) -- 0:00:06
897500 -- [-427.601] (-427.910) (-427.667) (-431.402) * [-430.378] (-432.275) (-431.685) (-428.684) -- 0:00:06
898000 -- (-427.941) [-430.116] (-429.578) (-433.394) * (-430.442) [-428.693] (-429.912) (-429.253) -- 0:00:06
898500 -- [-429.534] (-429.343) (-430.238) (-432.954) * (-428.673) [-428.854] (-434.267) (-429.235) -- 0:00:06
899000 -- [-427.160] (-432.383) (-429.671) (-430.441) * (-430.382) [-430.501] (-429.603) (-429.080) -- 0:00:06
899500 -- (-432.395) (-434.121) [-429.857] (-432.945) * (-427.784) (-430.097) (-430.408) [-428.431] -- 0:00:06
900000 -- [-428.694] (-429.847) (-429.763) (-430.836) * (-430.751) (-432.026) (-429.648) [-428.011] -- 0:00:06
Average standard deviation of split frequencies: 0.006490
900500 -- (-427.511) [-427.757] (-429.678) (-430.580) * (-429.274) (-432.962) (-427.422) [-428.058] -- 0:00:06
901000 -- (-427.511) (-430.959) (-429.551) [-430.395] * [-430.941] (-428.780) (-428.796) (-434.312) -- 0:00:06
901500 -- (-429.995) (-430.552) [-429.235] (-429.703) * [-428.484] (-430.237) (-428.037) (-432.873) -- 0:00:06
902000 -- (-428.891) [-429.708] (-432.614) (-428.380) * (-428.331) (-428.853) [-429.716] (-436.538) -- 0:00:06
902500 -- (-429.281) [-430.091] (-430.804) (-428.106) * (-428.796) (-428.063) [-428.901] (-432.093) -- 0:00:06
903000 -- (-431.877) [-432.739] (-428.433) (-428.400) * (-429.063) (-431.743) (-428.626) [-429.249] -- 0:00:06
903500 -- [-430.689] (-433.070) (-428.229) (-428.090) * (-428.461) [-432.471] (-435.125) (-431.299) -- 0:00:05
904000 -- (-428.062) (-431.682) [-429.128] (-430.164) * (-428.863) (-427.342) (-432.540) [-428.720] -- 0:00:05
904500 -- (-427.949) [-428.210] (-428.520) (-431.863) * (-427.397) (-430.104) [-428.074] (-428.678) -- 0:00:05
905000 -- [-428.526] (-429.868) (-429.865) (-429.227) * [-428.324] (-429.521) (-428.047) (-438.485) -- 0:00:05
Average standard deviation of split frequencies: 0.006556
905500 -- (-427.710) (-429.690) (-431.172) [-433.407] * (-428.441) [-428.712] (-435.543) (-432.806) -- 0:00:05
906000 -- [-428.622] (-431.532) (-429.602) (-429.588) * [-430.593] (-428.604) (-429.695) (-427.918) -- 0:00:05
906500 -- (-428.988) (-432.976) [-428.844] (-432.906) * (-427.971) [-430.032] (-428.440) (-431.596) -- 0:00:05
907000 -- (-428.985) (-429.272) [-427.883] (-434.544) * [-430.164] (-430.605) (-428.644) (-429.136) -- 0:00:05
907500 -- [-427.815] (-428.272) (-428.867) (-432.059) * [-429.073] (-429.651) (-433.178) (-429.083) -- 0:00:05
908000 -- (-429.278) (-430.580) [-427.761] (-429.343) * [-428.941] (-428.391) (-430.773) (-427.809) -- 0:00:05
908500 -- (-431.159) (-429.585) (-429.229) [-428.178] * [-428.308] (-439.454) (-430.836) (-429.240) -- 0:00:05
909000 -- (-436.912) [-430.894] (-430.012) (-430.678) * (-432.180) [-432.004] (-429.137) (-430.357) -- 0:00:05
909500 -- (-432.285) [-428.421] (-430.329) (-428.125) * (-429.023) (-430.584) (-429.365) [-428.374] -- 0:00:05
910000 -- [-428.619] (-429.652) (-430.676) (-430.788) * (-428.360) (-435.173) (-434.288) [-429.106] -- 0:00:05
Average standard deviation of split frequencies: 0.006281
910500 -- (-428.070) [-432.358] (-435.291) (-429.873) * [-428.808] (-427.381) (-430.067) (-429.596) -- 0:00:05
911000 -- (-428.364) (-433.498) (-430.798) [-428.001] * (-432.209) (-427.997) (-429.402) [-427.765] -- 0:00:05
911500 -- (-430.210) [-431.971] (-435.725) (-427.710) * (-427.836) (-430.883) (-431.523) [-428.417] -- 0:00:05
912000 -- (-429.439) (-427.725) (-428.421) [-427.562] * (-430.420) (-431.698) (-430.934) [-428.814] -- 0:00:05
912500 -- (-428.693) (-432.092) (-428.875) [-429.592] * [-428.815] (-430.533) (-428.479) (-430.143) -- 0:00:05
913000 -- [-428.143] (-431.066) (-436.654) (-431.290) * (-430.200) [-429.223] (-429.553) (-429.860) -- 0:00:05
913500 -- (-429.391) [-429.459] (-430.175) (-429.658) * (-430.095) (-431.555) (-428.847) [-429.323] -- 0:00:05
914000 -- (-430.021) (-430.542) (-431.172) [-432.951] * (-435.386) (-429.855) (-429.919) [-432.843] -- 0:00:05
914500 -- [-428.252] (-429.169) (-428.597) (-433.870) * (-429.757) (-428.626) [-428.525] (-432.306) -- 0:00:05
915000 -- [-433.460] (-428.374) (-427.512) (-428.532) * (-428.861) [-432.967] (-429.408) (-429.301) -- 0:00:05
Average standard deviation of split frequencies: 0.006416
915500 -- (-430.549) [-429.495] (-428.824) (-429.175) * (-430.704) (-429.374) [-428.282] (-427.914) -- 0:00:05
916000 -- [-428.656] (-429.827) (-430.541) (-429.654) * (-432.818) (-433.343) (-427.936) [-428.466] -- 0:00:05
916500 -- (-429.875) (-430.106) (-433.557) [-429.050] * (-428.813) (-428.216) (-428.105) [-429.599] -- 0:00:05
917000 -- (-430.886) (-434.118) (-430.634) [-429.760] * [-429.000] (-427.796) (-433.547) (-428.046) -- 0:00:05
917500 -- (-429.156) (-430.064) (-431.705) [-429.571] * [-428.235] (-431.191) (-433.187) (-432.007) -- 0:00:05
918000 -- [-429.898] (-432.433) (-428.461) (-430.264) * (-430.764) (-429.154) [-428.529] (-427.375) -- 0:00:05
918500 -- (-431.374) (-434.228) [-428.602] (-428.065) * [-428.127] (-428.484) (-429.086) (-429.369) -- 0:00:05
919000 -- (-431.849) [-428.518] (-429.177) (-433.972) * (-429.746) (-430.111) [-427.775] (-429.010) -- 0:00:05
919500 -- (-431.558) (-428.484) [-428.799] (-430.877) * [-429.571] (-428.661) (-430.551) (-433.269) -- 0:00:04
920000 -- (-432.301) (-431.824) [-432.048] (-431.424) * [-428.566] (-430.573) (-428.736) (-434.511) -- 0:00:04
Average standard deviation of split frequencies: 0.005974
920500 -- [-430.466] (-429.160) (-427.888) (-430.624) * [-427.664] (-428.503) (-429.991) (-433.452) -- 0:00:04
921000 -- (-429.987) [-429.395] (-430.244) (-431.021) * (-429.457) (-430.129) (-429.846) [-432.232] -- 0:00:04
921500 -- (-432.064) (-429.598) [-428.433] (-430.766) * (-428.087) (-431.881) [-431.173] (-431.005) -- 0:00:04
922000 -- (-431.099) (-427.854) (-430.825) [-429.926] * [-427.785] (-430.191) (-430.914) (-430.996) -- 0:00:04
922500 -- (-429.447) [-428.588] (-432.104) (-429.844) * (-428.275) (-433.235) (-428.215) [-428.283] -- 0:00:04
923000 -- [-431.170] (-429.512) (-430.245) (-430.984) * [-429.265] (-428.774) (-430.623) (-430.812) -- 0:00:04
923500 -- (-429.529) (-429.591) (-428.256) [-429.915] * [-428.234] (-432.333) (-429.498) (-430.488) -- 0:00:04
924000 -- (-428.991) (-428.565) (-430.543) [-431.030] * (-429.125) (-432.537) [-429.176] (-431.153) -- 0:00:04
924500 -- (-427.522) [-429.504] (-428.748) (-431.196) * (-429.738) (-429.128) [-427.444] (-429.268) -- 0:00:04
925000 -- (-432.162) [-428.922] (-429.395) (-428.669) * (-427.564) (-432.364) (-428.622) [-429.007] -- 0:00:04
Average standard deviation of split frequencies: 0.006007
925500 -- (-430.369) [-427.808] (-429.415) (-428.798) * (-431.044) (-431.746) (-428.086) [-433.268] -- 0:00:04
926000 -- (-430.372) [-428.040] (-428.050) (-429.562) * (-428.003) (-430.729) [-428.291] (-429.548) -- 0:00:04
926500 -- (-432.171) (-428.200) [-428.270] (-428.442) * [-427.416] (-427.825) (-428.047) (-435.119) -- 0:00:04
927000 -- (-428.993) [-428.049] (-429.008) (-429.206) * (-434.100) [-429.225] (-428.302) (-431.588) -- 0:00:04
927500 -- (-432.708) (-431.311) [-430.742] (-433.751) * (-427.590) (-432.606) (-428.570) [-428.052] -- 0:00:04
928000 -- (-428.574) [-428.734] (-432.603) (-434.425) * (-429.340) [-429.121] (-433.693) (-427.645) -- 0:00:04
928500 -- [-428.876] (-427.732) (-431.316) (-434.734) * (-429.196) (-431.367) [-428.338] (-428.151) -- 0:00:04
929000 -- (-427.662) (-428.182) (-434.410) [-429.714] * (-427.833) (-432.050) [-428.526] (-428.549) -- 0:00:04
929500 -- (-430.856) [-427.745] (-436.432) (-430.081) * (-428.520) [-428.607] (-428.759) (-428.303) -- 0:00:04
930000 -- (-430.125) (-429.325) [-429.059] (-429.495) * (-429.975) (-430.233) (-428.696) [-430.100] -- 0:00:04
Average standard deviation of split frequencies: 0.006146
930500 -- (-428.573) (-430.080) (-428.200) [-428.337] * (-429.621) [-428.576] (-430.088) (-430.357) -- 0:00:04
931000 -- (-429.211) (-429.658) [-429.562] (-429.213) * (-429.058) [-428.811] (-429.915) (-430.468) -- 0:00:04
931500 -- [-427.976] (-433.792) (-430.298) (-430.586) * (-429.695) (-430.145) [-429.002] (-428.535) -- 0:00:04
932000 -- [-428.490] (-432.186) (-430.985) (-428.497) * (-434.131) (-427.747) (-427.954) [-427.595] -- 0:00:04
932500 -- (-428.617) [-429.316] (-428.579) (-427.547) * (-430.197) [-429.433] (-428.105) (-427.365) -- 0:00:04
933000 -- (-429.325) (-433.316) [-431.491] (-427.388) * (-429.594) [-430.769] (-427.580) (-431.952) -- 0:00:04
933500 -- (-428.198) (-431.478) (-429.979) [-427.588] * (-435.451) (-428.788) [-430.131] (-429.154) -- 0:00:04
934000 -- (-428.935) [-431.842] (-428.590) (-428.442) * (-430.355) [-427.486] (-428.425) (-429.461) -- 0:00:04
934500 -- (-429.218) [-428.384] (-427.778) (-428.739) * (-433.010) (-431.754) [-428.226] (-428.276) -- 0:00:04
935000 -- (-428.429) (-429.634) (-430.166) [-433.717] * (-430.282) [-427.593] (-431.688) (-429.020) -- 0:00:04
Average standard deviation of split frequencies: 0.006178
935500 -- [-430.944] (-430.130) (-432.947) (-434.960) * [-429.245] (-432.540) (-430.071) (-432.910) -- 0:00:03
936000 -- (-429.485) (-433.981) (-429.611) [-428.801] * (-435.713) (-435.682) [-427.661] (-430.259) -- 0:00:03
936500 -- (-429.670) [-427.875] (-429.885) (-431.379) * [-434.881] (-436.621) (-429.902) (-433.560) -- 0:00:03
937000 -- (-431.534) (-428.245) [-430.225] (-429.525) * [-429.076] (-432.479) (-430.236) (-431.099) -- 0:00:03
937500 -- (-427.533) [-428.903] (-430.735) (-429.832) * (-428.679) (-430.129) (-431.888) [-427.527] -- 0:00:03
938000 -- [-427.808] (-428.203) (-427.920) (-433.254) * (-428.465) [-431.157] (-427.578) (-427.628) -- 0:00:03
938500 -- (-428.029) [-427.822] (-427.762) (-433.921) * (-431.388) [-433.363] (-428.243) (-431.368) -- 0:00:03
939000 -- (-432.708) [-430.106] (-427.585) (-430.704) * (-430.226) (-430.831) [-430.653] (-431.796) -- 0:00:03
939500 -- (-429.292) (-429.305) [-430.488] (-429.099) * [-429.286] (-430.093) (-428.553) (-431.108) -- 0:00:03
940000 -- (-428.891) (-430.908) (-433.353) [-432.249] * (-431.972) (-428.278) [-431.190] (-429.493) -- 0:00:03
Average standard deviation of split frequencies: 0.006114
940500 -- (-427.461) (-433.267) [-430.972] (-432.844) * (-433.572) (-428.168) (-434.631) [-429.442] -- 0:00:03
941000 -- (-427.485) (-434.008) [-427.611] (-428.733) * (-427.679) [-430.499] (-433.015) (-428.906) -- 0:00:03
941500 -- [-429.438] (-429.584) (-427.602) (-428.720) * (-430.908) [-430.578] (-431.329) (-429.219) -- 0:00:03
942000 -- [-428.629] (-432.433) (-427.704) (-435.895) * (-430.487) (-429.480) (-429.136) [-428.564] -- 0:00:03
942500 -- (-432.011) (-429.623) [-429.200] (-428.935) * (-432.273) [-430.611] (-428.907) (-428.995) -- 0:00:03
943000 -- (-433.755) (-430.515) (-428.446) [-430.829] * [-429.823] (-431.575) (-430.979) (-431.482) -- 0:00:03
943500 -- (-430.110) [-428.378] (-432.416) (-428.712) * [-428.017] (-433.405) (-434.589) (-428.487) -- 0:00:03
944000 -- (-430.024) (-430.237) [-428.839] (-435.286) * (-429.358) (-430.051) (-430.103) [-432.198] -- 0:00:03
944500 -- (-430.683) (-429.240) [-428.007] (-435.217) * (-429.424) [-428.903] (-429.741) (-429.294) -- 0:00:03
945000 -- (-429.640) [-428.683] (-429.584) (-429.295) * [-427.548] (-430.537) (-434.609) (-428.231) -- 0:00:03
Average standard deviation of split frequencies: 0.006212
945500 -- (-431.941) [-430.034] (-428.702) (-429.656) * (-431.226) (-429.872) (-430.821) [-429.346] -- 0:00:03
946000 -- (-434.365) (-430.973) [-429.981] (-430.846) * (-430.614) [-429.075] (-429.361) (-431.693) -- 0:00:03
946500 -- (-429.658) (-427.597) (-430.902) [-427.688] * (-431.599) (-429.554) [-429.687] (-430.520) -- 0:00:03
947000 -- (-429.966) [-427.857] (-429.395) (-433.153) * (-429.822) (-429.534) (-431.140) [-429.219] -- 0:00:03
947500 -- (-428.800) [-430.856] (-429.255) (-428.737) * (-430.488) (-429.470) [-429.722] (-431.594) -- 0:00:03
948000 -- (-427.655) [-429.194] (-432.913) (-430.215) * [-432.005] (-429.730) (-428.145) (-431.233) -- 0:00:03
948500 -- [-430.484] (-430.592) (-429.274) (-432.681) * (-431.358) [-429.488] (-434.103) (-428.001) -- 0:00:03
949000 -- (-433.823) (-429.090) (-428.323) [-427.593] * (-430.723) (-430.369) [-429.297] (-431.205) -- 0:00:03
949500 -- [-429.836] (-429.622) (-427.272) (-433.081) * (-429.434) [-428.422] (-429.651) (-430.601) -- 0:00:03
950000 -- [-429.296] (-435.213) (-427.261) (-430.070) * (-430.432) (-429.288) [-429.196] (-430.113) -- 0:00:03
Average standard deviation of split frequencies: 0.005917
950500 -- (-428.096) (-430.320) [-428.592] (-431.134) * [-430.295] (-429.751) (-428.184) (-428.047) -- 0:00:03
951000 -- (-430.067) (-427.467) (-430.935) [-428.191] * (-430.835) [-430.927] (-429.136) (-430.886) -- 0:00:03
951500 -- (-430.468) [-428.453] (-430.120) (-442.634) * (-430.267) [-427.642] (-431.085) (-428.002) -- 0:00:03
952000 -- (-431.126) [-430.066] (-429.526) (-429.019) * (-430.625) (-428.194) [-430.127] (-430.709) -- 0:00:02
952500 -- (-431.442) (-429.313) [-430.331] (-428.136) * (-431.502) [-431.125] (-432.361) (-428.641) -- 0:00:02
953000 -- [-431.417] (-428.375) (-430.954) (-430.693) * (-436.505) (-430.482) [-433.954] (-430.059) -- 0:00:02
953500 -- [-431.516] (-429.744) (-434.918) (-430.111) * (-431.572) (-431.487) (-428.993) [-430.764] -- 0:00:02
954000 -- [-429.508] (-427.670) (-428.581) (-433.067) * [-427.459] (-428.609) (-432.468) (-433.697) -- 0:00:02
954500 -- (-430.614) [-428.545] (-428.717) (-432.101) * (-427.913) (-428.509) [-431.664] (-428.931) -- 0:00:02
955000 -- (-430.494) [-428.276] (-430.034) (-432.586) * (-430.996) (-429.833) [-430.350] (-430.972) -- 0:00:02
Average standard deviation of split frequencies: 0.005917
955500 -- [-431.143] (-428.068) (-428.526) (-432.823) * (-429.706) [-428.674] (-429.212) (-429.618) -- 0:00:02
956000 -- (-428.823) [-429.939] (-427.838) (-428.607) * (-434.355) [-430.450] (-431.659) (-428.996) -- 0:00:02
956500 -- [-430.836] (-429.413) (-430.321) (-428.505) * (-431.458) (-428.736) (-429.612) [-432.258] -- 0:00:02
957000 -- (-429.481) [-427.699] (-428.304) (-429.990) * (-427.907) (-429.650) [-428.507] (-432.779) -- 0:00:02
957500 -- (-431.643) [-429.079] (-429.544) (-429.912) * [-429.025] (-429.723) (-428.431) (-433.497) -- 0:00:02
958000 -- [-430.781] (-427.558) (-428.500) (-428.188) * (-427.867) (-428.939) (-428.987) [-429.644] -- 0:00:02
958500 -- (-431.266) (-428.301) (-427.652) [-432.563] * [-428.656] (-429.417) (-434.166) (-428.568) -- 0:00:02
959000 -- (-431.037) (-430.979) [-430.006] (-430.941) * (-429.884) (-430.465) (-428.342) [-428.718] -- 0:00:02
959500 -- (-429.359) [-429.372] (-429.175) (-430.291) * [-428.672] (-428.183) (-429.613) (-428.085) -- 0:00:02
960000 -- (-431.774) [-428.127] (-428.719) (-427.546) * (-432.757) (-429.504) (-428.899) [-427.706] -- 0:00:02
Average standard deviation of split frequencies: 0.005921
960500 -- (-428.555) [-429.727] (-428.178) (-433.389) * (-434.304) [-430.097] (-429.461) (-430.996) -- 0:00:02
961000 -- (-434.401) (-430.477) (-429.107) [-430.294] * (-428.465) (-428.500) (-430.432) [-430.408] -- 0:00:02
961500 -- (-434.455) (-430.239) [-429.823] (-429.654) * (-430.343) (-431.984) [-429.564] (-432.467) -- 0:00:02
962000 -- (-429.935) (-429.964) [-427.840] (-429.486) * (-436.564) (-429.380) (-428.759) [-431.673] -- 0:00:02
962500 -- (-429.627) [-430.580] (-427.538) (-429.525) * [-430.130] (-431.628) (-428.064) (-429.624) -- 0:00:02
963000 -- [-429.335] (-431.618) (-428.411) (-428.438) * (-429.641) [-429.944] (-428.811) (-431.707) -- 0:00:02
963500 -- (-427.736) [-429.467] (-428.379) (-432.029) * (-427.308) [-431.727] (-429.824) (-428.835) -- 0:00:02
964000 -- (-429.661) (-431.916) (-428.700) [-430.015] * [-427.182] (-433.321) (-428.613) (-430.119) -- 0:00:02
964500 -- (-429.937) (-429.472) (-432.289) [-429.183] * (-427.189) [-432.064] (-430.757) (-430.129) -- 0:00:02
965000 -- (-428.198) (-428.525) [-430.559] (-429.151) * (-429.535) [-429.327] (-430.215) (-429.083) -- 0:00:02
Average standard deviation of split frequencies: 0.006214
965500 -- [-430.420] (-428.140) (-431.198) (-428.523) * (-429.560) (-432.811) [-430.374] (-432.804) -- 0:00:02
966000 -- (-431.252) (-429.681) [-431.179] (-428.468) * (-430.451) [-432.117] (-428.605) (-435.254) -- 0:00:02
966500 -- (-429.601) (-427.898) [-434.298] (-430.452) * (-429.339) [-431.370] (-433.805) (-437.561) -- 0:00:02
967000 -- [-427.392] (-429.288) (-431.503) (-430.698) * (-431.696) [-431.408] (-431.278) (-430.247) -- 0:00:02
967500 -- (-427.671) (-430.956) (-433.718) [-429.733] * (-430.098) (-429.370) (-428.652) [-429.123] -- 0:00:02
968000 -- [-427.726] (-428.101) (-428.922) (-430.526) * (-430.391) [-427.617] (-429.914) (-431.287) -- 0:00:01
968500 -- (-429.485) (-428.870) [-429.368] (-430.031) * (-430.112) [-428.712] (-431.565) (-429.411) -- 0:00:01
969000 -- (-432.593) (-428.096) (-429.805) [-430.498] * (-427.725) [-428.670] (-433.710) (-427.501) -- 0:00:01
969500 -- (-429.198) (-430.004) (-429.051) [-428.850] * (-427.735) (-427.448) (-434.088) [-431.238] -- 0:00:01
970000 -- [-431.086] (-433.734) (-432.471) (-431.400) * (-428.089) (-428.717) (-433.540) [-428.192] -- 0:00:01
Average standard deviation of split frequencies: 0.006864
970500 -- (-433.113) (-429.743) [-431.609] (-432.960) * [-428.731] (-431.311) (-427.870) (-429.563) -- 0:00:01
971000 -- [-429.264] (-429.810) (-431.191) (-430.502) * (-431.117) (-428.375) (-431.220) [-435.477] -- 0:00:01
971500 -- (-428.949) (-430.503) (-429.126) [-429.150] * (-428.847) [-428.323] (-431.845) (-435.361) -- 0:00:01
972000 -- (-428.690) (-430.495) [-427.518] (-427.950) * (-434.084) [-431.605] (-433.951) (-432.040) -- 0:00:01
972500 -- [-430.562] (-432.931) (-428.637) (-430.444) * (-434.725) [-428.839] (-434.589) (-428.148) -- 0:00:01
973000 -- (-429.522) (-428.446) [-429.770] (-428.204) * [-428.646] (-431.007) (-434.793) (-429.813) -- 0:00:01
973500 -- (-427.874) (-428.462) [-428.732] (-432.085) * (-430.815) [-429.179] (-430.207) (-429.107) -- 0:00:01
974000 -- [-427.773] (-436.806) (-433.041) (-431.136) * (-431.661) (-428.613) [-435.262] (-428.880) -- 0:00:01
974500 -- (-430.882) (-439.670) [-429.056] (-428.941) * (-433.873) (-428.685) (-428.696) [-428.154] -- 0:00:01
975000 -- (-429.162) (-428.865) (-429.762) [-427.737] * (-428.536) (-429.003) (-429.701) [-428.597] -- 0:00:01
Average standard deviation of split frequencies: 0.006826
975500 -- (-427.782) (-429.247) [-428.220] (-428.063) * (-428.672) (-430.421) (-430.557) [-428.979] -- 0:00:01
976000 -- (-427.451) [-429.236] (-429.178) (-430.116) * (-429.008) (-427.704) (-429.732) [-428.652] -- 0:00:01
976500 -- (-428.101) (-428.346) (-428.305) [-428.873] * [-428.723] (-427.964) (-432.950) (-432.435) -- 0:00:01
977000 -- (-427.984) (-428.231) [-428.100] (-429.477) * [-428.360] (-430.388) (-433.254) (-434.723) -- 0:00:01
977500 -- [-428.109] (-430.002) (-430.658) (-430.697) * (-428.603) [-431.071] (-435.476) (-430.946) -- 0:00:01
978000 -- (-427.792) (-429.843) [-430.760] (-427.817) * (-431.564) (-428.685) (-429.645) [-429.337] -- 0:00:01
978500 -- [-428.839] (-430.266) (-429.231) (-428.252) * (-430.631) (-430.635) [-430.520] (-428.165) -- 0:00:01
979000 -- (-429.915) (-429.726) (-431.487) [-431.175] * (-430.553) [-429.125] (-428.527) (-427.545) -- 0:00:01
979500 -- [-430.241] (-434.423) (-429.312) (-436.270) * [-429.118] (-428.196) (-429.354) (-427.990) -- 0:00:01
980000 -- [-430.162] (-428.416) (-428.594) (-428.304) * (-430.509) [-428.485] (-429.867) (-428.358) -- 0:00:01
Average standard deviation of split frequencies: 0.006730
980500 -- (-431.441) (-429.122) [-430.735] (-427.955) * (-430.416) [-428.898] (-431.235) (-430.358) -- 0:00:01
981000 -- (-430.219) (-429.950) (-437.933) [-428.084] * (-430.043) [-428.821] (-433.385) (-427.677) -- 0:00:01
981500 -- (-431.738) [-429.375] (-429.007) (-430.730) * (-428.417) [-430.784] (-428.980) (-428.248) -- 0:00:01
982000 -- (-428.963) (-428.091) (-428.284) [-431.646] * (-429.369) (-429.031) (-429.079) [-428.615] -- 0:00:01
982500 -- (-428.588) (-428.793) (-427.967) [-428.439] * (-429.152) (-431.213) (-429.783) [-429.321] -- 0:00:01
983000 -- (-432.541) [-430.820] (-430.888) (-431.682) * (-428.785) [-430.085] (-429.129) (-427.657) -- 0:00:01
983500 -- (-433.475) (-431.176) [-430.399] (-432.129) * (-429.632) [-427.924] (-429.282) (-427.679) -- 0:00:01
984000 -- (-434.186) (-433.038) [-431.212] (-428.645) * (-430.825) (-427.516) (-430.678) [-427.623] -- 0:00:00
984500 -- (-428.539) [-429.337] (-429.984) (-429.710) * (-430.899) (-430.543) [-430.143] (-428.966) -- 0:00:00
985000 -- (-429.694) [-428.898] (-427.668) (-429.584) * (-430.844) (-430.965) [-429.897] (-429.054) -- 0:00:00
Average standard deviation of split frequencies: 0.007076
985500 -- [-429.090] (-429.007) (-432.164) (-429.742) * [-429.854] (-430.336) (-429.433) (-434.120) -- 0:00:00
986000 -- (-427.666) (-428.436) (-429.146) [-429.294] * (-432.501) (-430.382) [-428.219] (-430.084) -- 0:00:00
986500 -- (-430.345) (-429.916) [-429.029] (-427.840) * (-428.859) (-432.262) [-428.185] (-432.360) -- 0:00:00
987000 -- (-431.026) (-429.359) [-430.975] (-429.116) * (-430.285) (-431.371) [-428.817] (-430.751) -- 0:00:00
987500 -- (-428.443) [-428.640] (-428.282) (-430.569) * (-430.432) [-429.484] (-428.859) (-436.105) -- 0:00:00
988000 -- [-427.940] (-428.744) (-427.893) (-429.676) * [-434.301] (-430.812) (-428.482) (-432.798) -- 0:00:00
988500 -- (-432.375) [-431.344] (-427.726) (-428.682) * (-434.155) (-429.162) (-429.585) [-430.445] -- 0:00:00
989000 -- [-432.463] (-429.772) (-428.100) (-428.861) * [-429.627] (-428.809) (-428.666) (-430.847) -- 0:00:00
989500 -- (-436.064) (-433.719) [-429.144] (-428.285) * (-430.186) (-430.442) (-430.038) [-432.087] -- 0:00:00
990000 -- (-430.428) (-429.714) [-427.967] (-429.177) * (-428.964) (-429.065) (-431.247) [-431.990] -- 0:00:00
Average standard deviation of split frequencies: 0.007138
990500 -- [-428.884] (-430.876) (-430.515) (-434.059) * (-430.308) (-429.606) [-428.555] (-429.826) -- 0:00:00
991000 -- (-429.476) (-428.255) (-431.186) [-429.194] * (-429.352) (-429.605) (-431.922) [-429.109] -- 0:00:00
991500 -- (-428.126) (-430.675) [-429.396] (-428.703) * (-427.608) (-429.865) (-428.623) [-429.680] -- 0:00:00
992000 -- (-428.253) [-432.906] (-430.032) (-430.280) * [-430.359] (-430.678) (-430.153) (-432.489) -- 0:00:00
992500 -- (-430.210) (-432.482) (-428.805) [-429.302] * [-429.811] (-429.938) (-428.759) (-432.969) -- 0:00:00
993000 -- (-432.007) (-431.397) (-430.706) [-428.622] * [-428.225] (-432.498) (-429.093) (-434.274) -- 0:00:00
993500 -- (-427.827) [-427.569] (-432.627) (-430.086) * [-428.432] (-434.458) (-429.060) (-430.282) -- 0:00:00
994000 -- (-428.284) [-428.548] (-432.916) (-432.210) * (-429.278) [-428.395] (-429.559) (-431.958) -- 0:00:00
994500 -- (-428.965) (-428.471) [-430.220] (-431.170) * (-429.924) [-430.109] (-434.243) (-430.205) -- 0:00:00
995000 -- (-430.079) (-430.347) [-428.521] (-428.206) * (-430.080) (-428.859) (-432.393) [-430.484] -- 0:00:00
Average standard deviation of split frequencies: 0.007447
995500 -- (-428.718) (-427.399) (-430.526) [-429.590] * (-433.009) [-432.282] (-428.533) (-428.919) -- 0:00:00
996000 -- (-429.714) [-429.347] (-429.517) (-430.996) * [-428.284] (-431.530) (-429.883) (-429.882) -- 0:00:00
996500 -- (-428.703) (-431.695) [-430.456] (-430.966) * [-430.288] (-431.362) (-428.875) (-431.778) -- 0:00:00
997000 -- (-429.597) (-431.604) [-431.126] (-430.578) * (-430.975) (-428.906) (-428.925) [-432.752] -- 0:00:00
997500 -- (-432.055) (-427.990) (-427.333) [-429.216] * (-431.223) (-431.130) [-430.100] (-427.576) -- 0:00:00
998000 -- (-429.406) (-427.751) [-428.358] (-432.313) * (-430.320) (-428.588) (-430.233) [-429.646] -- 0:00:00
998500 -- (-430.081) [-428.896] (-428.470) (-430.149) * (-430.740) [-428.390] (-429.275) (-430.050) -- 0:00:00
999000 -- [-429.758] (-432.831) (-430.879) (-429.056) * (-428.233) (-428.361) [-428.694] (-427.920) -- 0:00:00
999500 -- (-432.726) (-428.568) (-430.244) [-431.012] * (-429.669) [-429.400] (-433.487) (-428.483) -- 0:00:00
1000000 -- (-427.506) [-429.252] (-428.536) (-431.131) * [-432.413] (-430.768) (-432.526) (-428.144) -- 0:00:00
Average standard deviation of split frequencies: 0.007600
Analysis completed in 1 mins 2 seconds
Analysis used 61.37 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -427.16
Likelihood of best state for "cold" chain of run 2 was -427.16
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
38.2 % ( 31 %) Dirichlet(Pi{all})
37.8 % ( 26 %) Slider(Pi{all})
79.6 % ( 69 %) Multiplier(Alpha{1,2})
77.8 % ( 46 %) Multiplier(Alpha{3})
25.5 % ( 27 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.5 % ( 61 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.3 % ( 95 %) Nodeslider(V{all})
30.6 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.3 % ( 37 %) Dirichlet(Pi{all})
36.9 % ( 20 %) Slider(Pi{all})
78.6 % ( 49 %) Multiplier(Alpha{1,2})
77.9 % ( 53 %) Multiplier(Alpha{3})
25.8 % ( 34 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 36 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 167231 0.82 0.67
3 | 167314 166667 0.84
4 | 166186 166155 166447
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167400 0.82 0.67
3 | 165938 166485 0.84
4 | 166719 166687 166771
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -428.81
| 1 |
| 2 1 21 |
| 2 1 1 12 22 22 2 |
| 2 2 2 1 2 2 2 11 |
| 2 21 2 1 1 21 12 22 1 |
| * 2 1 2 2 *2 1 * 2 11|
| 121 2 111*2 212 1 1 1 |
| 1 2 2 12 22 2 2 1 1 11 11 1 2 1 |
|2 2 1 1 1 1 1 2 2 1 2 2 |
| 2 1 1 1 21 2 |
|11 1 1 * 2 2 2 2 2|
| 1 2 1 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -430.76
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -428.88 -431.90
2 -428.86 -432.56
--------------------------------------
TOTAL -428.87 -432.29
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897289 0.093234 0.365363 1.539730 0.858834 1318.85 1409.92 1.000
r(A<->C){all} 0.175672 0.022000 0.000001 0.476734 0.136180 135.57 183.05 1.000
r(A<->G){all} 0.159723 0.018767 0.000190 0.431247 0.121672 300.88 347.58 1.000
r(A<->T){all} 0.173477 0.021108 0.000011 0.462552 0.134324 61.86 141.78 1.000
r(C<->G){all} 0.160700 0.019263 0.000238 0.444791 0.123407 131.84 251.29 1.000
r(C<->T){all} 0.169915 0.020909 0.000065 0.456736 0.133003 173.50 202.13 1.000
r(G<->T){all} 0.160514 0.019942 0.000270 0.454571 0.119585 94.23 94.98 1.000
pi(A){all} 0.163013 0.000413 0.122543 0.202146 0.162314 1380.90 1385.20 1.000
pi(C){all} 0.253946 0.000572 0.207974 0.300894 0.254140 1421.64 1430.02 1.000
pi(G){all} 0.332384 0.000719 0.280932 0.387324 0.332057 1230.27 1312.49 1.000
pi(T){all} 0.250657 0.000581 0.203485 0.298856 0.249963 1395.83 1405.89 1.000
alpha{1,2} 0.394327 0.201015 0.000134 1.325140 0.243095 1191.24 1198.72 1.000
alpha{3} 0.457530 0.235137 0.000166 1.450346 0.296808 1240.64 1288.42 1.001
pinvar{all} 0.994778 0.000039 0.982697 0.999996 0.996792 1104.44 1191.96 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .*..*.
9 -- .****.
10 -- .**.**
11 -- ..*..*
12 -- ..*.*.
13 -- .**...
14 -- ..****
15 -- ....**
16 -- .*.***
17 -- ..**..
18 -- ...*.*
19 -- .*.*..
20 -- .*...*
21 -- .***.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 471 0.156895 0.013662 0.147235 0.166556 2
8 452 0.150566 0.000000 0.150566 0.150566 2
9 450 0.149900 0.004711 0.146569 0.153231 2
10 442 0.147235 0.016017 0.135909 0.158561 2
11 436 0.145237 0.004711 0.141905 0.148568 2
12 431 0.143571 0.006124 0.139241 0.147901 2
13 431 0.143571 0.002355 0.141905 0.145237 2
14 427 0.142239 0.006124 0.137908 0.146569 2
15 419 0.139574 0.007066 0.134577 0.144570 2
16 419 0.139574 0.003298 0.137242 0.141905 2
17 417 0.138907 0.007066 0.133911 0.143904 2
18 417 0.138907 0.009893 0.131912 0.145903 2
19 413 0.137575 0.019315 0.123917 0.151233 2
20 411 0.136909 0.004240 0.133911 0.139907 2
21 402 0.133911 0.009422 0.127249 0.140573 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098311 0.009892 0.000008 0.304289 0.066722 1.000 2
length{all}[2] 0.101415 0.010281 0.000041 0.308546 0.068677 1.000 2
length{all}[3] 0.100515 0.009633 0.000030 0.298220 0.069285 1.000 2
length{all}[4] 0.098598 0.009553 0.000034 0.292859 0.067233 1.000 2
length{all}[5] 0.098577 0.009395 0.000085 0.285407 0.071324 1.000 2
length{all}[6] 0.098233 0.009382 0.000003 0.292089 0.068791 1.000 2
length{all}[7] 0.103233 0.010695 0.000132 0.276389 0.069399 1.000 2
length{all}[8] 0.098672 0.009034 0.000052 0.269623 0.071095 0.998 2
length{all}[9] 0.101355 0.009444 0.000288 0.303934 0.069920 0.998 2
length{all}[10] 0.106106 0.010766 0.000115 0.322245 0.074723 0.998 2
length{all}[11] 0.100306 0.008520 0.000172 0.290730 0.074906 0.998 2
length{all}[12] 0.098910 0.008788 0.000676 0.284061 0.066965 0.998 2
length{all}[13] 0.097969 0.009072 0.000094 0.294391 0.071625 1.011 2
length{all}[14] 0.098275 0.008665 0.000068 0.288246 0.068484 0.998 2
length{all}[15] 0.101308 0.009475 0.000115 0.294051 0.070173 1.001 2
length{all}[16] 0.101974 0.010822 0.000232 0.312776 0.068570 1.001 2
length{all}[17] 0.098244 0.010031 0.000117 0.322268 0.066811 0.998 2
length{all}[18] 0.093396 0.007353 0.001568 0.256316 0.070953 1.000 2
length{all}[19] 0.101270 0.010271 0.000500 0.291827 0.072988 0.998 2
length{all}[20] 0.096456 0.010743 0.000033 0.298639 0.059817 1.006 2
length{all}[21] 0.098839 0.009350 0.001229 0.297027 0.071963 1.007 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007600
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 315
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 105 / 105 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 105 / 105 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108622 0.059027 0.032723 0.076294 0.073962 0.092077 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -463.269339
Iterating by ming2
Initial: fx= 463.269339
x= 0.10862 0.05903 0.03272 0.07629 0.07396 0.09208 0.30000 1.30000
1 h-m-p 0.0000 0.0003 251.5514 +++ 443.201860 m 0.0003 14 | 1/8
2 h-m-p 0.0020 0.0109 36.5348 ------------.. | 1/8
3 h-m-p 0.0000 0.0003 230.6794 +++ 429.576699 m 0.0003 47 | 2/8
4 h-m-p 0.0019 0.0175 27.3507 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 207.1156 ++ 423.329100 m 0.0001 79 | 3/8
6 h-m-p 0.0013 0.0290 20.6954 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 179.7125 ++ 422.595116 m 0.0000 110 | 4/8
8 h-m-p 0.0002 0.0425 15.5412 ----------.. | 4/8
9 h-m-p 0.0000 0.0002 146.5783 ++ 419.276768 m 0.0002 140 | 5/8
10 h-m-p 0.0015 0.0653 10.4768 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 103.7914 +++ 417.526885 m 0.0002 172 | 6/8
12 h-m-p 1.1364 8.0000 0.0000 ++ 417.526885 m 8.0000 183 | 6/8
13 h-m-p 0.0341 8.0000 0.0005 ----C 417.526885 0 0.0000 200 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 --C 417.526885 0 0.0003 215
Out..
lnL = -417.526885
216 lfun, 216 eigenQcodon, 1296 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068565 0.016943 0.069552 0.025327 0.052507 0.020071 0.299873 0.782637 0.396876
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.634744
np = 9
lnL0 = -443.163519
Iterating by ming2
Initial: fx= 443.163519
x= 0.06856 0.01694 0.06955 0.02533 0.05251 0.02007 0.29987 0.78264 0.39688
1 h-m-p 0.0000 0.0002 245.0080 +++ 432.996806 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0002 106.6181 ++ 431.394866 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0001 136.5443 ++ 429.678857 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0003 408.0957 ++ 421.334462 m 0.0003 51 | 4/9
5 h-m-p 0.0000 0.0000 8018.2225 ++ 417.646601 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 702.4638 ++ 417.526847 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 417.526847 m 8.0000 87 | 6/9
8 h-m-p 0.0053 0.9581 0.2024 ++++ 417.526830 m 0.9581 104 | 7/9
9 h-m-p 0.2087 8.0000 0.0985 ---------------.. | 7/9
10 h-m-p 0.0160 8.0000 0.0001 +++++ 417.526830 m 8.0000 149 | 7/9
11 h-m-p 0.0051 2.5605 0.3134 ---------C 417.526830 0 0.0000 172 | 7/9
12 h-m-p 0.0160 8.0000 0.0004 +++++ 417.526829 m 8.0000 189 | 7/9
13 h-m-p 0.0087 2.7452 0.3441 ----------Y 417.526829 0 0.0000 213 | 7/9
14 h-m-p 0.0160 8.0000 0.0288 +++++ 417.526783 m 8.0000 230 | 7/9
15 h-m-p 0.5341 2.8144 0.4317 ---------------C 417.526783 0 0.0000 259 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526783 m 8.0000 276 | 7/9
17 h-m-p 0.0090 4.4894 0.2185 ----------Y 417.526783 0 0.0000 300 | 7/9
18 h-m-p 0.0160 8.0000 0.0004 -------C 417.526783 0 0.0000 321 | 7/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526783 m 8.0000 338 | 7/9
20 h-m-p 0.0089 4.4668 0.2190 ----------Y 417.526783 0 0.0000 362 | 7/9
21 h-m-p 0.0160 8.0000 0.0014 +++++ 417.526779 m 8.0000 379 | 7/9
22 h-m-p 0.0519 4.4721 0.2211 ------------N 417.526779 0 0.0000 405 | 7/9
23 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526779 m 8.0000 422 | 7/9
24 h-m-p 0.0092 4.6064 0.2107 ------------Y 417.526779 0 0.0000 448 | 7/9
25 h-m-p 0.0160 8.0000 0.0000 ----------C 417.526779 0 0.0000 472 | 7/9
26 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526779 m 8.0000 489 | 7/9
27 h-m-p 0.0097 4.8402 0.2042 -----------Y 417.526779 0 0.0000 514 | 7/9
28 h-m-p 0.0160 8.0000 0.0000 ------Y 417.526779 0 0.0000 534 | 7/9
29 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526779 m 8.0000 551 | 7/9
30 h-m-p 0.0093 4.6417 0.2130 -------------.. | 7/9
31 h-m-p 0.0160 8.0000 0.0003 +++++ 417.526778 m 8.0000 593 | 7/9
32 h-m-p 0.0129 4.6602 0.2136 -----------Y 417.526778 0 0.0000 618 | 7/9
33 h-m-p 0.0160 8.0000 0.0029 +++++ 417.526770 m 8.0000 635 | 7/9
34 h-m-p 0.0968 4.8601 0.2402 ------------Y 417.526770 0 0.0000 661 | 7/9
35 h-m-p 0.0160 8.0000 0.0001 -------C 417.526770 0 0.0000 682 | 7/9
36 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526770 m 8.0000 699 | 7/9
37 h-m-p 0.0114 5.7064 0.1979 -------------.. | 7/9
38 h-m-p 0.0160 8.0000 0.0004 +++++ 417.526768 m 8.0000 741 | 7/9
39 h-m-p 0.0153 5.0275 0.2022 -------------.. | 7/9
40 h-m-p 0.0160 8.0000 0.0004 +++++ 417.526767 m 8.0000 783 | 7/9
41 h-m-p 0.0156 5.0803 0.2007 ------------Y 417.526767 0 0.0000 809 | 7/9
42 h-m-p 0.0000 0.0025 3.1032 ++++ 417.526764 m 0.0025 825 | 8/9
43 h-m-p 0.0273 8.0000 0.0615 -------------C 417.526764 0 0.0000 850 | 8/9
44 h-m-p 0.0160 8.0000 0.0000 -C 417.526764 0 0.0010 864
Out..
lnL = -417.526764
865 lfun, 2595 eigenQcodon, 10380 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096565 0.091496 0.079817 0.031939 0.019114 0.074698 0.095248 1.313709 0.284774 0.216559 1.428120
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.011782
np = 11
lnL0 = -455.466402
Iterating by ming2
Initial: fx= 455.466402
x= 0.09657 0.09150 0.07982 0.03194 0.01911 0.07470 0.09525 1.31371 0.28477 0.21656 1.42812
1 h-m-p 0.0000 0.0002 222.3432 +++ 445.018201 m 0.0002 17 | 1/11
2 h-m-p 0.0001 0.0005 127.8912 ++ 438.669804 m 0.0005 31 | 2/11
3 h-m-p 0.0001 0.0007 179.5342 ++ 422.697042 m 0.0007 45 | 3/11
4 h-m-p 0.0002 0.0010 45.6605 ++ 420.736526 m 0.0010 59 | 4/11
5 h-m-p 0.0000 0.0000 1655.6407 ++ 420.085189 m 0.0000 73 | 5/11
6 h-m-p 0.0024 0.0221 4.1231 ------------.. | 5/11
7 h-m-p 0.0000 0.0001 142.0958 ++ 418.083894 m 0.0001 111 | 6/11
8 h-m-p 0.0032 0.0336 3.1128 ------------.. | 6/11
9 h-m-p 0.0000 0.0001 101.9574 ++ 417.526847 m 0.0001 149 | 7/11
10 h-m-p 0.1655 8.0000 0.0000 +++ 417.526847 m 8.0000 164 | 7/11
11 h-m-p 0.0185 8.0000 0.0015 +++++ 417.526847 m 8.0000 185 | 7/11
12 h-m-p 0.0023 0.0860 5.1793 --------Y 417.526847 0 0.0000 211 | 7/11
13 h-m-p 0.0160 8.0000 0.0004 +++++ 417.526847 m 8.0000 228 | 7/11
14 h-m-p 0.0002 0.0403 16.9449 --------Y 417.526847 0 0.0000 254 | 7/11
15 h-m-p 0.0160 8.0000 0.0049 +++++ 417.526847 m 8.0000 271 | 7/11
16 h-m-p 0.0141 0.2565 2.8004 ------------C 417.526847 0 0.0000 301 | 7/11
17 h-m-p 0.0160 8.0000 0.0000 -Y 417.526847 0 0.0010 316 | 7/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 417.526847 m 8.0000 337 | 7/11
19 h-m-p 0.0002 0.0946 6.0882 ------Y 417.526847 0 0.0000 361 | 7/11
20 h-m-p 0.0190 8.0000 0.0000 +++++ 417.526847 m 8.0000 378 | 7/11
21 h-m-p 0.0193 8.0000 0.0015 +++++ 417.526847 m 8.0000 399 | 7/11
22 h-m-p 0.0036 0.1716 3.4367 ---------N 417.526847 0 0.0000 426 | 7/11
23 h-m-p 0.0288 8.0000 0.0000 -----Y 417.526847 0 0.0000 445 | 7/11
24 h-m-p 0.0160 8.0000 0.0000 ---------Y 417.526847 0 0.0000 472
Out..
lnL = -417.526847
473 lfun, 1892 eigenQcodon, 8514 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -417.533117 S = -417.525644 -0.002857
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:05
did 20 / 50 patterns 0:05
did 30 / 50 patterns 0:05
did 40 / 50 patterns 0:05
did 50 / 50 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109118 0.065292 0.077827 0.066334 0.014248 0.030530 0.083217 0.821474 1.601258
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.286860
np = 9
lnL0 = -453.227487
Iterating by ming2
Initial: fx= 453.227487
x= 0.10912 0.06529 0.07783 0.06633 0.01425 0.03053 0.08322 0.82147 1.60126
1 h-m-p 0.0000 0.0001 232.9929 ++ 445.159470 m 0.0001 14 | 1/9
2 h-m-p 0.0008 0.0040 32.1299 ++ 442.732371 m 0.0040 26 | 2/9
3 h-m-p 0.0000 0.0001 914.5640 ++ 441.091950 m 0.0001 38 | 3/9
4 h-m-p 0.0007 0.0069 94.0300 ++ 435.097388 m 0.0069 50 | 4/9
5 h-m-p 0.0033 0.0163 9.4183 ++ 431.848331 m 0.0163 62 | 5/9
6 h-m-p 0.0003 0.0017 49.3685 ++ 421.222879 m 0.0017 74 | 6/9
7 h-m-p 0.0005 0.0027 14.1235 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 137.0800 ++ 418.804587 m 0.0001 107 | 7/9
9 h-m-p 0.0160 8.0000 1.0648 -------------.. | 7/9
10 h-m-p 0.0000 0.0001 97.4672 ++ 417.526755 m 0.0001 142 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 417.526755 0 1.6000 154 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 Y 417.526755 0 1.6000 167
Out..
lnL = -417.526755
168 lfun, 1848 eigenQcodon, 10080 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035764 0.038226 0.080151 0.094564 0.070566 0.052126 0.000100 0.900000 0.426481 1.828601 1.299822
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.008790
np = 11
lnL0 = -452.454193
Iterating by ming2
Initial: fx= 452.454193
x= 0.03576 0.03823 0.08015 0.09456 0.07057 0.05213 0.00011 0.90000 0.42648 1.82860 1.29982
1 h-m-p 0.0000 0.0000 215.0061 ++ 452.308757 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0019 115.4604 ++++ 432.906119 m 0.0019 32 | 2/11
3 h-m-p 0.0000 0.0000 21331.5413 ++ 431.741840 m 0.0000 46 | 3/11
4 h-m-p 0.0006 0.0076 23.2500 ++ 428.851538 m 0.0076 60 | 4/11
5 h-m-p 0.0002 0.0008 45.9613 ++ 427.199394 m 0.0008 74 | 5/11
6 h-m-p 0.0000 0.0001 2598.7104 ++ 423.102556 m 0.0001 88 | 6/11
7 h-m-p 0.0005 0.0026 144.9948 ++ 418.320493 m 0.0026 102 | 7/11
8 h-m-p 0.0507 0.2533 2.6062 --------------.. | 7/11
9 h-m-p 0.0000 0.0001 101.7166 ++ 417.526851 m 0.0001 142 | 8/11
10 h-m-p 0.4579 8.0000 0.0000 +++ 417.526851 m 8.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0068 ----------C 417.526851 0 0.0000 184 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526851 m 8.0000 204 | 8/11
13 h-m-p 0.0160 8.0000 0.3357 --------C 417.526851 0 0.0000 229 | 8/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 417.526851 m 8.0000 249 | 8/11
15 h-m-p 0.0139 6.9596 0.3947 ------------Y 417.526851 0 0.0000 278 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 ------Y 417.526851 0 0.0000 301 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526851 m 8.0000 321 | 8/11
18 h-m-p 0.0160 8.0000 0.0545 +++++ 417.526839 m 8.0000 341 | 8/11
19 h-m-p 0.3031 8.0000 1.4372 -------------Y 417.526839 0 0.0000 371 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526839 m 8.0000 388 | 8/11
21 h-m-p 0.0160 8.0000 0.0004 +++++ 417.526839 m 8.0000 408 | 8/11
22 h-m-p 0.0160 8.0000 1.1487 -------------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 417.526839 m 8.0000 453 | 8/11
24 h-m-p 0.0023 1.1361 0.5970 ----------N 417.526839 0 0.0000 480 | 8/11
25 h-m-p 0.0160 8.0000 0.0054 +++++ 417.526833 m 8.0000 500 | 8/11
26 h-m-p 0.1125 1.8018 0.3868 -------------Y 417.526833 0 0.0000 530 | 8/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526833 m 8.0000 550 | 8/11
28 h-m-p 0.0040 1.9892 0.3460 -----------C 417.526833 0 0.0000 578 | 8/11
29 h-m-p 0.0160 8.0000 0.0001 +++++ 417.526833 m 8.0000 598 | 8/11
30 h-m-p 0.0042 2.0842 0.5584 -----------Y 417.526833 0 0.0000 626 | 8/11
31 h-m-p 0.0160 8.0000 0.0000 ----Y 417.526833 0 0.0000 647 | 8/11
32 h-m-p 0.0160 8.0000 0.0000 +++++ 417.526833 m 8.0000 667 | 8/11
33 h-m-p 0.0009 0.4736 0.6271 --------C 417.526833 0 0.0000 692 | 8/11
34 h-m-p 0.0160 8.0000 0.0021 ------------C 417.526833 0 0.0000 721 | 8/11
35 h-m-p 0.0160 8.0000 0.0000 ------Y 417.526833 0 0.0000 744
Out..
lnL = -417.526833
745 lfun, 8940 eigenQcodon, 49170 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -417.537054 S = -417.525820 -0.004929
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:20
did 20 / 50 patterns 0:20
did 30 / 50 patterns 0:20
did 40 / 50 patterns 0:20
did 50 / 50 patterns 0:20
Time used: 0:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=105
NC_011896_1_WP_010907810_1_600_MLBR_RS02835 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
NC_002677_1_NP_301486_1_358_ML0574 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL
**************************************************
NC_011896_1_WP_010907810_1_600_MLBR_RS02835 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
NC_002677_1_NP_301486_1_358_ML0574 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220 VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI
**************************************************
NC_011896_1_WP_010907810_1_600_MLBR_RS02835 IMRDA
NC_002677_1_NP_301486_1_358_ML0574 IMRDA
NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300 IMRDA
NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525 IMRDA
NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130 IMRDA
NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220 IMRDA
*****
>NC_011896_1_WP_010907810_1_600_MLBR_RS02835 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT ATTATGCGCGATGCG >NC_002677_1_NP_301486_1_358_ML0574 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT ATTATGCGCGATGCG >NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT ATTATGCGCGATGCG >NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT ATTATGCGCGATGCG >NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT ATTATGCGCGATGCG >NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220 GTGACCCTACATATACCCAGGTTCGCACGGTATTCGACGATGCGATCGTT GCGATTTGCTAGTACGGCAACCAGATTCAAGCGTGCATGGTCGGTATCGG TCGAGTTGGCGGTGGTGGATGCCGGTCGGGACTCTGGGTTGGTGGAGTTG GTGGATGCGCTCAGCCTAGAAGTTGGCGCGCCGGGGGATGCCGTGCTAGC GACTCGCCGACTGTCGGTGTTGATTTGTGCCGCTAGCTTCCCATACCGTC CTGTTCAACAGCGTGCGAATCAGACTTTCCTGGCCGTGGCCACCGGCATT ATTATGCGCGATGCG
>NC_011896_1_WP_010907810_1_600_MLBR_RS02835 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI IMRDA >NC_002677_1_NP_301486_1_358_ML0574 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI IMRDA >NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI IMRDA >NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI IMRDA >NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI IMRDA >NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220 VTLHIPRFARYSTMRSLRFASTATRFKRAWSVSVELAVVDAGRDSGLVEL VDALSLEVGAPGDAVLATRRLSVLICAASFPYRPVQQRANQTFLAVATGI IMRDA
#NEXUS
[ID: 0305269938]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907810_1_600_MLBR_RS02835
NC_002677_1_NP_301486_1_358_ML0574
NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300
NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525
NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130
NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907810_1_600_MLBR_RS02835,
2 NC_002677_1_NP_301486_1_358_ML0574,
3 NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300,
4 NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525,
5 NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130,
6 NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06672238,2:0.06867651,3:0.06928462,4:0.06723257,5:0.07132368,6:0.0687909);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06672238,2:0.06867651,3:0.06928462,4:0.06723257,5:0.07132368,6:0.0687909);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -428.88 -431.90
2 -428.86 -432.56
--------------------------------------
TOTAL -428.87 -432.29
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0574/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897289 0.093234 0.365363 1.539730 0.858834 1318.85 1409.92 1.000
r(A<->C){all} 0.175672 0.022000 0.000001 0.476734 0.136180 135.57 183.05 1.000
r(A<->G){all} 0.159723 0.018767 0.000190 0.431247 0.121672 300.88 347.58 1.000
r(A<->T){all} 0.173477 0.021108 0.000011 0.462552 0.134324 61.86 141.78 1.000
r(C<->G){all} 0.160700 0.019263 0.000238 0.444791 0.123407 131.84 251.29 1.000
r(C<->T){all} 0.169915 0.020909 0.000065 0.456736 0.133003 173.50 202.13 1.000
r(G<->T){all} 0.160514 0.019942 0.000270 0.454571 0.119585 94.23 94.98 1.000
pi(A){all} 0.163013 0.000413 0.122543 0.202146 0.162314 1380.90 1385.20 1.000
pi(C){all} 0.253946 0.000572 0.207974 0.300894 0.254140 1421.64 1430.02 1.000
pi(G){all} 0.332384 0.000719 0.280932 0.387324 0.332057 1230.27 1312.49 1.000
pi(T){all} 0.250657 0.000581 0.203485 0.298856 0.249963 1395.83 1405.89 1.000
alpha{1,2} 0.394327 0.201015 0.000134 1.325140 0.243095 1191.24 1198.72 1.000
alpha{3} 0.457530 0.235137 0.000166 1.450346 0.296808 1240.64 1288.42 1.001
pinvar{all} 0.994778 0.000039 0.982697 0.999996 0.996792 1104.44 1191.96 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0574/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 105
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 2 2 2 2 2 2
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 3 3 3 3 3 3
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 0 0 0 0 0 0 | ACC 3 3 3 3 3 3 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 5 5 5 5 5 5 | GAC 1 1 1 1 1 1 | GGC 2 2 2 2 2 2
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 8 8 8 8 8 8 | GCG 6 6 6 6 6 6 | GAG 2 2 2 2 2 2 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907810_1_600_MLBR_RS02835
position 1: T:0.19048 C:0.22857 A:0.19048 G:0.39048
position 2: T:0.32381 C:0.31429 A:0.15238 G:0.20952
position 3: T:0.23810 C:0.21905 A:0.14286 G:0.40000
Average T:0.25079 C:0.25397 A:0.16190 G:0.33333
#2: NC_002677_1_NP_301486_1_358_ML0574
position 1: T:0.19048 C:0.22857 A:0.19048 G:0.39048
position 2: T:0.32381 C:0.31429 A:0.15238 G:0.20952
position 3: T:0.23810 C:0.21905 A:0.14286 G:0.40000
Average T:0.25079 C:0.25397 A:0.16190 G:0.33333
#3: NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300
position 1: T:0.19048 C:0.22857 A:0.19048 G:0.39048
position 2: T:0.32381 C:0.31429 A:0.15238 G:0.20952
position 3: T:0.23810 C:0.21905 A:0.14286 G:0.40000
Average T:0.25079 C:0.25397 A:0.16190 G:0.33333
#4: NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525
position 1: T:0.19048 C:0.22857 A:0.19048 G:0.39048
position 2: T:0.32381 C:0.31429 A:0.15238 G:0.20952
position 3: T:0.23810 C:0.21905 A:0.14286 G:0.40000
Average T:0.25079 C:0.25397 A:0.16190 G:0.33333
#5: NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130
position 1: T:0.19048 C:0.22857 A:0.19048 G:0.39048
position 2: T:0.32381 C:0.31429 A:0.15238 G:0.20952
position 3: T:0.23810 C:0.21905 A:0.14286 G:0.40000
Average T:0.25079 C:0.25397 A:0.16190 G:0.33333
#6: NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220
position 1: T:0.19048 C:0.22857 A:0.19048 G:0.39048
position 2: T:0.32381 C:0.31429 A:0.15238 G:0.20952
position 3: T:0.23810 C:0.21905 A:0.14286 G:0.40000
Average T:0.25079 C:0.25397 A:0.16190 G:0.33333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 24 | TCC 0 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 30 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 18
CTC 6 | CCC 6 | CAC 0 | CGC 12
CTA 18 | CCA 6 | Gln Q CAA 6 | CGA 18
CTG 12 | CCG 6 | CAG 12 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 6
ATC 0 | ACC 18 | AAC 0 | AGC 12
ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 12 | ACG 12 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 6
GTC 6 | GCC 30 | GAC 6 | GGC 12
GTA 6 | GCA 18 | Glu E GAA 6 | GGA 0
GTG 48 | GCG 36 | GAG 12 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19048 C:0.22857 A:0.19048 G:0.39048
position 2: T:0.32381 C:0.31429 A:0.15238 G:0.20952
position 3: T:0.23810 C:0.21905 A:0.14286 G:0.40000
Average T:0.25079 C:0.25397 A:0.16190 G:0.33333
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -417.526885 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299873 1.299822
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907810_1_600_MLBR_RS02835: 0.000004, NC_002677_1_NP_301486_1_358_ML0574: 0.000004, NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300: 0.000004, NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525: 0.000004, NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130: 0.000004, NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29987
omega (dN/dS) = 1.29982
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.2 88.8 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 226.2 88.8 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 226.2 88.8 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 226.2 88.8 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 226.2 88.8 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 226.2 88.8 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -417.526764 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.095248 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907810_1_600_MLBR_RS02835: 0.000004, NC_002677_1_NP_301486_1_358_ML0574: 0.000004, NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300: 0.000004, NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525: 0.000004, NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130: 0.000004, NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.09525
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 227.3 87.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 227.3 87.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 227.3 87.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 227.3 87.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 227.3 87.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 227.3 87.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -417.526847 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.083217 0.619733 0.216725 0.000001 1.387721
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907810_1_600_MLBR_RS02835: 0.000004, NC_002677_1_NP_301486_1_358_ML0574: 0.000004, NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300: 0.000004, NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525: 0.000004, NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130: 0.000004, NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.08322
MLEs of dN/dS (w) for site classes (K=3)
p: 0.61973 0.21672 0.16354
w: 0.00000 1.00000 1.38772
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 227.4 87.6 0.4437 0.0000 0.0000 0.0 0.0
7..2 0.000 227.4 87.6 0.4437 0.0000 0.0000 0.0 0.0
7..3 0.000 227.4 87.6 0.4437 0.0000 0.0000 0.0 0.0
7..4 0.000 227.4 87.6 0.4437 0.0000 0.0000 0.0 0.0
7..5 0.000 227.4 87.6 0.4437 0.0000 0.0000 0.0 0.0
7..6 0.000 227.4 87.6 0.4437 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907810_1_600_MLBR_RS02835)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907810_1_600_MLBR_RS02835)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -417.526755 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.439610
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907810_1_600_MLBR_RS02835: 0.000004, NC_002677_1_NP_301486_1_358_ML0574: 0.000004, NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300: 0.000004, NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525: 0.000004, NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130: 0.000004, NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.43961
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 227.9 87.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 227.9 87.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 227.9 87.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 227.9 87.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 227.9 87.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 227.9 87.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -417.526833 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.688655 0.005000 1.667552 1.084631
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907810_1_600_MLBR_RS02835: 0.000004, NC_002677_1_NP_301486_1_358_ML0574: 0.000004, NZ_LVXE01000026_1_WP_010907810_1_1089_A3216_RS08300: 0.000004, NZ_LYPH01000029_1_WP_010907810_1_1151_A8144_RS05525: 0.000004, NZ_CP029543_1_WP_010907810_1_614_DIJ64_RS03130: 0.000004, NZ_AP014567_1_WP_010907810_1_632_JK2ML_RS03220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.68865 p = 0.00500 q = 1.66755
(p1 = 0.31135) w = 1.08463
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06887 0.06887 0.06887 0.06887 0.06887 0.06887 0.06887 0.06887 0.06887 0.06887 0.31135
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.08463
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 227.9 87.1 0.3377 0.0000 0.0000 0.0 0.0
7..2 0.000 227.9 87.1 0.3377 0.0000 0.0000 0.0 0.0
7..3 0.000 227.9 87.1 0.3377 0.0000 0.0000 0.0 0.0
7..4 0.000 227.9 87.1 0.3377 0.0000 0.0000 0.0 0.0
7..5 0.000 227.9 87.1 0.3377 0.0000 0.0000 0.0 0.0
7..6 0.000 227.9 87.1 0.3377 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907810_1_600_MLBR_RS02835)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907810_1_600_MLBR_RS02835)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:20
Model 1: NearlyNeutral -417.526764 Model 2: PositiveSelection -417.526847 Model 0: one-ratio -417.526885 Model 7: beta -417.526755 Model 8: beta&w>1 -417.526833 Model 0 vs 1 2.4199999995744292E-4 Model 2 vs 1 1.659999999219508E-4 Model 8 vs 7 1.560000000608852E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
