--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:15:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0575/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.41 -293.44
2 -290.44 -294.59
--------------------------------------
TOTAL -290.42 -294.17
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888275 0.091130 0.358555 1.485524 0.850055 1254.09 1377.55 1.001
r(A<->C){all} 0.178700 0.020543 0.000086 0.464850 0.141762 222.07 271.33 1.001
r(A<->G){all} 0.169585 0.019848 0.000010 0.450349 0.136194 113.59 215.07 1.000
r(A<->T){all} 0.156016 0.017085 0.000040 0.403471 0.123546 138.19 217.40 1.004
r(C<->G){all} 0.160352 0.019817 0.000045 0.454347 0.119823 247.67 315.41 1.002
r(C<->T){all} 0.169279 0.021497 0.000062 0.472792 0.129971 219.84 285.34 1.000
r(G<->T){all} 0.166068 0.020927 0.000049 0.452535 0.123543 175.28 183.27 1.000
pi(A){all} 0.136312 0.000541 0.093349 0.184774 0.135412 1175.32 1338.16 1.000
pi(C){all} 0.232607 0.000802 0.179851 0.292352 0.230992 1350.34 1361.31 1.000
pi(G){all} 0.326461 0.000982 0.264069 0.385344 0.325517 1274.41 1387.71 1.000
pi(T){all} 0.304620 0.000988 0.246475 0.368926 0.304562 1163.00 1315.46 1.000
alpha{1,2} 0.403519 0.224955 0.000134 1.349261 0.236161 1150.55 1283.07 1.000
alpha{3} 0.457428 0.251070 0.000149 1.496312 0.283319 1166.97 1295.62 1.000
pinvar{all} 0.991707 0.000105 0.973121 1.000000 0.994952 1112.08 1214.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -271.614493
Model 2: PositiveSelection -271.614437
Model 0: one-ratio -271.614437
Model 7: beta -271.614525
Model 8: beta&w>1 -271.614437
Model 0 vs 1 1.1199999994460086E-4
Model 2 vs 1 1.1199999994460086E-4
Model 8 vs 7 1.7600000001039007E-4
>C1
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C2
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C3
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C4
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C5
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C6
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=72
C1 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C2 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C3 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C4 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C5 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C6 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
**************************************************
C1 MLISTVVVVCRIPVVAGRSVVA
C2 MLISTVVVVCRIPVVAGRSVVA
C3 MLISTVVVVCRIPVVAGRSVVA
C4 MLISTVVVVCRIPVVAGRSVVA
C5 MLISTVVVVCRIPVVAGRSVVA
C6 MLISTVVVVCRIPVVAGRSVVA
**********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 72 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 72 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2160]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2160]--->[2160]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.446 Mb, Max= 30.591 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C2 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C3 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C4 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C5 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
C6 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
**************************************************
C1 MLISTVVVVCRIPVVAGRSVVA
C2 MLISTVVVVCRIPVVAGRSVVA
C3 MLISTVVVVCRIPVVAGRSVVA
C4 MLISTVVVVCRIPVVAGRSVVA
C5 MLISTVVVVCRIPVVAGRSVVA
C6 MLISTVVVVCRIPVVAGRSVVA
**********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
C2 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
C3 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
C4 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
C5 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
C6 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
**************************************************
C1 ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
C2 ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
C3 ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
C4 ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
C5 ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
C6 ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
**************************************************
C1 AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
C2 AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
C3 AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
C4 AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
C5 AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
C6 AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
**************************************************
C1 ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
C2 ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
C3 ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
C4 ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
C5 ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
C6 ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
**************************************************
C1 GAGATCGGTGGTTGCC
C2 GAGATCGGTGGTTGCC
C3 GAGATCGGTGGTTGCC
C4 GAGATCGGTGGTTGCC
C5 GAGATCGGTGGTTGCC
C6 GAGATCGGTGGTTGCC
****************
>C1
GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
GAGATCGGTGGTTGCC
>C2
GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
GAGATCGGTGGTTGCC
>C3
GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
GAGATCGGTGGTTGCC
>C4
GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
GAGATCGGTGGTTGCC
>C5
GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
GAGATCGGTGGTTGCC
>C6
GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA
ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC
AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC
ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG
GAGATCGGTGGTTGCC
>C1
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C2
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C3
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C4
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C5
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
>C6
VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
MLISTVVVVCRIPVVAGRSVVA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 216 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579796033
Setting output file names to "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 707464880
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0859190610
Seed = 1402513814
Swapseed = 1579796033
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -483.418352 -- -24.965149
Chain 2 -- -483.418352 -- -24.965149
Chain 3 -- -483.418352 -- -24.965149
Chain 4 -- -483.418352 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -483.418323 -- -24.965149
Chain 2 -- -483.418352 -- -24.965149
Chain 3 -- -483.418323 -- -24.965149
Chain 4 -- -483.418352 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-483.418] (-483.418) (-483.418) (-483.418) * [-483.418] (-483.418) (-483.418) (-483.418)
500 -- (-301.868) (-305.586) [-306.146] (-301.654) * (-306.555) (-309.927) (-303.867) [-299.794] -- 0:00:00
1000 -- [-301.173] (-299.743) (-301.184) (-305.823) * (-300.463) (-303.202) (-313.508) [-298.406] -- 0:00:00
1500 -- [-306.947] (-301.541) (-305.330) (-301.366) * (-294.632) (-298.237) (-300.371) [-302.080] -- 0:00:00
2000 -- (-300.993) (-303.603) (-300.764) [-299.765] * [-298.957] (-298.257) (-299.636) (-295.954) -- 0:00:00
2500 -- (-297.879) (-306.959) (-305.431) [-299.015] * [-298.053] (-298.328) (-299.618) (-304.933) -- 0:00:00
3000 -- (-298.962) (-298.418) [-294.800] (-299.313) * [-298.191] (-302.133) (-297.101) (-298.218) -- 0:00:00
3500 -- (-295.921) (-294.778) (-308.314) [-300.857] * [-298.493] (-304.387) (-300.435) (-303.869) -- 0:00:00
4000 -- (-297.825) (-298.724) [-296.291] (-306.594) * [-303.047] (-301.067) (-301.302) (-308.201) -- 0:00:00
4500 -- (-299.932) [-297.355] (-302.532) (-299.356) * (-297.165) (-299.055) [-303.727] (-306.690) -- 0:00:00
5000 -- (-300.384) (-302.541) (-304.583) [-294.883] * [-298.124] (-299.122) (-301.189) (-301.550) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- [-294.466] (-303.171) (-303.445) (-295.425) * [-299.695] (-300.028) (-298.209) (-299.301) -- 0:00:00
6000 -- (-302.564) (-298.396) (-301.911) [-297.010] * [-295.840] (-300.275) (-301.856) (-304.133) -- 0:00:00
6500 -- (-309.583) (-301.808) [-298.528] (-299.308) * (-301.847) (-296.918) [-295.509] (-299.582) -- 0:00:00
7000 -- (-302.687) (-310.874) [-301.817] (-297.296) * [-297.738] (-298.036) (-298.763) (-305.647) -- 0:00:00
7500 -- (-309.301) (-297.379) [-303.837] (-301.161) * [-295.398] (-301.569) (-306.162) (-307.735) -- 0:00:00
8000 -- (-304.439) (-305.613) [-296.052] (-304.726) * (-299.383) (-302.524) [-296.673] (-304.510) -- 0:00:00
8500 -- (-294.378) [-300.771] (-305.560) (-301.527) * (-296.316) (-300.246) [-296.439] (-304.407) -- 0:00:00
9000 -- (-293.610) (-301.242) (-299.210) [-295.456] * (-300.779) (-305.262) [-298.893] (-295.458) -- 0:00:00
9500 -- (-291.514) (-295.730) (-299.061) [-300.186] * (-305.858) (-300.055) [-293.692] (-294.666) -- 0:00:00
10000 -- [-289.409] (-302.642) (-304.937) (-319.056) * (-297.569) [-296.836] (-299.838) (-289.909) -- 0:01:39
Average standard deviation of split frequencies: 0.084371
10500 -- (-291.911) [-301.944] (-304.823) (-300.237) * (-290.319) (-295.939) [-297.136] (-291.346) -- 0:01:34
11000 -- (-291.027) [-300.976] (-302.579) (-295.485) * [-289.807] (-303.076) (-307.008) (-290.178) -- 0:01:29
11500 -- (-292.331) (-297.791) (-307.251) [-291.319] * (-290.618) (-298.240) [-302.289] (-290.809) -- 0:01:25
12000 -- [-292.508] (-299.449) (-308.082) (-290.772) * (-292.014) (-302.109) (-305.316) [-290.240] -- 0:01:22
12500 -- (-291.885) (-304.436) [-299.983] (-290.925) * [-290.070] (-296.840) (-308.018) (-291.023) -- 0:01:19
13000 -- [-290.834] (-308.138) (-297.527) (-290.481) * [-294.994] (-302.943) (-300.856) (-291.824) -- 0:01:15
13500 -- (-294.201) (-304.180) [-289.793] (-289.680) * (-291.996) (-300.649) (-304.270) [-297.832] -- 0:01:13
14000 -- (-289.202) (-300.683) (-292.299) [-289.614] * [-293.343] (-299.120) (-309.743) (-295.721) -- 0:01:10
14500 -- (-291.570) (-301.385) [-290.713] (-289.877) * (-289.762) (-303.267) (-300.318) [-291.093] -- 0:01:07
15000 -- (-292.015) [-301.112] (-289.660) (-291.227) * [-289.392] (-298.185) (-310.399) (-289.342) -- 0:01:05
Average standard deviation of split frequencies: 0.074996
15500 -- (-292.968) (-303.831) [-290.013] (-291.576) * (-290.032) (-302.481) [-304.487] (-290.156) -- 0:01:03
16000 -- (-290.466) (-302.386) (-290.251) [-291.795] * (-289.586) [-297.487] (-308.788) (-290.478) -- 0:01:01
16500 -- (-292.623) (-298.571) (-290.051) [-293.246] * (-289.992) (-304.435) (-300.944) [-291.412] -- 0:00:59
17000 -- (-294.545) (-304.958) [-290.458] (-291.128) * (-289.469) (-302.523) (-302.913) [-290.650] -- 0:00:57
17500 -- (-290.347) [-303.805] (-292.947) (-290.778) * [-291.223] (-308.698) (-302.787) (-289.788) -- 0:00:56
18000 -- (-289.989) (-313.742) (-291.539) [-291.830] * (-294.118) (-307.119) (-301.612) [-294.923] -- 0:00:54
18500 -- (-293.945) (-309.210) [-290.504] (-290.265) * (-292.171) (-292.276) (-306.930) [-292.048] -- 0:00:53
19000 -- (-290.119) (-297.270) [-291.630] (-289.149) * [-289.518] (-290.579) (-315.418) (-290.218) -- 0:00:51
19500 -- (-291.049) (-289.672) (-291.294) [-290.725] * (-292.555) (-291.909) [-300.627] (-291.490) -- 0:00:50
20000 -- (-292.835) (-291.664) [-290.823] (-289.886) * (-288.995) (-291.472) (-310.168) [-290.696] -- 0:00:49
Average standard deviation of split frequencies: 0.048471
20500 -- [-295.155] (-291.663) (-293.252) (-291.164) * [-290.650] (-293.682) (-298.499) (-291.312) -- 0:00:47
21000 -- (-294.707) [-291.879] (-292.603) (-288.853) * [-290.743] (-291.097) (-291.452) (-291.018) -- 0:00:46
21500 -- (-292.626) (-293.618) [-290.969] (-289.679) * (-291.634) (-290.471) [-291.795] (-291.345) -- 0:00:45
22000 -- [-292.350] (-291.850) (-293.133) (-290.960) * (-290.409) [-289.327] (-289.433) (-291.393) -- 0:00:44
22500 -- [-290.173] (-289.030) (-295.169) (-290.410) * (-292.625) [-290.124] (-290.580) (-293.134) -- 0:00:43
23000 -- (-293.471) [-290.850] (-290.508) (-290.021) * [-291.907] (-289.769) (-291.775) (-292.531) -- 0:00:42
23500 -- (-292.973) (-290.849) (-291.191) [-288.853] * (-295.559) (-291.528) [-291.856] (-292.142) -- 0:00:41
24000 -- (-292.690) (-289.839) [-290.663] (-289.077) * (-296.217) (-291.475) [-292.910] (-290.976) -- 0:00:40
24500 -- [-290.588] (-302.288) (-291.748) (-293.359) * (-292.683) (-289.885) [-291.191] (-290.841) -- 0:00:39
25000 -- (-288.781) [-289.381] (-293.595) (-292.570) * (-289.502) (-290.512) [-291.819] (-293.509) -- 0:00:39
Average standard deviation of split frequencies: 0.040291
25500 -- (-290.169) [-291.922] (-290.364) (-289.181) * (-289.913) (-289.734) (-289.377) [-288.835] -- 0:00:38
26000 -- (-291.156) [-290.649] (-289.250) (-288.717) * (-290.076) (-291.385) [-291.148] (-291.829) -- 0:01:14
26500 -- (-289.834) [-290.951] (-289.409) (-289.736) * (-292.977) (-290.738) (-290.515) [-288.891] -- 0:01:13
27000 -- (-292.074) (-291.357) [-291.299] (-291.043) * (-294.456) (-290.508) (-290.296) [-290.970] -- 0:01:12
27500 -- [-292.675] (-290.820) (-291.083) (-289.975) * (-300.017) (-289.893) (-294.131) [-290.800] -- 0:01:10
28000 -- [-289.718] (-289.865) (-291.121) (-288.871) * (-294.141) (-293.701) (-296.759) [-289.911] -- 0:01:09
28500 -- [-289.445] (-289.850) (-289.363) (-289.399) * (-293.051) (-293.049) [-292.104] (-289.223) -- 0:01:08
29000 -- (-291.906) [-291.637] (-290.357) (-292.022) * [-291.698] (-294.265) (-289.135) (-291.927) -- 0:01:06
29500 -- (-291.956) (-289.280) (-289.629) [-290.048] * (-290.336) (-290.036) [-292.068] (-288.970) -- 0:01:05
30000 -- (-290.618) (-289.624) [-292.228] (-289.810) * (-291.190) (-290.331) (-290.932) [-291.268] -- 0:01:04
Average standard deviation of split frequencies: 0.037216
30500 -- (-289.352) [-289.186] (-290.851) (-289.726) * (-290.199) (-294.620) (-290.506) [-289.955] -- 0:01:03
31000 -- (-289.743) (-290.223) (-293.511) [-290.080] * (-290.648) [-290.919] (-291.126) (-292.108) -- 0:01:02
31500 -- (-290.501) (-290.868) [-293.474] (-289.663) * (-290.014) (-290.634) [-289.646] (-289.365) -- 0:01:01
32000 -- (-292.456) (-290.001) (-290.365) [-289.714] * [-289.702] (-294.255) (-290.950) (-289.564) -- 0:01:00
32500 -- (-293.152) [-288.774] (-290.966) (-291.430) * (-293.454) [-290.851] (-292.572) (-290.195) -- 0:00:59
33000 -- (-290.717) (-290.103) [-290.546] (-292.599) * (-289.277) [-289.503] (-294.007) (-290.389) -- 0:00:58
33500 -- [-290.156] (-292.497) (-293.114) (-291.658) * (-289.140) (-293.019) [-290.159] (-294.839) -- 0:00:57
34000 -- (-292.022) (-290.385) [-290.086] (-291.211) * [-292.584] (-289.851) (-291.939) (-291.324) -- 0:00:56
34500 -- (-290.166) [-291.581] (-290.970) (-290.581) * (-290.910) (-290.966) (-291.025) [-290.693] -- 0:00:55
35000 -- (-291.592) [-289.731] (-291.348) (-292.418) * (-291.141) [-289.690] (-292.147) (-291.459) -- 0:00:55
Average standard deviation of split frequencies: 0.031427
35500 -- (-293.133) (-289.185) [-293.130] (-289.986) * (-290.041) [-289.368] (-293.337) (-289.528) -- 0:00:54
36000 -- (-290.787) [-290.323] (-290.422) (-290.071) * (-289.759) (-291.836) (-290.553) [-289.538] -- 0:00:53
36500 -- (-290.488) [-291.739] (-290.386) (-289.643) * (-291.338) (-290.106) [-289.910] (-291.896) -- 0:00:52
37000 -- (-291.946) (-290.157) (-292.696) [-290.511] * [-291.198] (-291.143) (-289.148) (-290.194) -- 0:00:52
37500 -- (-290.880) (-294.704) (-289.958) [-293.478] * (-290.616) [-290.431] (-289.238) (-294.809) -- 0:00:51
38000 -- (-289.655) (-291.110) (-290.713) [-291.413] * (-291.291) [-292.434] (-292.796) (-289.232) -- 0:00:50
38500 -- (-291.944) [-293.562] (-293.139) (-289.969) * (-290.202) [-291.345] (-291.994) (-290.791) -- 0:00:49
39000 -- [-290.740] (-292.228) (-290.312) (-289.812) * (-290.696) (-294.049) (-291.183) [-290.434] -- 0:00:49
39500 -- (-290.590) (-292.523) (-294.261) [-288.790] * (-289.025) [-289.418] (-288.907) (-296.621) -- 0:00:48
40000 -- (-291.201) [-293.552] (-291.777) (-289.345) * (-288.945) [-291.534] (-290.563) (-296.211) -- 0:00:48
Average standard deviation of split frequencies: 0.028336
40500 -- (-290.411) (-293.487) [-289.805] (-291.452) * (-290.605) [-291.382] (-291.235) (-292.820) -- 0:00:47
41000 -- (-289.079) [-293.106] (-288.958) (-290.155) * (-296.118) (-291.410) (-293.912) [-292.587] -- 0:00:46
41500 -- (-289.845) (-290.217) [-290.146] (-289.271) * [-289.724] (-293.987) (-294.584) (-293.501) -- 0:00:46
42000 -- (-289.726) (-289.286) [-289.618] (-291.396) * (-291.255) (-290.098) (-290.744) [-292.478] -- 0:01:08
42500 -- (-290.659) (-289.227) [-289.824] (-292.205) * [-290.577] (-289.692) (-290.358) (-289.743) -- 0:01:07
43000 -- (-290.789) (-289.546) [-290.439] (-298.775) * [-290.201] (-291.119) (-291.386) (-289.945) -- 0:01:06
43500 -- (-295.193) (-290.597) [-290.254] (-295.406) * (-291.218) [-290.953] (-289.952) (-291.112) -- 0:01:05
44000 -- (-290.988) (-290.838) [-289.033] (-296.223) * (-297.292) (-291.366) (-289.477) [-291.872] -- 0:01:05
44500 -- (-293.766) (-290.542) (-292.359) [-295.128] * [-292.372] (-291.594) (-290.398) (-291.852) -- 0:01:04
45000 -- (-292.816) (-294.839) [-289.663] (-292.518) * [-291.114] (-290.345) (-291.079) (-293.503) -- 0:01:03
Average standard deviation of split frequencies: 0.027669
45500 -- (-291.400) (-290.626) (-290.901) [-292.564] * (-292.651) [-290.176] (-292.255) (-290.677) -- 0:01:02
46000 -- (-295.481) (-291.252) (-291.985) [-289.427] * [-292.653] (-294.875) (-291.988) (-289.420) -- 0:01:02
46500 -- (-295.784) (-289.525) (-291.664) [-291.903] * (-293.609) (-299.823) [-290.989] (-294.459) -- 0:01:01
47000 -- (-289.420) (-293.913) [-291.229] (-290.229) * [-289.834] (-297.327) (-292.151) (-290.893) -- 0:01:00
47500 -- (-289.841) (-292.133) [-289.590] (-295.030) * (-296.116) (-293.527) (-289.546) [-290.242] -- 0:01:00
48000 -- (-291.067) (-290.126) (-291.495) [-291.754] * [-291.694] (-292.933) (-290.477) (-290.115) -- 0:00:59
48500 -- (-290.947) (-292.638) (-289.852) [-298.307] * (-290.773) (-290.465) [-290.926] (-294.495) -- 0:00:58
49000 -- [-292.870] (-292.623) (-293.298) (-292.063) * [-290.979] (-292.218) (-289.578) (-293.839) -- 0:00:58
49500 -- (-290.505) (-290.322) (-291.721) [-290.163] * (-290.877) (-291.147) (-291.046) [-290.193] -- 0:00:57
50000 -- (-290.463) [-290.870] (-296.099) (-289.822) * [-290.770] (-293.849) (-295.294) (-294.771) -- 0:00:57
Average standard deviation of split frequencies: 0.029773
50500 -- (-290.434) [-293.508] (-291.076) (-293.168) * (-291.445) (-293.375) (-294.356) [-289.944] -- 0:00:56
51000 -- (-289.701) (-291.142) [-290.360] (-291.219) * (-293.238) [-290.881] (-291.191) (-289.758) -- 0:00:55
51500 -- [-289.828] (-292.700) (-293.904) (-289.801) * (-292.417) (-290.410) [-291.645] (-295.681) -- 0:00:55
52000 -- [-289.582] (-292.236) (-292.193) (-290.113) * (-292.621) (-289.674) (-294.368) [-294.219] -- 0:00:54
52500 -- (-290.934) (-291.909) (-292.083) [-290.579] * [-290.297] (-293.733) (-295.155) (-292.369) -- 0:00:54
53000 -- (-296.036) (-290.230) [-290.323] (-294.870) * (-289.601) (-293.676) (-300.109) [-289.126] -- 0:00:53
53500 -- (-290.734) [-293.350] (-291.950) (-289.639) * (-289.845) (-292.981) [-290.039] (-291.316) -- 0:00:53
54000 -- (-289.042) [-289.566] (-292.141) (-289.643) * (-289.409) [-289.436] (-289.477) (-290.331) -- 0:00:52
54500 -- (-290.758) (-290.659) (-289.613) [-292.717] * (-289.481) (-288.920) [-291.206] (-295.554) -- 0:00:52
55000 -- [-289.731] (-292.886) (-289.884) (-289.049) * (-289.432) (-289.206) (-289.274) [-291.943] -- 0:00:51
Average standard deviation of split frequencies: 0.025254
55500 -- [-290.641] (-292.561) (-291.949) (-289.294) * (-290.380) [-292.272] (-292.761) (-291.505) -- 0:00:51
56000 -- (-289.626) (-290.641) [-290.148] (-289.929) * (-290.222) (-293.829) (-291.554) [-294.052] -- 0:00:50
56500 -- [-291.483] (-291.040) (-293.152) (-291.571) * (-290.504) [-289.531] (-296.335) (-290.042) -- 0:00:50
57000 -- (-289.838) [-290.308] (-291.807) (-290.253) * (-291.066) (-290.191) (-289.693) [-290.660] -- 0:00:49
57500 -- (-289.358) (-291.658) [-289.839] (-291.336) * (-289.676) [-289.589] (-292.366) (-290.797) -- 0:00:49
58000 -- (-290.346) [-291.070] (-289.244) (-291.911) * [-290.909] (-293.602) (-291.263) (-293.593) -- 0:00:48
58500 -- (-299.113) (-289.234) (-297.697) [-295.293] * (-292.696) (-290.080) [-291.259] (-293.236) -- 0:01:04
59000 -- (-290.802) (-296.458) [-289.430] (-290.716) * [-291.431] (-294.094) (-293.083) (-292.571) -- 0:01:03
59500 -- (-291.320) (-291.435) (-292.574) [-291.175] * (-290.715) (-291.799) (-290.367) [-290.241] -- 0:01:03
60000 -- (-289.722) (-290.335) (-291.395) [-289.822] * (-290.633) (-290.280) [-290.452] (-292.367) -- 0:01:02
Average standard deviation of split frequencies: 0.026333
60500 -- (-291.958) (-289.763) [-289.735] (-291.362) * [-290.914] (-292.595) (-292.790) (-290.581) -- 0:01:02
61000 -- [-291.837] (-291.634) (-289.309) (-292.761) * (-295.056) (-293.281) (-293.334) [-289.828] -- 0:01:01
61500 -- [-293.183] (-292.225) (-292.241) (-292.371) * (-292.878) (-289.421) (-294.055) [-290.234] -- 0:01:01
62000 -- (-290.282) (-291.258) [-290.610] (-289.872) * (-289.448) (-289.207) (-289.704) [-292.563] -- 0:01:00
62500 -- (-291.386) (-289.534) (-290.977) [-289.787] * [-292.652] (-290.446) (-289.954) (-293.662) -- 0:01:00
63000 -- (-290.405) [-289.725] (-292.466) (-291.017) * (-292.253) [-294.851] (-288.743) (-293.738) -- 0:00:59
63500 -- [-292.494] (-289.730) (-289.997) (-291.979) * (-292.629) (-289.373) (-292.058) [-292.340] -- 0:00:58
64000 -- [-290.099] (-289.261) (-291.753) (-289.026) * (-291.115) (-291.207) (-289.788) [-290.706] -- 0:00:58
64500 -- (-289.141) (-293.176) (-291.023) [-290.893] * (-291.247) (-289.334) (-292.185) [-291.059] -- 0:00:58
65000 -- [-291.172] (-291.651) (-289.362) (-289.059) * [-289.843] (-289.536) (-295.308) (-291.879) -- 0:00:57
Average standard deviation of split frequencies: 0.024148
65500 -- [-289.753] (-290.094) (-288.935) (-290.017) * [-292.018] (-293.872) (-295.941) (-294.132) -- 0:00:57
66000 -- (-289.776) (-289.873) [-289.467] (-290.975) * (-291.742) [-289.103] (-292.345) (-289.582) -- 0:00:56
66500 -- [-289.461] (-290.990) (-293.547) (-291.226) * (-292.453) (-289.363) (-291.991) [-290.917] -- 0:00:56
67000 -- [-290.415] (-290.260) (-295.582) (-292.974) * [-290.658] (-290.019) (-293.219) (-292.366) -- 0:00:55
67500 -- (-294.944) [-290.626] (-293.415) (-295.434) * (-289.711) (-292.845) (-291.580) [-292.295] -- 0:00:55
68000 -- (-291.119) (-288.942) (-291.096) [-288.947] * (-289.288) [-290.605] (-293.197) (-294.792) -- 0:00:54
68500 -- (-291.878) (-291.215) [-289.103] (-291.497) * [-289.655] (-289.410) (-290.293) (-289.149) -- 0:00:54
69000 -- (-290.237) (-290.693) [-290.804] (-293.263) * [-292.013] (-300.606) (-291.139) (-291.288) -- 0:00:53
69500 -- (-291.966) (-294.120) [-292.088] (-290.104) * (-295.728) (-296.398) [-289.316] (-291.604) -- 0:00:53
70000 -- (-289.764) [-292.070] (-291.179) (-291.853) * (-289.436) [-292.148] (-290.459) (-289.276) -- 0:00:53
Average standard deviation of split frequencies: 0.022741
70500 -- [-290.088] (-288.878) (-289.708) (-291.416) * (-294.129) (-294.798) (-290.913) [-295.257] -- 0:00:52
71000 -- (-290.097) (-291.154) (-294.458) [-290.127] * [-296.233] (-289.492) (-289.733) (-292.944) -- 0:00:52
71500 -- (-290.132) (-291.828) [-289.966] (-293.372) * (-293.481) (-289.914) (-291.581) [-291.933] -- 0:00:51
72000 -- (-290.157) [-291.502] (-289.996) (-289.624) * (-289.421) (-291.639) (-294.073) [-291.235] -- 0:00:51
72500 -- (-291.028) (-291.005) [-289.696] (-289.978) * (-293.190) (-290.386) [-292.824] (-292.392) -- 0:00:51
73000 -- (-292.510) (-291.674) [-291.071] (-290.883) * (-290.806) [-289.531] (-294.694) (-290.327) -- 0:00:50
73500 -- (-289.527) (-291.087) [-290.319] (-289.995) * [-292.112] (-291.574) (-291.589) (-290.900) -- 0:00:50
74000 -- (-290.529) (-291.182) [-289.420] (-290.126) * (-292.581) [-291.313] (-290.258) (-290.026) -- 0:00:50
74500 -- (-289.158) [-293.577] (-290.313) (-291.469) * (-292.688) [-292.802] (-291.756) (-299.262) -- 0:00:49
75000 -- (-290.674) (-294.101) (-290.783) [-289.825] * (-293.833) [-291.099] (-293.311) (-297.596) -- 0:01:01
Average standard deviation of split frequencies: 0.025790
75500 -- (-290.487) [-294.195] (-289.965) (-292.406) * (-293.545) [-290.047] (-290.360) (-291.574) -- 0:01:01
76000 -- (-291.026) (-289.892) (-289.729) [-291.885] * (-295.385) [-290.227] (-290.740) (-290.862) -- 0:01:00
76500 -- [-290.396] (-290.030) (-296.720) (-292.064) * (-291.772) (-290.211) [-295.283] (-291.234) -- 0:01:00
77000 -- [-289.444] (-290.537) (-300.528) (-289.325) * (-291.572) (-292.407) [-290.970] (-288.820) -- 0:00:59
77500 -- (-291.252) (-293.395) (-292.667) [-290.280] * (-291.608) [-289.965] (-289.756) (-289.659) -- 0:00:59
78000 -- (-294.027) (-290.006) [-295.173] (-291.682) * (-290.929) [-289.656] (-291.934) (-291.339) -- 0:00:59
78500 -- (-292.533) (-289.243) (-290.251) [-290.831] * (-291.444) [-289.821] (-291.280) (-290.834) -- 0:00:58
79000 -- (-292.526) [-290.943] (-293.537) (-291.983) * (-289.926) (-289.050) [-289.360] (-288.869) -- 0:00:58
79500 -- (-291.409) (-289.557) (-292.092) [-290.928] * [-290.172] (-291.504) (-291.074) (-291.651) -- 0:00:57
80000 -- (-294.330) (-293.408) (-292.415) [-292.258] * (-295.455) [-290.859] (-292.913) (-292.969) -- 0:00:57
Average standard deviation of split frequencies: 0.027271
80500 -- [-292.172] (-294.046) (-290.886) (-291.106) * (-299.112) [-291.500] (-291.691) (-291.272) -- 0:00:57
81000 -- (-289.973) [-297.155] (-292.928) (-289.761) * (-294.179) [-289.481] (-291.524) (-291.999) -- 0:00:56
81500 -- (-289.449) (-295.105) (-291.248) [-288.980] * (-294.067) [-289.626] (-291.484) (-292.005) -- 0:00:56
82000 -- (-291.205) (-289.879) (-296.201) [-289.453] * (-292.294) [-291.054] (-293.781) (-290.812) -- 0:00:55
82500 -- [-291.422] (-292.446) (-293.221) (-288.953) * (-290.669) (-292.639) [-291.492] (-290.306) -- 0:00:55
83000 -- [-290.197] (-292.271) (-291.812) (-290.345) * [-290.742] (-292.581) (-295.414) (-291.167) -- 0:00:55
83500 -- [-290.063] (-292.651) (-290.443) (-290.528) * (-290.820) (-292.594) [-293.473] (-291.039) -- 0:00:54
84000 -- (-292.601) [-292.265] (-292.093) (-289.618) * (-291.473) [-289.524] (-293.001) (-290.374) -- 0:00:54
84500 -- (-291.836) [-290.757] (-291.589) (-291.165) * (-291.312) (-292.370) (-290.776) [-289.312] -- 0:00:54
85000 -- (-289.393) [-288.969] (-291.347) (-291.377) * (-289.352) [-289.624] (-294.493) (-290.367) -- 0:00:53
Average standard deviation of split frequencies: 0.027407
85500 -- [-290.214] (-291.019) (-291.291) (-290.075) * (-290.514) (-290.943) [-290.022] (-291.762) -- 0:00:53
86000 -- [-289.687] (-297.479) (-290.061) (-291.634) * (-292.327) (-293.436) (-291.500) [-291.382] -- 0:00:53
86500 -- (-290.705) (-290.691) [-290.252] (-289.709) * [-291.350] (-291.388) (-289.892) (-289.776) -- 0:00:52
87000 -- (-293.992) [-290.260] (-290.591) (-290.220) * (-289.990) [-292.178] (-295.661) (-290.505) -- 0:00:52
87500 -- (-291.731) (-290.349) (-292.165) [-290.967] * [-288.845] (-290.705) (-292.913) (-290.515) -- 0:00:52
88000 -- [-290.258] (-290.316) (-293.106) (-293.124) * (-289.679) [-290.349] (-289.831) (-291.161) -- 0:00:51
88500 -- [-290.342] (-290.628) (-293.105) (-289.580) * [-289.423] (-290.140) (-290.563) (-289.276) -- 0:00:51
89000 -- (-290.467) (-292.752) (-290.656) [-289.552] * (-292.924) (-289.565) [-291.050] (-289.445) -- 0:00:51
89500 -- (-291.842) (-292.928) [-292.644] (-291.284) * (-289.622) (-295.332) (-290.744) [-289.881] -- 0:00:50
90000 -- (-289.281) [-289.960] (-290.392) (-289.438) * (-292.592) (-291.590) [-291.183] (-289.265) -- 0:00:50
Average standard deviation of split frequencies: 0.027441
90500 -- [-291.605] (-289.735) (-291.320) (-290.539) * (-288.820) [-289.750] (-290.134) (-290.546) -- 0:00:50
91000 -- (-292.677) (-289.535) [-290.383] (-288.864) * (-290.311) [-289.511] (-295.201) (-291.674) -- 0:00:49
91500 -- (-295.777) [-289.817] (-289.197) (-291.973) * (-289.515) (-290.231) [-293.201] (-289.171) -- 0:00:49
92000 -- [-294.101] (-292.094) (-289.245) (-295.805) * (-294.097) (-291.892) (-295.975) [-289.948] -- 0:00:59
92500 -- (-290.875) (-290.096) [-289.326] (-292.527) * [-289.534] (-292.055) (-298.204) (-291.201) -- 0:00:58
93000 -- [-289.322] (-291.210) (-290.366) (-292.158) * (-291.066) [-291.507] (-295.322) (-289.556) -- 0:00:58
93500 -- (-289.422) (-293.690) [-290.297] (-291.151) * (-292.459) (-291.278) [-291.282] (-292.132) -- 0:00:58
94000 -- (-292.290) (-290.656) [-289.912] (-291.106) * [-290.076] (-293.911) (-296.235) (-294.269) -- 0:00:57
94500 -- (-291.060) [-293.814] (-292.143) (-294.284) * [-289.628] (-290.179) (-292.454) (-288.898) -- 0:00:57
95000 -- (-291.859) (-291.741) (-289.874) [-291.081] * (-289.964) (-290.430) (-292.765) [-291.077] -- 0:00:57
Average standard deviation of split frequencies: 0.027826
95500 -- [-291.134] (-290.329) (-290.266) (-292.398) * (-291.630) [-289.649] (-289.156) (-291.202) -- 0:00:56
96000 -- [-290.299] (-292.081) (-291.564) (-292.418) * (-291.364) [-290.980] (-291.914) (-290.556) -- 0:00:56
96500 -- (-295.060) (-291.868) [-291.947] (-293.449) * [-289.567] (-291.205) (-294.825) (-289.285) -- 0:00:56
97000 -- (-288.847) (-291.171) [-290.543] (-289.906) * (-289.570) (-289.382) [-292.132] (-292.333) -- 0:00:55
97500 -- (-289.669) (-290.043) (-290.749) [-289.858] * [-290.084] (-292.243) (-290.850) (-289.638) -- 0:00:55
98000 -- (-289.736) (-291.492) (-290.823) [-289.394] * (-294.286) (-293.534) [-294.322] (-291.182) -- 0:00:55
98500 -- (-291.225) (-294.062) (-290.952) [-291.659] * (-293.309) (-291.067) [-291.400] (-291.073) -- 0:00:54
99000 -- [-290.293] (-292.853) (-291.145) (-291.267) * (-291.446) [-289.579] (-290.386) (-293.574) -- 0:00:54
99500 -- (-289.630) (-292.706) [-290.152] (-290.159) * (-291.729) (-292.141) (-294.857) [-294.612] -- 0:00:54
100000 -- [-290.432] (-290.360) (-291.346) (-289.005) * (-289.982) (-291.399) [-293.537] (-291.626) -- 0:00:54
Average standard deviation of split frequencies: 0.024646
100500 -- [-290.186] (-293.560) (-291.574) (-294.098) * [-289.626] (-291.182) (-294.588) (-292.755) -- 0:00:53
101000 -- (-290.313) (-290.149) (-292.308) [-290.077] * [-291.623] (-291.640) (-294.965) (-290.934) -- 0:00:53
101500 -- [-293.253] (-289.071) (-296.486) (-290.328) * (-290.016) (-293.273) [-289.738] (-291.781) -- 0:00:53
102000 -- [-289.831] (-290.647) (-294.633) (-290.317) * (-293.746) (-295.049) (-290.510) [-289.214] -- 0:00:52
102500 -- (-290.854) [-292.181] (-297.146) (-289.956) * [-290.832] (-291.197) (-292.105) (-290.326) -- 0:00:52
103000 -- [-290.505] (-293.599) (-293.114) (-289.947) * (-292.721) (-292.198) [-289.400] (-290.046) -- 0:00:52
103500 -- [-290.905] (-289.748) (-290.889) (-289.289) * (-290.805) [-291.201] (-290.034) (-291.721) -- 0:00:51
104000 -- [-291.984] (-289.972) (-291.229) (-289.685) * (-289.595) (-294.635) (-291.105) [-291.900] -- 0:00:51
104500 -- [-290.914] (-290.467) (-290.655) (-289.302) * (-291.417) [-290.625] (-289.872) (-293.865) -- 0:00:51
105000 -- [-291.306] (-291.767) (-291.745) (-290.283) * [-289.575] (-291.367) (-292.157) (-290.123) -- 0:00:51
Average standard deviation of split frequencies: 0.023172
105500 -- [-294.379] (-290.902) (-290.051) (-294.479) * [-290.784] (-293.674) (-289.103) (-289.380) -- 0:00:50
106000 -- (-290.709) (-290.295) (-289.956) [-290.751] * [-289.195] (-292.084) (-290.858) (-289.454) -- 0:00:50
106500 -- [-290.580] (-292.961) (-289.993) (-296.612) * (-291.212) (-292.744) (-289.433) [-289.949] -- 0:00:50
107000 -- [-292.817] (-291.748) (-290.583) (-290.041) * (-290.070) [-290.004] (-289.322) (-290.066) -- 0:00:50
107500 -- (-292.577) (-290.424) [-291.039] (-291.310) * (-290.694) (-292.033) (-290.553) [-291.745] -- 0:00:49
108000 -- (-290.328) [-291.271] (-292.102) (-290.088) * [-289.964] (-291.367) (-293.196) (-290.799) -- 0:00:49
108500 -- (-290.477) (-297.438) (-290.937) [-290.300] * (-292.571) (-290.565) (-292.446) [-290.239] -- 0:00:49
109000 -- [-293.506] (-296.063) (-289.325) (-292.052) * (-289.239) (-290.636) (-289.852) [-291.032] -- 0:00:57
109500 -- (-289.826) (-293.313) [-289.648] (-291.143) * (-289.909) (-292.075) [-291.264] (-292.293) -- 0:00:56
110000 -- (-290.438) [-291.868] (-291.297) (-295.291) * (-290.348) [-289.175] (-291.637) (-300.882) -- 0:00:56
Average standard deviation of split frequencies: 0.024280
110500 -- (-291.345) [-295.645] (-290.032) (-294.324) * (-291.919) [-290.146] (-291.601) (-296.897) -- 0:00:56
111000 -- [-291.581] (-294.091) (-292.648) (-291.944) * (-293.736) (-292.154) (-291.310) [-291.095] -- 0:00:56
111500 -- [-289.216] (-295.552) (-290.658) (-291.275) * (-291.201) (-291.206) [-289.189] (-292.023) -- 0:00:55
112000 -- [-291.872] (-291.760) (-290.250) (-289.423) * (-290.199) (-294.082) [-289.862] (-289.715) -- 0:00:55
112500 -- (-292.634) (-290.151) [-289.542] (-290.287) * [-290.607] (-293.702) (-290.746) (-295.448) -- 0:00:55
113000 -- (-289.198) (-291.338) (-290.140) [-293.066] * (-289.315) [-294.003] (-296.837) (-290.359) -- 0:00:54
113500 -- [-290.223] (-291.928) (-291.560) (-291.346) * (-291.903) (-291.472) [-292.515] (-293.318) -- 0:00:54
114000 -- (-290.533) [-291.336] (-289.759) (-291.220) * (-290.520) (-289.677) [-290.560] (-291.791) -- 0:00:54
114500 -- (-291.084) (-290.756) [-289.716] (-294.587) * (-293.900) (-290.622) [-289.873] (-295.023) -- 0:00:54
115000 -- (-291.286) (-290.870) (-290.782) [-294.041] * (-291.863) (-292.931) [-289.881] (-292.913) -- 0:00:53
Average standard deviation of split frequencies: 0.023415
115500 -- (-290.638) [-291.987] (-294.064) (-292.587) * (-289.753) [-293.382] (-293.853) (-293.772) -- 0:00:53
116000 -- (-289.885) [-291.922] (-289.205) (-292.960) * (-289.300) [-290.463] (-293.806) (-292.874) -- 0:00:53
116500 -- (-292.422) (-290.693) (-295.935) [-290.252] * (-292.889) (-289.438) [-296.221] (-294.266) -- 0:00:53
117000 -- (-292.573) (-290.745) (-290.906) [-290.426] * (-290.188) (-289.840) (-297.157) [-291.415] -- 0:00:52
117500 -- [-290.419] (-289.710) (-294.025) (-292.520) * (-291.629) (-289.287) (-292.774) [-291.304] -- 0:00:52
118000 -- (-291.897) (-292.304) [-290.058] (-291.190) * [-291.042] (-290.585) (-289.801) (-292.005) -- 0:00:52
118500 -- (-290.457) [-292.664] (-291.330) (-289.923) * (-289.959) (-290.350) (-289.516) [-295.387] -- 0:00:52
119000 -- (-290.358) [-290.569] (-290.629) (-295.063) * (-295.016) (-289.357) [-291.347] (-290.699) -- 0:00:51
119500 -- (-290.962) (-293.731) [-295.869] (-292.898) * [-291.483] (-290.836) (-293.941) (-290.823) -- 0:00:51
120000 -- (-297.423) (-294.514) [-291.471] (-291.231) * (-290.629) (-290.326) [-290.309] (-290.192) -- 0:00:51
Average standard deviation of split frequencies: 0.025393
120500 -- (-290.489) (-296.524) [-291.065] (-293.354) * (-290.396) (-290.534) [-291.534] (-295.333) -- 0:00:51
121000 -- (-290.077) (-295.307) [-291.902] (-292.194) * (-291.665) (-289.857) (-291.452) [-290.053] -- 0:00:50
121500 -- (-290.009) [-296.210] (-288.839) (-290.620) * (-290.411) (-291.882) (-290.818) [-289.936] -- 0:00:50
122000 -- (-290.394) (-290.360) [-291.472] (-292.532) * (-290.717) (-293.445) (-289.541) [-291.951] -- 0:00:50
122500 -- (-290.612) (-291.062) (-289.658) [-289.783] * (-292.395) (-292.465) (-290.742) [-291.573] -- 0:00:50
123000 -- (-291.962) [-291.990] (-290.122) (-291.900) * (-292.407) (-291.209) (-290.120) [-290.812] -- 0:00:49
123500 -- (-290.866) (-294.945) [-292.797] (-288.975) * (-292.282) (-291.658) (-293.758) [-291.025] -- 0:00:49
124000 -- (-293.164) [-289.135] (-292.362) (-291.163) * (-290.115) (-292.928) (-290.962) [-291.628] -- 0:00:49
124500 -- (-289.375) (-291.391) [-291.070] (-290.844) * (-292.777) [-291.380] (-290.790) (-290.367) -- 0:00:49
125000 -- (-291.053) (-295.275) [-289.378] (-290.695) * (-292.934) [-298.021] (-293.491) (-290.258) -- 0:00:49
Average standard deviation of split frequencies: 0.020873
125500 -- (-291.254) [-290.400] (-288.801) (-290.877) * (-295.419) (-292.634) (-292.454) [-289.307] -- 0:00:48
126000 -- (-290.688) [-290.206] (-291.196) (-293.913) * [-292.025] (-293.016) (-291.831) (-292.135) -- 0:00:48
126500 -- (-292.584) (-290.351) (-289.160) [-291.797] * (-292.401) (-290.386) [-289.793] (-290.970) -- 0:00:55
127000 -- (-290.368) (-290.844) (-289.881) [-293.192] * [-294.116] (-295.351) (-290.855) (-291.727) -- 0:00:54
127500 -- (-292.304) (-293.619) (-293.190) [-293.413] * (-290.531) (-289.259) (-290.180) [-289.741] -- 0:00:54
128000 -- (-293.087) [-291.619] (-293.791) (-291.203) * (-290.258) (-292.888) [-290.519] (-296.145) -- 0:00:54
128500 -- [-290.963] (-294.451) (-291.631) (-289.985) * (-291.487) (-291.687) (-290.741) [-295.951] -- 0:00:54
129000 -- (-289.305) [-289.459] (-292.264) (-289.827) * [-293.290] (-295.805) (-290.892) (-296.216) -- 0:00:54
129500 -- (-292.439) (-289.749) (-291.173) [-290.804] * [-293.517] (-294.483) (-289.735) (-295.260) -- 0:00:53
130000 -- (-292.708) (-294.413) [-289.681] (-290.099) * (-289.934) [-293.523] (-291.360) (-290.661) -- 0:00:53
Average standard deviation of split frequencies: 0.022047
130500 -- (-294.093) [-294.160] (-289.772) (-292.910) * (-293.102) [-292.093] (-293.081) (-291.168) -- 0:00:53
131000 -- (-297.024) (-290.506) (-293.402) [-291.152] * (-290.429) (-290.273) (-291.448) [-291.967] -- 0:00:53
131500 -- (-295.892) [-292.071] (-291.064) (-291.534) * [-292.551] (-291.873) (-294.903) (-292.549) -- 0:00:52
132000 -- (-293.046) (-290.752) (-292.416) [-291.090] * (-292.295) (-289.641) (-291.406) [-289.936] -- 0:00:52
132500 -- (-294.568) (-291.927) (-295.994) [-289.259] * (-290.204) [-289.643] (-293.778) (-292.153) -- 0:00:52
133000 -- (-298.673) (-290.285) [-290.197] (-291.171) * (-291.731) (-291.329) [-292.401] (-291.440) -- 0:00:52
133500 -- [-296.828] (-291.340) (-289.275) (-295.273) * (-292.439) (-291.530) (-292.226) [-289.386] -- 0:00:51
134000 -- [-291.880] (-291.357) (-293.690) (-289.205) * (-291.884) (-291.402) (-292.951) [-291.730] -- 0:00:51
134500 -- [-292.307] (-295.220) (-294.150) (-293.766) * [-289.440] (-294.041) (-293.047) (-292.253) -- 0:00:51
135000 -- (-289.601) (-292.960) (-292.343) [-290.046] * (-289.769) [-294.305] (-294.157) (-290.666) -- 0:00:51
Average standard deviation of split frequencies: 0.023614
135500 -- [-289.446] (-289.935) (-292.992) (-290.957) * [-293.252] (-289.795) (-289.455) (-289.527) -- 0:00:51
136000 -- (-291.572) (-293.819) (-289.989) [-291.368] * [-289.837] (-291.149) (-289.275) (-294.953) -- 0:00:50
136500 -- (-292.789) [-290.622] (-293.143) (-291.867) * (-289.179) [-289.823] (-292.127) (-289.912) -- 0:00:50
137000 -- (-291.204) (-294.368) (-294.058) [-289.694] * (-290.763) [-289.451] (-293.672) (-290.230) -- 0:00:50
137500 -- (-290.520) [-290.035] (-296.361) (-289.882) * (-292.707) (-292.268) [-290.845] (-291.362) -- 0:00:50
138000 -- (-290.775) (-291.760) (-296.114) [-289.977] * [-289.340] (-293.138) (-290.408) (-292.981) -- 0:00:49
138500 -- (-291.279) (-296.701) (-291.918) [-289.845] * (-293.096) (-293.672) [-290.057] (-289.405) -- 0:00:49
139000 -- (-289.333) (-290.395) [-290.986] (-289.401) * (-295.522) (-297.718) (-289.518) [-293.068] -- 0:00:49
139500 -- (-292.209) [-297.543] (-290.182) (-290.385) * (-291.291) (-291.831) (-291.297) [-290.736] -- 0:00:49
140000 -- (-290.826) (-289.746) (-290.652) [-288.826] * [-289.742] (-291.682) (-291.643) (-292.872) -- 0:00:49
Average standard deviation of split frequencies: 0.023668
140500 -- (-293.572) [-291.757] (-293.688) (-291.348) * (-289.435) (-290.894) (-289.782) [-290.692] -- 0:00:48
141000 -- (-292.234) [-291.169] (-289.498) (-290.978) * (-290.822) (-289.954) [-289.175] (-290.530) -- 0:00:48
141500 -- [-292.508] (-293.743) (-289.074) (-289.476) * (-290.296) (-291.823) [-295.487] (-291.598) -- 0:00:48
142000 -- (-294.008) (-288.986) (-291.048) [-290.786] * (-293.427) (-290.025) (-295.790) [-290.501] -- 0:00:48
142500 -- [-291.977] (-290.749) (-291.410) (-294.321) * (-289.382) (-292.882) [-292.832] (-292.356) -- 0:00:48
143000 -- (-290.851) (-290.482) [-291.878] (-292.263) * (-291.607) [-290.555] (-290.107) (-289.217) -- 0:00:47
143500 -- [-289.087] (-290.528) (-289.971) (-290.215) * (-288.895) (-291.289) (-290.848) [-289.901] -- 0:00:53
144000 -- (-290.925) [-293.338] (-290.724) (-292.405) * (-290.157) (-290.112) (-292.379) [-290.030] -- 0:00:53
144500 -- [-291.036] (-290.919) (-293.349) (-289.585) * (-291.359) (-292.798) (-290.330) [-290.093] -- 0:00:53
145000 -- [-290.751] (-292.394) (-289.951) (-290.120) * (-294.360) [-290.467] (-291.194) (-290.258) -- 0:00:53
Average standard deviation of split frequencies: 0.022222
145500 -- (-290.103) (-291.967) (-291.068) [-292.324] * (-292.558) (-289.602) (-293.573) [-290.618] -- 0:00:52
146000 -- (-290.041) (-291.532) [-289.895] (-291.709) * (-295.052) (-291.082) (-290.427) [-290.333] -- 0:00:52
146500 -- [-289.532] (-291.692) (-292.546) (-291.109) * (-292.146) (-289.927) (-293.141) [-290.747] -- 0:00:52
147000 -- [-289.232] (-290.784) (-288.957) (-294.947) * [-291.713] (-289.383) (-289.937) (-290.909) -- 0:00:52
147500 -- [-288.998] (-290.616) (-294.249) (-293.721) * (-293.360) (-290.471) [-290.678] (-290.315) -- 0:00:52
148000 -- (-291.666) (-291.269) (-293.361) [-292.886] * (-291.158) (-289.833) (-290.562) [-289.885] -- 0:00:51
148500 -- [-291.213] (-289.730) (-295.794) (-290.542) * (-290.802) [-289.829] (-291.544) (-291.748) -- 0:00:51
149000 -- (-294.098) [-290.952] (-288.841) (-290.859) * [-290.352] (-293.300) (-294.760) (-290.387) -- 0:00:51
149500 -- (-290.356) (-293.999) (-290.159) [-291.489] * [-290.693] (-291.080) (-291.316) (-291.921) -- 0:00:51
150000 -- (-291.683) [-290.672] (-292.581) (-292.130) * (-295.545) [-290.345] (-289.443) (-296.192) -- 0:00:51
Average standard deviation of split frequencies: 0.020728
150500 -- (-295.466) [-291.932] (-290.512) (-292.714) * [-290.308] (-290.050) (-294.904) (-292.652) -- 0:00:50
151000 -- (-293.435) (-291.192) [-289.352] (-292.761) * (-290.799) (-294.004) [-292.157] (-290.234) -- 0:00:50
151500 -- [-289.727] (-292.796) (-289.880) (-298.063) * (-289.116) (-294.494) (-291.402) [-290.723] -- 0:00:50
152000 -- (-289.730) (-293.455) [-291.788] (-293.607) * (-290.403) (-289.925) [-289.889] (-295.501) -- 0:00:50
152500 -- (-291.743) (-299.021) (-289.797) [-291.508] * (-290.579) (-290.857) [-290.332] (-295.750) -- 0:00:50
153000 -- (-290.652) [-294.150] (-289.183) (-289.694) * (-293.527) [-291.206] (-290.547) (-292.816) -- 0:00:49
153500 -- [-290.462] (-289.958) (-293.227) (-294.960) * (-289.719) [-291.954] (-290.490) (-289.748) -- 0:00:49
154000 -- (-291.370) (-291.199) (-293.764) [-290.057] * (-292.751) (-291.014) [-292.422] (-291.715) -- 0:00:49
154500 -- (-295.220) (-292.090) (-293.246) [-292.672] * (-290.452) (-291.168) (-295.473) [-293.554] -- 0:00:49
155000 -- (-292.159) (-290.135) [-293.805] (-294.610) * (-291.930) (-291.146) (-299.413) [-289.018] -- 0:00:49
Average standard deviation of split frequencies: 0.019642
155500 -- (-289.698) (-290.141) (-293.356) [-293.905] * (-292.165) (-289.717) (-293.225) [-289.886] -- 0:00:48
156000 -- (-290.748) [-294.603] (-293.875) (-290.904) * (-290.346) [-290.449] (-291.410) (-292.448) -- 0:00:48
156500 -- (-291.239) (-289.385) (-293.181) [-290.484] * (-290.634) (-290.656) [-293.569] (-291.767) -- 0:00:48
157000 -- (-291.404) (-290.814) (-289.577) [-289.053] * (-290.384) (-291.261) [-294.114] (-294.204) -- 0:00:48
157500 -- (-294.838) (-290.599) [-290.434] (-289.361) * (-292.339) (-289.586) (-291.756) [-294.457] -- 0:00:48
158000 -- (-291.806) [-292.269] (-289.946) (-291.738) * [-289.144] (-290.943) (-291.197) (-290.223) -- 0:00:47
158500 -- (-290.548) (-290.373) [-290.277] (-290.451) * (-293.476) (-290.089) [-290.547] (-292.911) -- 0:00:47
159000 -- (-291.047) (-291.737) (-294.109) [-290.766] * (-292.768) (-289.872) (-289.989) [-290.618] -- 0:00:47
159500 -- [-290.739] (-291.798) (-291.071) (-291.817) * (-291.692) (-290.236) (-297.349) [-290.592] -- 0:00:47
160000 -- [-289.405] (-291.059) (-290.495) (-289.558) * (-291.494) [-289.767] (-293.164) (-298.738) -- 0:00:47
Average standard deviation of split frequencies: 0.022189
160500 -- [-289.187] (-291.417) (-289.444) (-291.910) * (-292.201) (-291.710) [-292.934] (-293.616) -- 0:00:52
161000 -- (-294.958) (-292.590) (-292.711) [-289.306] * (-291.094) [-290.283] (-292.913) (-290.241) -- 0:00:52
161500 -- (-291.405) (-289.986) [-289.248] (-293.040) * [-289.626] (-292.366) (-291.954) (-292.266) -- 0:00:51
162000 -- (-290.612) (-291.302) [-291.417] (-291.535) * (-293.114) [-291.197] (-289.623) (-291.840) -- 0:00:51
162500 -- [-291.447] (-293.455) (-289.646) (-290.368) * (-292.112) (-289.749) (-290.303) [-291.115] -- 0:00:51
163000 -- (-295.043) [-290.040] (-289.156) (-292.328) * [-290.443] (-291.167) (-289.289) (-289.122) -- 0:00:51
163500 -- (-290.725) (-290.116) [-291.044] (-293.176) * [-293.697] (-294.042) (-293.124) (-297.041) -- 0:00:51
164000 -- (-294.921) (-291.661) (-294.807) [-290.862] * [-291.743] (-289.154) (-293.964) (-289.803) -- 0:00:50
164500 -- [-290.069] (-291.747) (-289.297) (-291.540) * (-292.102) (-291.882) [-293.368] (-290.546) -- 0:00:50
165000 -- [-290.310] (-290.710) (-291.557) (-292.102) * [-291.974] (-289.358) (-290.127) (-292.415) -- 0:00:50
Average standard deviation of split frequencies: 0.019524
165500 -- (-291.409) (-292.427) [-294.386] (-294.509) * (-290.543) (-289.812) [-291.671] (-294.591) -- 0:00:50
166000 -- (-290.986) [-294.680] (-290.794) (-295.708) * (-289.471) [-289.155] (-292.757) (-294.679) -- 0:00:50
166500 -- (-292.945) (-293.063) (-291.473) [-290.299] * (-291.771) [-291.098] (-291.943) (-291.508) -- 0:00:50
167000 -- [-291.359] (-290.908) (-291.167) (-289.765) * (-291.533) (-292.150) (-289.533) [-289.250] -- 0:00:49
167500 -- (-289.230) (-290.974) (-290.871) [-288.964] * [-291.736] (-294.206) (-289.506) (-289.727) -- 0:00:49
168000 -- (-289.715) (-293.566) (-290.664) [-288.933] * (-298.938) (-291.685) [-291.126] (-291.220) -- 0:00:49
168500 -- (-289.432) (-288.836) [-289.218] (-292.011) * (-298.137) (-289.698) [-290.995] (-291.614) -- 0:00:49
169000 -- (-290.282) [-289.043] (-289.013) (-290.845) * (-292.533) [-290.776] (-289.652) (-291.060) -- 0:00:49
169500 -- (-291.283) (-289.734) [-290.817] (-293.263) * (-291.319) [-289.769] (-292.150) (-289.819) -- 0:00:48
170000 -- (-290.648) (-291.301) (-293.045) [-289.284] * (-289.908) (-289.925) (-289.422) [-291.974] -- 0:00:48
Average standard deviation of split frequencies: 0.020371
170500 -- (-291.675) (-292.983) (-289.647) [-291.535] * (-290.138) (-290.380) [-290.199] (-290.629) -- 0:00:48
171000 -- (-292.717) [-292.521] (-294.033) (-290.867) * [-289.773] (-289.412) (-291.613) (-294.698) -- 0:00:48
171500 -- (-290.076) (-288.789) (-296.985) [-294.158] * (-290.313) (-289.229) (-292.487) [-292.325] -- 0:00:48
172000 -- [-291.141] (-291.426) (-292.192) (-290.797) * (-291.215) (-296.209) [-291.056] (-290.024) -- 0:00:48
172500 -- [-293.950] (-289.000) (-291.312) (-291.606) * (-292.522) [-290.429] (-290.244) (-289.251) -- 0:00:47
173000 -- (-295.667) (-291.924) [-290.555] (-291.687) * (-293.084) [-290.560] (-289.838) (-290.155) -- 0:00:47
173500 -- (-291.563) [-289.369] (-289.807) (-289.134) * [-290.324] (-290.168) (-290.179) (-290.125) -- 0:00:47
174000 -- [-292.568] (-293.171) (-292.464) (-290.899) * (-292.239) (-289.116) (-291.140) [-290.517] -- 0:00:47
174500 -- (-289.290) [-291.795] (-290.898) (-289.448) * (-289.213) (-293.391) (-292.700) [-291.684] -- 0:00:47
175000 -- (-291.052) [-291.163] (-292.563) (-289.340) * (-289.750) (-290.029) [-291.612] (-290.335) -- 0:00:47
Average standard deviation of split frequencies: 0.018591
175500 -- (-289.426) [-291.803] (-296.245) (-290.388) * [-290.690] (-291.027) (-290.051) (-290.203) -- 0:00:46
176000 -- (-297.998) [-291.543] (-289.779) (-294.230) * [-291.458] (-291.933) (-291.835) (-292.958) -- 0:00:46
176500 -- (-298.117) (-290.625) [-290.329] (-291.785) * [-290.201] (-292.976) (-290.928) (-291.615) -- 0:00:46
177000 -- (-294.803) (-292.426) [-291.995] (-289.812) * (-289.827) (-294.218) (-296.564) [-291.222] -- 0:00:46
177500 -- (-292.625) (-297.088) [-289.814] (-291.521) * (-289.800) (-291.346) [-295.297] (-293.584) -- 0:00:50
178000 -- (-289.482) (-293.328) (-290.149) [-291.403] * (-290.607) [-292.426] (-289.858) (-290.621) -- 0:00:50
178500 -- (-289.565) (-291.638) (-291.878) [-291.891] * (-289.208) (-292.470) [-291.787] (-294.638) -- 0:00:50
179000 -- [-289.383] (-289.295) (-291.708) (-290.790) * (-291.691) (-289.802) (-290.032) [-290.113] -- 0:00:50
179500 -- [-290.918] (-291.120) (-295.840) (-291.731) * (-289.562) (-292.507) (-290.140) [-290.512] -- 0:00:50
180000 -- [-292.722] (-290.410) (-293.217) (-292.013) * (-290.826) [-289.125] (-294.559) (-291.061) -- 0:00:50
Average standard deviation of split frequencies: 0.018754
180500 -- [-292.530] (-294.317) (-297.773) (-294.859) * (-289.553) (-294.862) [-289.269] (-291.450) -- 0:00:49
181000 -- (-289.627) (-294.584) [-290.401] (-292.224) * (-290.794) (-290.737) (-291.653) [-291.713] -- 0:00:49
181500 -- [-293.660] (-293.195) (-289.561) (-292.102) * (-290.217) [-290.987] (-288.977) (-290.516) -- 0:00:49
182000 -- (-293.310) (-289.789) [-289.393] (-289.016) * (-291.035) (-289.432) [-289.748] (-298.869) -- 0:00:49
182500 -- (-290.134) (-292.121) (-289.982) [-290.250] * [-296.240] (-290.580) (-289.825) (-291.822) -- 0:00:49
183000 -- (-290.263) [-292.859] (-295.287) (-290.219) * (-292.344) (-291.344) [-291.298] (-292.950) -- 0:00:49
183500 -- [-289.602] (-292.454) (-294.766) (-289.715) * (-293.758) (-290.645) [-292.873] (-289.989) -- 0:00:48
184000 -- (-295.459) [-289.653] (-291.357) (-290.905) * (-290.771) (-290.505) (-292.618) [-291.364] -- 0:00:48
184500 -- (-293.791) [-291.839] (-291.723) (-290.005) * (-290.169) (-289.791) (-290.593) [-289.024] -- 0:00:48
185000 -- [-291.651] (-291.057) (-291.615) (-293.011) * (-289.783) (-291.957) [-292.250] (-297.497) -- 0:00:48
Average standard deviation of split frequencies: 0.017890
185500 -- (-290.452) [-291.531] (-291.543) (-289.937) * (-293.193) (-295.691) [-290.165] (-291.657) -- 0:00:48
186000 -- (-289.352) (-291.370) [-292.045] (-289.703) * [-292.373] (-294.297) (-288.939) (-290.251) -- 0:00:48
186500 -- [-292.310] (-291.510) (-291.290) (-291.033) * (-292.346) (-290.575) [-289.511] (-293.530) -- 0:00:47
187000 -- (-291.779) [-291.386] (-297.475) (-290.933) * (-290.089) [-289.906] (-290.022) (-292.876) -- 0:00:47
187500 -- (-292.884) (-289.672) [-291.754] (-293.334) * (-291.804) [-292.037] (-290.402) (-290.859) -- 0:00:47
188000 -- [-290.884] (-291.052) (-300.209) (-290.883) * [-289.644] (-291.503) (-291.860) (-289.972) -- 0:00:47
188500 -- (-289.402) (-288.983) (-297.854) [-289.986] * (-292.338) (-290.804) (-291.935) [-290.051] -- 0:00:47
189000 -- (-290.155) (-289.999) (-290.315) [-288.998] * (-294.700) (-290.757) [-290.056] (-291.702) -- 0:00:47
189500 -- (-291.491) (-296.696) [-291.036] (-292.057) * (-294.952) (-291.525) [-289.946] (-289.316) -- 0:00:47
190000 -- [-291.558] (-291.279) (-290.913) (-290.429) * (-293.127) (-290.990) (-290.108) [-289.650] -- 0:00:46
Average standard deviation of split frequencies: 0.017016
190500 -- (-292.435) (-289.829) [-292.740] (-290.078) * [-290.670] (-290.071) (-294.537) (-292.224) -- 0:00:46
191000 -- (-291.155) (-291.905) [-290.005] (-291.211) * (-289.914) [-289.707] (-291.025) (-291.582) -- 0:00:46
191500 -- (-289.831) (-291.904) [-290.790] (-294.677) * (-289.994) (-291.143) [-290.852] (-291.385) -- 0:00:46
192000 -- (-290.518) [-291.019] (-294.232) (-293.261) * (-291.905) [-292.091] (-294.510) (-292.342) -- 0:00:46
192500 -- (-292.062) (-290.252) (-291.738) [-290.767] * (-290.034) (-290.598) [-294.356] (-295.522) -- 0:00:46
193000 -- (-290.784) (-290.387) [-290.334] (-297.138) * (-289.520) (-293.603) [-290.407] (-294.975) -- 0:00:45
193500 -- (-292.444) [-289.054] (-292.065) (-290.009) * (-291.024) (-293.117) (-290.994) [-291.734] -- 0:00:45
194000 -- (-292.836) (-290.162) [-289.426] (-290.781) * (-291.043) [-291.339] (-290.461) (-290.802) -- 0:00:45
194500 -- (-291.263) (-290.724) [-290.504] (-290.924) * [-289.567] (-288.960) (-289.660) (-292.670) -- 0:00:45
195000 -- (-292.070) (-289.387) [-289.390] (-290.819) * (-289.836) (-290.081) [-291.840] (-290.851) -- 0:00:49
Average standard deviation of split frequencies: 0.015987
195500 -- (-293.683) [-289.463] (-289.568) (-292.276) * [-291.255] (-291.364) (-292.169) (-292.184) -- 0:00:49
196000 -- (-295.050) (-289.751) (-292.032) [-291.944] * (-290.643) (-289.632) (-292.045) [-291.855] -- 0:00:49
196500 -- (-292.417) (-291.433) [-295.472] (-289.264) * (-290.161) [-293.334] (-289.146) (-292.282) -- 0:00:49
197000 -- (-290.653) (-292.665) [-292.164] (-297.684) * (-289.485) (-289.778) [-289.246] (-291.236) -- 0:00:48
197500 -- [-289.819] (-291.782) (-289.913) (-293.384) * (-295.738) (-292.468) (-290.792) [-293.029] -- 0:00:48
198000 -- (-290.205) (-291.162) [-289.580] (-292.010) * (-289.818) (-290.396) [-292.345] (-297.502) -- 0:00:48
198500 -- [-291.452] (-292.029) (-290.482) (-294.772) * [-291.240] (-294.027) (-291.070) (-291.260) -- 0:00:48
199000 -- (-292.600) (-290.194) (-291.996) [-291.200] * (-290.778) (-292.125) (-292.410) [-293.518] -- 0:00:48
199500 -- (-290.612) [-289.189] (-291.981) (-289.592) * (-292.441) (-289.638) (-289.872) [-292.301] -- 0:00:48
200000 -- (-290.070) (-289.466) [-290.661] (-289.429) * (-291.179) [-289.713] (-291.107) (-290.060) -- 0:00:48
Average standard deviation of split frequencies: 0.019087
200500 -- [-289.889] (-291.380) (-290.470) (-290.484) * (-294.823) [-289.730] (-290.497) (-291.243) -- 0:00:47
201000 -- (-289.383) [-292.357] (-289.168) (-293.313) * (-290.391) (-289.832) [-294.303] (-291.643) -- 0:00:47
201500 -- (-291.047) (-291.082) (-290.406) [-293.586] * (-293.620) (-292.896) [-290.466] (-289.198) -- 0:00:47
202000 -- (-291.427) (-291.535) [-291.228] (-290.691) * (-293.965) [-289.947] (-289.082) (-290.805) -- 0:00:47
202500 -- [-290.530] (-291.030) (-289.764) (-289.705) * (-290.520) [-298.112] (-292.019) (-290.884) -- 0:00:47
203000 -- [-289.765] (-291.645) (-291.936) (-290.708) * (-290.429) [-290.877] (-290.700) (-290.140) -- 0:00:47
203500 -- (-290.172) (-291.487) [-292.101] (-290.511) * (-292.749) (-292.322) (-291.563) [-290.041] -- 0:00:46
204000 -- (-293.780) (-288.814) [-290.546] (-293.135) * [-291.955] (-290.979) (-291.994) (-290.184) -- 0:00:46
204500 -- [-291.008] (-291.597) (-296.841) (-292.739) * (-294.019) (-294.995) (-291.527) [-292.344] -- 0:00:46
205000 -- (-290.258) (-289.483) [-294.779] (-289.389) * (-294.006) (-292.737) [-292.332] (-292.583) -- 0:00:46
Average standard deviation of split frequencies: 0.017903
205500 -- (-290.416) (-289.948) (-291.671) [-289.321] * (-289.856) [-288.834] (-291.576) (-295.305) -- 0:00:46
206000 -- (-289.079) (-290.501) (-291.475) [-290.292] * (-289.816) [-289.968] (-292.564) (-290.040) -- 0:00:46
206500 -- [-291.012] (-290.966) (-291.101) (-290.863) * (-291.986) (-290.321) [-290.887] (-291.026) -- 0:00:46
207000 -- (-290.979) (-289.528) [-293.584] (-289.770) * (-295.395) (-294.315) [-290.526] (-290.264) -- 0:00:45
207500 -- [-290.385] (-289.334) (-288.899) (-289.156) * (-294.419) (-290.700) (-291.052) [-290.062] -- 0:00:45
208000 -- (-290.971) (-293.892) [-290.943] (-290.399) * (-296.196) [-292.483] (-289.897) (-291.305) -- 0:00:45
208500 -- [-290.905] (-292.599) (-292.144) (-290.411) * (-295.562) [-293.476] (-289.408) (-290.189) -- 0:00:45
209000 -- (-288.782) (-296.135) (-290.801) [-289.657] * [-289.241] (-293.511) (-290.795) (-292.619) -- 0:00:45
209500 -- (-289.924) (-291.810) (-289.821) [-290.294] * (-294.692) [-291.507] (-290.358) (-291.797) -- 0:00:45
210000 -- (-289.197) [-289.493] (-291.630) (-296.092) * (-289.751) [-291.463] (-290.341) (-289.300) -- 0:00:45
Average standard deviation of split frequencies: 0.018954
210500 -- (-291.265) (-289.336) [-289.832] (-291.332) * [-290.542] (-289.892) (-290.916) (-291.941) -- 0:00:45
211000 -- (-293.021) (-293.130) [-291.278] (-297.143) * [-293.494] (-291.202) (-289.837) (-296.411) -- 0:00:44
211500 -- (-292.353) [-290.494] (-294.342) (-291.792) * (-289.691) (-289.567) (-296.135) [-292.655] -- 0:00:44
212000 -- (-295.759) (-291.022) (-290.336) [-292.971] * (-289.710) [-292.182] (-292.421) (-291.500) -- 0:00:48
212500 -- (-290.692) [-289.272] (-292.391) (-293.517) * [-290.773] (-289.315) (-294.761) (-291.533) -- 0:00:48
213000 -- (-290.985) (-293.486) [-289.259] (-291.669) * (-289.563) [-289.340] (-292.198) (-290.675) -- 0:00:48
213500 -- [-289.876] (-294.389) (-290.783) (-292.030) * (-300.185) (-298.391) [-290.301] (-290.565) -- 0:00:47
214000 -- (-290.129) [-289.440] (-293.547) (-290.746) * (-290.403) (-290.805) (-290.535) [-290.312] -- 0:00:47
214500 -- (-290.453) (-290.399) (-289.887) [-290.559] * (-290.825) (-293.491) [-289.462] (-290.299) -- 0:00:47
215000 -- (-291.836) (-290.419) (-291.297) [-291.120] * (-292.440) (-290.247) [-292.716] (-294.136) -- 0:00:47
Average standard deviation of split frequencies: 0.020027
215500 -- (-292.671) (-291.723) [-289.534] (-289.282) * [-290.011] (-291.553) (-292.725) (-295.937) -- 0:00:47
216000 -- (-290.404) [-291.531] (-290.478) (-292.355) * [-290.919] (-290.064) (-291.482) (-293.946) -- 0:00:47
216500 -- (-292.653) (-292.963) (-293.557) [-291.130] * [-290.100] (-289.276) (-289.397) (-292.876) -- 0:00:47
217000 -- (-292.104) [-293.334] (-290.441) (-292.578) * [-293.449] (-289.545) (-294.205) (-294.965) -- 0:00:46
217500 -- (-303.327) (-289.806) (-290.742) [-292.686] * (-291.162) [-289.085] (-292.273) (-292.497) -- 0:00:46
218000 -- (-293.606) [-289.702] (-290.324) (-299.596) * (-291.139) (-291.676) [-289.787] (-297.118) -- 0:00:46
218500 -- (-290.733) [-291.578] (-289.121) (-292.061) * (-290.477) (-290.082) [-291.311] (-290.358) -- 0:00:46
219000 -- [-294.032] (-289.553) (-290.983) (-289.741) * (-293.481) (-291.598) [-290.853] (-289.745) -- 0:00:46
219500 -- (-291.806) (-293.350) (-293.183) [-289.250] * (-294.302) [-290.728] (-294.282) (-290.471) -- 0:00:46
220000 -- (-292.482) (-292.781) (-295.717) [-290.134] * (-291.315) (-290.285) [-290.772] (-289.947) -- 0:00:46
Average standard deviation of split frequencies: 0.020986
220500 -- (-289.574) (-292.850) (-290.532) [-290.947] * (-293.970) (-291.417) [-290.823] (-290.544) -- 0:00:45
221000 -- (-290.717) [-290.856] (-289.869) (-289.305) * (-294.691) (-297.605) [-290.626] (-292.319) -- 0:00:45
221500 -- [-292.913] (-289.945) (-290.938) (-290.717) * (-295.767) (-291.497) (-291.194) [-290.589] -- 0:00:45
222000 -- (-292.752) (-292.246) [-292.708] (-290.265) * (-289.446) [-291.526] (-290.856) (-291.348) -- 0:00:45
222500 -- [-291.100] (-291.422) (-290.583) (-290.377) * [-291.184] (-291.318) (-291.416) (-291.020) -- 0:00:45
223000 -- [-295.958] (-292.409) (-290.479) (-295.806) * [-290.086] (-290.188) (-292.576) (-291.408) -- 0:00:45
223500 -- (-294.435) [-291.094] (-290.421) (-293.337) * (-291.340) (-291.264) (-290.026) [-290.622] -- 0:00:45
224000 -- (-292.745) (-292.799) [-289.789] (-290.446) * (-291.432) (-292.786) (-291.706) [-292.304] -- 0:00:45
224500 -- (-290.274) (-289.235) (-291.500) [-290.148] * (-292.874) [-289.210] (-291.944) (-293.716) -- 0:00:44
225000 -- (-289.982) [-290.908] (-297.322) (-291.822) * [-290.334] (-289.765) (-294.098) (-293.113) -- 0:00:44
Average standard deviation of split frequencies: 0.019754
225500 -- (-292.378) (-291.156) (-290.364) [-291.302] * (-292.284) (-293.514) [-295.572] (-290.233) -- 0:00:44
226000 -- (-295.178) [-292.076] (-289.792) (-291.073) * (-292.141) (-292.984) [-293.087] (-291.141) -- 0:00:44
226500 -- (-292.245) (-292.771) (-290.764) [-291.791] * [-291.011] (-290.704) (-292.698) (-288.822) -- 0:00:44
227000 -- (-292.533) [-290.998] (-290.507) (-292.634) * (-289.218) [-290.302] (-291.517) (-292.402) -- 0:00:44
227500 -- (-291.852) (-292.096) [-289.965] (-290.400) * (-290.536) [-290.193] (-290.879) (-290.508) -- 0:00:44
228000 -- [-290.880] (-289.811) (-289.486) (-292.393) * (-291.846) (-289.522) (-292.300) [-294.495] -- 0:00:44
228500 -- (-289.497) [-289.981] (-290.737) (-290.705) * (-290.547) (-292.326) (-294.212) [-291.894] -- 0:00:43
229000 -- (-289.203) (-290.283) [-290.253] (-290.523) * [-290.301] (-292.254) (-292.164) (-290.082) -- 0:00:43
229500 -- (-289.927) (-292.740) [-290.458] (-290.130) * (-302.013) (-293.300) (-290.693) [-290.337] -- 0:00:47
230000 -- (-292.289) [-293.851] (-295.677) (-292.094) * (-297.966) (-291.546) (-294.142) [-293.291] -- 0:00:46
Average standard deviation of split frequencies: 0.019715
230500 -- [-290.140] (-290.321) (-291.873) (-288.709) * [-293.154] (-294.270) (-293.038) (-289.857) -- 0:00:46
231000 -- (-289.651) [-290.443] (-291.953) (-293.575) * (-289.353) [-289.368] (-291.712) (-292.772) -- 0:00:46
231500 -- (-292.821) [-289.651] (-293.959) (-293.190) * (-289.319) [-289.670] (-290.911) (-294.717) -- 0:00:46
232000 -- (-291.250) (-289.347) (-289.921) [-290.510] * (-290.049) (-293.851) (-290.652) [-292.662] -- 0:00:46
232500 -- (-291.934) [-291.767] (-294.085) (-292.007) * [-290.153] (-291.219) (-294.269) (-291.304) -- 0:00:46
233000 -- (-291.805) (-292.698) [-292.150] (-292.166) * (-290.855) (-292.526) [-290.715] (-292.452) -- 0:00:46
233500 -- [-291.184] (-292.493) (-292.832) (-291.520) * (-293.150) (-291.078) (-291.296) [-293.148] -- 0:00:45
234000 -- (-290.319) [-292.344] (-295.966) (-291.344) * (-291.680) [-292.151] (-292.504) (-289.445) -- 0:00:45
234500 -- [-290.534] (-293.397) (-294.683) (-291.150) * (-294.248) [-290.440] (-291.510) (-291.981) -- 0:00:45
235000 -- (-292.915) [-298.433] (-294.320) (-291.212) * (-291.074) (-292.303) (-291.941) [-292.051] -- 0:00:45
Average standard deviation of split frequencies: 0.018199
235500 -- [-291.371] (-296.916) (-294.343) (-292.679) * (-290.754) (-292.137) [-291.111] (-290.893) -- 0:00:45
236000 -- [-290.889] (-289.967) (-292.731) (-290.946) * (-291.938) (-294.758) [-290.536] (-292.276) -- 0:00:45
236500 -- [-290.192] (-290.183) (-288.763) (-291.328) * (-290.677) (-288.884) (-290.892) [-291.071] -- 0:00:45
237000 -- (-291.035) (-290.144) [-293.231] (-292.330) * [-289.534] (-293.164) (-289.606) (-292.270) -- 0:00:45
237500 -- (-291.532) [-290.457] (-289.497) (-290.079) * (-294.730) [-293.129] (-291.631) (-292.607) -- 0:00:44
238000 -- [-296.047] (-290.772) (-289.809) (-290.256) * (-292.357) (-289.246) (-291.040) [-290.749] -- 0:00:44
238500 -- (-290.764) (-289.504) (-291.352) [-291.669] * [-290.318] (-293.296) (-291.872) (-289.813) -- 0:00:44
239000 -- (-292.796) [-292.800] (-290.364) (-290.147) * (-290.021) (-295.887) [-291.007] (-289.458) -- 0:00:44
239500 -- (-290.833) (-292.906) [-291.381] (-292.505) * (-290.710) (-296.019) (-292.563) [-289.990] -- 0:00:44
240000 -- (-291.202) [-290.002] (-291.313) (-292.745) * [-289.734] (-291.391) (-292.041) (-291.029) -- 0:00:44
Average standard deviation of split frequencies: 0.018435
240500 -- (-292.045) [-291.561] (-296.128) (-289.061) * (-300.295) (-289.021) [-292.587] (-289.139) -- 0:00:44
241000 -- (-291.979) (-292.868) [-293.614] (-295.940) * (-294.729) (-289.020) (-291.266) [-291.148] -- 0:00:44
241500 -- (-290.600) [-293.359] (-291.326) (-290.324) * (-289.621) [-290.123] (-289.641) (-290.908) -- 0:00:43
242000 -- [-291.656] (-291.912) (-294.043) (-289.594) * (-295.827) (-293.939) [-291.804] (-290.947) -- 0:00:43
242500 -- (-291.584) [-292.590] (-292.207) (-290.024) * (-291.998) [-291.004] (-292.323) (-291.320) -- 0:00:43
243000 -- (-290.555) (-290.483) [-290.094] (-291.371) * (-291.883) (-290.265) [-297.194] (-289.649) -- 0:00:43
243500 -- (-292.055) (-294.052) (-290.984) [-292.307] * (-290.567) [-289.777] (-293.904) (-290.605) -- 0:00:43
244000 -- [-292.441] (-291.032) (-292.825) (-292.083) * (-296.713) (-297.060) (-294.020) [-291.007] -- 0:00:43
244500 -- (-290.497) (-295.418) (-290.661) [-291.408] * (-295.849) (-289.718) (-293.300) [-290.368] -- 0:00:43
245000 -- [-288.851] (-292.910) (-291.452) (-295.618) * [-294.623] (-293.885) (-295.728) (-289.371) -- 0:00:43
Average standard deviation of split frequencies: 0.015117
245500 -- [-290.647] (-291.433) (-289.922) (-292.414) * (-290.565) [-294.542] (-290.497) (-289.782) -- 0:00:43
246000 -- (-292.605) (-292.409) (-289.063) [-295.094] * (-290.226) (-293.811) (-289.929) [-291.925] -- 0:00:42
246500 -- [-292.660] (-291.263) (-289.368) (-290.884) * [-292.431] (-293.197) (-289.316) (-290.238) -- 0:00:45
247000 -- (-291.036) (-292.616) (-293.473) [-292.753] * (-293.537) [-289.744] (-291.616) (-290.034) -- 0:00:45
247500 -- (-290.066) [-294.399] (-292.886) (-291.381) * (-289.890) (-289.556) (-295.770) [-289.848] -- 0:00:45
248000 -- [-291.010] (-293.560) (-292.695) (-291.930) * (-295.094) [-290.061] (-293.790) (-291.626) -- 0:00:45
248500 -- (-293.783) (-292.429) [-292.795] (-291.277) * (-290.299) (-292.620) (-294.675) [-290.319] -- 0:00:45
249000 -- (-289.486) [-291.490] (-290.600) (-290.344) * (-292.031) (-293.344) (-294.038) [-289.227] -- 0:00:45
249500 -- (-290.590) (-291.601) [-292.355] (-289.999) * (-291.940) [-290.491] (-296.723) (-290.504) -- 0:00:45
250000 -- (-297.323) [-290.863] (-292.866) (-290.264) * [-292.481] (-288.931) (-291.871) (-292.226) -- 0:00:45
Average standard deviation of split frequencies: 0.015243
250500 -- [-293.693] (-291.645) (-289.592) (-291.732) * (-291.455) [-291.698] (-292.550) (-292.759) -- 0:00:44
251000 -- (-290.330) (-289.780) [-290.704] (-290.545) * (-291.497) (-291.449) [-290.627] (-293.145) -- 0:00:44
251500 -- (-289.621) [-289.368] (-292.881) (-293.682) * (-292.742) [-289.859] (-294.635) (-300.510) -- 0:00:44
252000 -- (-289.657) [-294.269] (-292.398) (-295.231) * (-291.803) (-289.802) [-293.543] (-291.780) -- 0:00:44
252500 -- (-290.778) (-292.301) [-289.250] (-293.209) * [-290.579] (-290.150) (-292.289) (-299.733) -- 0:00:44
253000 -- (-290.069) (-289.544) (-289.607) [-290.480] * (-291.786) (-290.225) [-290.778] (-291.605) -- 0:00:44
253500 -- (-289.738) [-292.133] (-290.369) (-292.916) * (-291.144) (-293.125) [-293.107] (-289.273) -- 0:00:44
254000 -- [-292.577] (-290.703) (-293.255) (-292.127) * (-289.718) (-295.238) [-289.146] (-291.674) -- 0:00:44
254500 -- (-292.080) (-290.262) [-292.251] (-295.971) * (-290.654) (-292.844) (-289.068) [-292.117] -- 0:00:43
255000 -- [-289.973] (-290.657) (-289.866) (-294.907) * (-294.353) (-290.023) [-292.515] (-291.291) -- 0:00:43
Average standard deviation of split frequencies: 0.015038
255500 -- [-289.825] (-293.782) (-290.537) (-292.634) * (-300.067) (-292.658) [-289.794] (-290.844) -- 0:00:43
256000 -- (-290.237) (-290.013) (-292.776) [-289.451] * (-293.608) (-293.130) (-289.528) [-293.065] -- 0:00:43
256500 -- (-294.145) [-290.528] (-291.200) (-290.290) * [-294.603] (-297.045) (-290.187) (-289.269) -- 0:00:43
257000 -- (-290.517) (-290.556) (-289.920) [-289.745] * (-290.540) (-290.407) [-294.290] (-289.871) -- 0:00:43
257500 -- [-290.983] (-289.577) (-292.311) (-292.869) * (-290.465) (-289.460) [-291.801] (-290.377) -- 0:00:43
258000 -- (-289.727) [-291.161] (-290.453) (-291.119) * (-289.930) (-289.238) (-291.058) [-292.602] -- 0:00:43
258500 -- (-291.923) [-292.657] (-290.971) (-290.607) * [-291.739] (-290.586) (-293.027) (-294.479) -- 0:00:43
259000 -- (-291.652) [-291.925] (-293.284) (-293.686) * (-290.473) (-290.510) (-290.605) [-293.771] -- 0:00:42
259500 -- (-292.745) (-291.357) (-292.490) [-291.840] * [-290.470] (-291.911) (-289.662) (-294.398) -- 0:00:42
260000 -- [-290.853] (-289.909) (-290.584) (-291.923) * [-291.454] (-295.112) (-291.998) (-291.767) -- 0:00:42
Average standard deviation of split frequencies: 0.014680
260500 -- (-292.259) (-292.237) (-289.582) [-293.931] * [-289.605] (-292.259) (-289.306) (-291.868) -- 0:00:42
261000 -- (-289.521) (-289.947) (-292.995) [-290.165] * (-291.152) [-292.684] (-289.403) (-291.289) -- 0:00:42
261500 -- (-290.088) (-296.576) (-290.351) [-291.237] * (-290.416) (-293.019) [-292.161] (-290.610) -- 0:00:42
262000 -- (-292.583) (-290.671) (-290.827) [-291.215] * [-290.189] (-297.119) (-292.383) (-292.434) -- 0:00:42
262500 -- (-292.004) (-291.186) [-291.231] (-290.180) * (-289.918) [-290.569] (-293.425) (-291.869) -- 0:00:42
263000 -- (-290.953) (-292.005) (-290.806) [-289.264] * [-289.320] (-292.539) (-290.250) (-289.873) -- 0:00:42
263500 -- (-292.348) (-290.528) [-289.735] (-289.373) * (-293.440) (-291.165) [-289.953] (-291.385) -- 0:00:41
264000 -- [-290.895] (-289.317) (-290.923) (-293.133) * [-291.716] (-292.345) (-289.389) (-292.208) -- 0:00:44
264500 -- (-292.600) (-290.031) (-292.160) [-291.492] * [-290.997] (-292.123) (-293.627) (-290.555) -- 0:00:44
265000 -- (-293.201) (-292.010) (-295.255) [-291.665] * (-290.177) [-291.784] (-291.603) (-289.038) -- 0:00:44
Average standard deviation of split frequencies: 0.015064
265500 -- (-291.658) [-290.851] (-293.181) (-290.368) * [-292.436] (-290.033) (-290.002) (-289.053) -- 0:00:44
266000 -- [-292.691] (-291.389) (-290.538) (-288.863) * (-293.326) (-292.394) (-291.033) [-291.138] -- 0:00:44
266500 -- (-289.902) [-290.305] (-289.403) (-295.828) * [-292.205] (-290.152) (-290.517) (-292.684) -- 0:00:44
267000 -- (-292.997) [-290.016] (-290.162) (-291.032) * (-291.918) [-290.595] (-289.267) (-291.439) -- 0:00:43
267500 -- [-290.806] (-290.064) (-290.453) (-291.489) * (-292.707) (-292.167) (-289.632) [-294.819] -- 0:00:43
268000 -- (-292.475) [-291.959] (-293.815) (-291.157) * (-290.096) (-293.311) [-290.022] (-290.863) -- 0:00:43
268500 -- [-290.041] (-289.618) (-293.593) (-288.975) * [-290.362] (-292.226) (-290.314) (-291.834) -- 0:00:43
269000 -- (-290.332) [-289.502] (-291.872) (-289.386) * (-291.279) [-290.021] (-292.392) (-294.086) -- 0:00:43
269500 -- (-289.314) [-291.660] (-291.954) (-290.745) * (-293.223) (-289.297) (-291.911) [-290.419] -- 0:00:43
270000 -- (-289.712) (-291.867) [-291.397] (-290.605) * (-290.719) (-289.913) [-292.141] (-292.994) -- 0:00:43
Average standard deviation of split frequencies: 0.015675
270500 -- (-290.172) (-289.705) [-292.761] (-290.517) * (-289.019) (-292.163) (-289.760) [-289.450] -- 0:00:43
271000 -- (-290.362) (-293.152) (-290.538) [-291.907] * (-295.600) (-289.977) (-291.203) [-292.938] -- 0:00:43
271500 -- [-289.735] (-292.485) (-290.117) (-289.071) * [-289.855] (-291.297) (-292.374) (-290.650) -- 0:00:42
272000 -- (-291.816) (-290.968) [-289.887] (-295.494) * [-289.411] (-290.700) (-295.688) (-294.426) -- 0:00:42
272500 -- [-292.847] (-289.820) (-292.605) (-296.119) * (-291.391) (-290.263) [-289.241] (-292.350) -- 0:00:42
273000 -- (-293.464) [-290.435] (-291.375) (-291.022) * [-289.226] (-292.959) (-289.922) (-292.114) -- 0:00:42
273500 -- (-290.059) (-291.873) (-291.621) [-290.755] * [-291.563] (-290.011) (-290.611) (-289.860) -- 0:00:42
274000 -- [-290.676] (-289.989) (-290.543) (-296.457) * (-293.417) [-290.961] (-290.216) (-289.809) -- 0:00:42
274500 -- (-289.718) (-290.354) (-292.733) [-294.474] * (-292.628) (-290.909) [-288.913] (-289.144) -- 0:00:42
275000 -- (-290.404) (-297.326) (-292.313) [-293.960] * (-293.534) (-289.498) [-290.318] (-290.659) -- 0:00:42
Average standard deviation of split frequencies: 0.014233
275500 -- (-292.322) (-293.093) [-292.922] (-293.782) * (-295.194) (-290.582) (-291.581) [-293.625] -- 0:00:42
276000 -- (-290.403) [-291.110] (-291.965) (-296.228) * (-296.051) [-290.389] (-289.111) (-293.450) -- 0:00:41
276500 -- [-289.503] (-290.461) (-289.621) (-290.576) * (-294.896) (-289.460) (-289.960) [-291.763] -- 0:00:41
277000 -- (-289.674) [-293.609] (-290.444) (-289.326) * [-291.448] (-290.527) (-289.812) (-291.668) -- 0:00:41
277500 -- [-291.092] (-290.736) (-290.342) (-290.403) * (-291.545) [-289.661] (-289.009) (-289.809) -- 0:00:41
278000 -- [-289.271] (-289.434) (-292.275) (-295.335) * [-294.505] (-292.066) (-290.956) (-293.511) -- 0:00:41
278500 -- (-289.409) [-289.384] (-292.557) (-293.361) * (-289.940) (-292.947) [-290.988] (-291.991) -- 0:00:41
279000 -- (-289.659) [-289.099] (-298.784) (-291.490) * (-290.001) (-292.358) (-290.018) [-290.942] -- 0:00:41
279500 -- (-289.652) (-290.701) (-297.386) [-291.446] * (-289.792) [-290.948] (-292.628) (-289.695) -- 0:00:41
280000 -- (-295.124) [-294.423] (-293.952) (-290.600) * [-291.050] (-296.745) (-293.444) (-288.997) -- 0:00:41
Average standard deviation of split frequencies: 0.014524
280500 -- (-289.018) [-290.412] (-291.495) (-289.486) * (-289.956) (-291.338) (-289.743) [-289.539] -- 0:00:41
281000 -- (-290.148) [-291.143] (-293.680) (-292.418) * (-290.207) (-295.781) [-289.437] (-292.078) -- 0:00:43
281500 -- (-291.276) [-290.988] (-293.622) (-296.109) * (-293.290) [-290.297] (-291.735) (-293.443) -- 0:00:43
282000 -- [-291.899] (-290.400) (-290.597) (-295.432) * (-293.772) [-289.562] (-292.776) (-293.552) -- 0:00:43
282500 -- [-292.692] (-289.364) (-292.105) (-297.435) * (-291.751) (-292.562) [-290.233] (-289.203) -- 0:00:43
283000 -- (-293.490) (-289.203) [-293.786] (-292.128) * [-291.488] (-292.402) (-292.348) (-293.384) -- 0:00:43
283500 -- (-290.287) [-289.461] (-290.452) (-290.813) * [-289.591] (-290.009) (-292.786) (-288.954) -- 0:00:42
284000 -- (-293.656) [-289.814] (-291.295) (-294.355) * (-291.962) (-291.562) [-289.374] (-291.679) -- 0:00:42
284500 -- (-289.495) [-290.668] (-291.306) (-290.827) * [-291.541] (-289.350) (-289.675) (-292.991) -- 0:00:42
285000 -- (-294.555) (-289.287) [-291.336] (-293.236) * (-289.805) (-289.648) [-291.055] (-293.315) -- 0:00:42
Average standard deviation of split frequencies: 0.014834
285500 -- (-295.948) (-289.763) (-291.958) [-292.286] * (-291.846) [-292.234] (-295.283) (-292.369) -- 0:00:42
286000 -- (-293.764) (-290.770) [-291.526] (-292.779) * (-289.316) (-290.179) (-289.360) [-289.595] -- 0:00:42
286500 -- (-292.143) (-293.130) (-292.073) [-289.469] * (-289.405) (-291.006) (-290.015) [-290.336] -- 0:00:42
287000 -- (-290.365) (-290.293) (-290.315) [-289.135] * (-292.323) (-295.959) [-291.603] (-291.478) -- 0:00:42
287500 -- (-291.020) [-290.174] (-292.651) (-295.353) * (-290.033) (-289.935) [-292.005] (-292.882) -- 0:00:42
288000 -- [-292.373] (-291.929) (-291.139) (-291.593) * (-292.282) (-291.812) [-293.406] (-290.760) -- 0:00:42
288500 -- [-289.668] (-291.751) (-295.468) (-291.171) * [-290.045] (-293.830) (-290.726) (-292.363) -- 0:00:41
289000 -- (-291.392) (-290.477) [-291.301] (-290.698) * [-296.142] (-293.656) (-291.146) (-291.819) -- 0:00:41
289500 -- (-290.618) (-294.592) [-292.124] (-291.696) * (-292.424) [-292.885] (-291.580) (-290.875) -- 0:00:41
290000 -- (-293.747) [-290.615] (-290.749) (-293.274) * (-294.561) (-290.498) [-291.518] (-289.433) -- 0:00:41
Average standard deviation of split frequencies: 0.015455
290500 -- [-291.612] (-291.893) (-291.501) (-290.202) * (-289.207) [-290.771] (-291.670) (-290.510) -- 0:00:41
291000 -- (-290.298) (-292.427) [-291.864] (-293.093) * (-290.258) (-294.966) (-292.167) [-292.112] -- 0:00:41
291500 -- (-290.653) (-291.371) [-291.223] (-292.029) * (-289.859) (-292.552) [-291.646] (-291.252) -- 0:00:41
292000 -- [-290.457] (-292.499) (-294.470) (-293.427) * [-290.335] (-293.411) (-291.259) (-297.426) -- 0:00:41
292500 -- (-294.788) (-289.686) [-289.474] (-293.230) * [-293.116] (-290.908) (-291.511) (-296.397) -- 0:00:41
293000 -- (-292.835) (-291.216) [-288.918] (-290.347) * (-289.982) (-289.855) [-291.016] (-293.658) -- 0:00:41
293500 -- (-296.529) (-289.458) [-290.144] (-291.251) * (-291.898) [-293.377] (-289.305) (-290.644) -- 0:00:40
294000 -- (-290.809) [-292.447] (-294.789) (-289.217) * (-295.390) [-289.748] (-289.833) (-293.883) -- 0:00:40
294500 -- (-291.486) (-289.804) [-292.166] (-292.631) * (-291.620) (-290.841) [-290.722] (-291.002) -- 0:00:40
295000 -- (-289.398) [-291.593] (-294.695) (-290.063) * (-294.023) (-294.455) [-290.326] (-293.162) -- 0:00:40
Average standard deviation of split frequencies: 0.014864
295500 -- (-290.410) [-292.361] (-297.426) (-290.485) * (-295.509) (-290.732) (-294.495) [-291.498] -- 0:00:40
296000 -- [-290.427] (-289.587) (-292.948) (-290.740) * (-291.440) (-293.639) (-290.525) [-290.295] -- 0:00:40
296500 -- (-290.585) [-292.310] (-297.446) (-292.106) * (-298.869) [-290.917] (-292.389) (-293.618) -- 0:00:40
297000 -- (-295.652) (-294.972) [-290.815] (-290.661) * (-290.284) (-290.256) (-290.625) [-289.736] -- 0:00:40
297500 -- (-292.563) (-290.650) (-291.503) [-289.566] * (-290.783) (-296.063) [-290.840] (-289.107) -- 0:00:40
298000 -- (-293.311) (-293.380) (-291.872) [-294.962] * (-290.379) (-291.317) [-292.024] (-290.682) -- 0:00:42
298500 -- (-290.465) [-290.612] (-289.818) (-290.652) * (-294.091) (-289.275) (-291.994) [-291.725] -- 0:00:42
299000 -- (-293.379) (-290.497) (-293.420) [-290.732] * (-292.240) [-291.137] (-289.780) (-292.867) -- 0:00:42
299500 -- [-290.262] (-290.930) (-290.112) (-290.126) * [-292.567] (-293.018) (-291.354) (-291.409) -- 0:00:42
300000 -- (-289.512) (-290.729) (-291.040) [-289.479] * (-289.542) [-294.876] (-292.103) (-292.605) -- 0:00:42
Average standard deviation of split frequencies: 0.014849
300500 -- (-289.451) (-291.566) (-292.390) [-291.096] * (-289.461) [-289.401] (-292.277) (-292.564) -- 0:00:41
301000 -- (-291.411) (-290.047) (-291.448) [-289.973] * (-289.372) [-289.855] (-293.310) (-288.832) -- 0:00:41
301500 -- (-291.304) [-288.864] (-290.722) (-291.278) * (-292.014) [-293.256] (-291.455) (-290.191) -- 0:00:41
302000 -- (-290.414) [-291.065] (-292.622) (-289.077) * [-292.345] (-292.166) (-290.095) (-293.507) -- 0:00:41
302500 -- [-289.748] (-288.701) (-289.514) (-290.288) * (-289.721) (-290.829) [-294.514] (-290.765) -- 0:00:41
303000 -- (-288.818) [-290.096] (-289.685) (-294.555) * [-289.859] (-291.705) (-298.230) (-291.459) -- 0:00:41
303500 -- (-289.071) [-289.793] (-290.714) (-290.824) * (-290.239) (-291.988) (-294.638) [-291.941] -- 0:00:41
304000 -- (-292.649) [-289.806] (-295.665) (-290.652) * [-291.673] (-296.712) (-290.433) (-291.755) -- 0:00:41
304500 -- (-290.638) [-291.920] (-291.999) (-290.137) * [-289.925] (-291.029) (-290.394) (-290.832) -- 0:00:41
305000 -- (-289.881) (-294.729) (-293.214) [-289.659] * [-290.301] (-290.813) (-292.670) (-290.478) -- 0:00:41
Average standard deviation of split frequencies: 0.014590
305500 -- (-292.403) (-289.487) (-292.369) [-289.576] * (-290.384) (-290.925) (-291.853) [-290.340] -- 0:00:40
306000 -- (-290.188) [-294.105] (-292.716) (-291.543) * (-295.618) (-290.141) [-291.906] (-291.545) -- 0:00:40
306500 -- [-289.765] (-289.973) (-291.930) (-291.540) * (-293.906) (-292.208) (-291.722) [-290.139] -- 0:00:40
307000 -- (-289.374) (-294.379) [-292.254] (-290.064) * (-293.728) [-290.355] (-293.073) (-291.387) -- 0:00:40
307500 -- (-291.320) (-292.489) [-289.831] (-296.585) * (-290.429) (-296.001) (-289.145) [-289.755] -- 0:00:40
308000 -- (-290.873) (-289.016) [-291.157] (-292.793) * (-290.494) (-291.230) (-290.349) [-289.527] -- 0:00:40
308500 -- (-290.155) (-290.298) (-291.258) [-290.672] * [-289.804] (-290.251) (-291.738) (-293.211) -- 0:00:40
309000 -- (-291.423) (-291.345) (-290.599) [-292.773] * (-291.197) (-289.770) (-289.833) [-290.952] -- 0:00:40
309500 -- [-291.296] (-289.741) (-290.489) (-290.526) * (-291.209) (-293.157) [-290.345] (-290.695) -- 0:00:40
310000 -- (-295.090) (-290.394) [-290.105] (-292.847) * (-290.764) [-290.243] (-290.111) (-294.990) -- 0:00:40
Average standard deviation of split frequencies: 0.013066
310500 -- (-293.188) [-290.974] (-294.084) (-294.281) * (-294.148) (-293.139) (-290.943) [-291.655] -- 0:00:39
311000 -- (-290.084) (-290.849) [-290.771] (-291.220) * [-293.684] (-290.797) (-291.818) (-290.085) -- 0:00:39
311500 -- [-291.135] (-292.125) (-291.412) (-290.042) * (-291.858) (-292.661) [-292.897] (-290.217) -- 0:00:39
312000 -- (-292.710) [-290.568] (-292.772) (-294.109) * [-291.774] (-294.132) (-293.198) (-289.427) -- 0:00:39
312500 -- (-291.120) (-291.372) [-291.560] (-293.204) * [-291.860] (-291.611) (-293.048) (-290.355) -- 0:00:39
313000 -- (-292.734) [-291.447] (-293.333) (-294.731) * (-289.986) (-291.339) (-290.900) [-292.254] -- 0:00:39
313500 -- (-289.761) (-293.912) [-290.030] (-289.757) * (-290.079) [-292.915] (-292.264) (-291.333) -- 0:00:39
314000 -- [-293.410] (-292.139) (-292.106) (-289.265) * (-290.571) (-291.744) [-289.528] (-290.401) -- 0:00:39
314500 -- (-291.297) [-291.042] (-291.944) (-290.505) * (-290.127) (-291.116) [-290.700] (-292.110) -- 0:00:39
315000 -- (-291.918) (-290.532) (-289.515) [-289.523] * (-291.257) [-290.690] (-292.613) (-294.787) -- 0:00:41
Average standard deviation of split frequencies: 0.012461
315500 -- [-288.935] (-288.953) (-294.031) (-294.068) * [-289.316] (-291.870) (-289.357) (-292.431) -- 0:00:41
316000 -- [-289.123] (-290.600) (-291.486) (-290.109) * [-290.097] (-292.475) (-290.851) (-290.205) -- 0:00:41
316500 -- [-290.538] (-291.007) (-289.945) (-291.016) * [-290.213] (-290.736) (-290.523) (-294.310) -- 0:00:41
317000 -- [-290.996] (-290.628) (-293.814) (-289.596) * [-290.328] (-290.586) (-289.456) (-290.443) -- 0:00:40
317500 -- (-291.191) (-291.462) (-293.015) [-290.201] * (-289.262) (-291.679) [-291.914] (-291.615) -- 0:00:40
318000 -- (-290.178) (-292.615) [-290.467] (-290.610) * (-291.712) (-292.201) [-292.815] (-290.131) -- 0:00:40
318500 -- (-290.918) (-291.231) [-290.758] (-291.541) * [-292.837] (-291.194) (-293.145) (-293.295) -- 0:00:40
319000 -- (-294.383) (-290.552) (-289.383) [-290.659] * (-291.870) (-290.498) (-290.295) [-292.832] -- 0:00:40
319500 -- (-291.180) (-289.065) [-290.429] (-291.975) * (-291.657) [-290.260] (-290.879) (-293.277) -- 0:00:40
320000 -- (-290.552) (-290.656) (-291.623) [-291.280] * (-290.335) (-289.643) [-290.263] (-291.808) -- 0:00:40
Average standard deviation of split frequencies: 0.012193
320500 -- (-290.915) (-289.584) [-292.525] (-292.651) * (-289.310) [-290.037] (-290.398) (-289.486) -- 0:00:40
321000 -- (-290.608) [-291.965] (-292.804) (-292.344) * (-290.593) (-295.339) (-289.522) [-290.005] -- 0:00:40
321500 -- [-292.053] (-294.182) (-290.887) (-290.799) * [-290.172] (-291.232) (-288.828) (-289.436) -- 0:00:40
322000 -- [-289.174] (-291.166) (-290.181) (-291.400) * (-290.810) (-295.056) (-292.391) [-290.568] -- 0:00:40
322500 -- [-289.447] (-291.762) (-289.611) (-296.632) * [-291.759] (-291.182) (-291.521) (-299.083) -- 0:00:39
323000 -- (-291.505) (-293.350) (-288.931) [-291.187] * (-290.882) (-289.998) [-290.402] (-292.001) -- 0:00:39
323500 -- (-293.526) [-290.114] (-293.433) (-293.451) * (-290.523) (-290.455) [-291.035] (-291.465) -- 0:00:39
324000 -- (-289.446) [-290.678] (-291.442) (-292.561) * [-292.398] (-289.860) (-289.770) (-294.311) -- 0:00:39
324500 -- [-292.989] (-290.067) (-291.409) (-290.461) * [-291.945] (-290.451) (-292.471) (-290.244) -- 0:00:39
325000 -- (-293.664) (-291.632) [-290.133] (-289.113) * (-294.305) [-289.682] (-290.737) (-292.528) -- 0:00:39
Average standard deviation of split frequencies: 0.011749
325500 -- (-290.054) [-292.516] (-290.769) (-290.373) * (-290.267) [-289.505] (-291.124) (-292.844) -- 0:00:39
326000 -- (-290.834) (-289.989) (-292.583) [-293.111] * [-292.572] (-289.570) (-291.758) (-291.489) -- 0:00:39
326500 -- (-291.114) (-293.217) [-290.505] (-292.190) * (-291.937) (-289.971) [-292.826] (-291.241) -- 0:00:39
327000 -- [-290.923] (-292.717) (-292.607) (-291.137) * [-293.290] (-293.557) (-291.593) (-289.031) -- 0:00:39
327500 -- (-297.949) [-291.923] (-292.601) (-291.505) * (-292.839) (-292.414) (-295.429) [-290.816] -- 0:00:39
328000 -- (-289.772) [-290.961] (-288.763) (-292.177) * (-294.460) (-291.629) [-292.343] (-292.480) -- 0:00:38
328500 -- (-290.949) (-298.074) [-288.768] (-293.484) * [-291.802] (-291.975) (-292.806) (-291.284) -- 0:00:38
329000 -- [-292.047] (-291.978) (-292.853) (-291.084) * (-290.326) (-295.999) (-291.055) [-290.308] -- 0:00:38
329500 -- [-289.733] (-290.393) (-291.819) (-289.381) * [-292.141] (-291.488) (-291.776) (-291.229) -- 0:00:38
330000 -- (-289.638) (-289.716) (-291.366) [-289.782] * (-292.199) (-290.080) [-291.509] (-290.461) -- 0:00:38
Average standard deviation of split frequencies: 0.010692
330500 -- (-291.983) [-290.454] (-291.058) (-290.115) * (-290.647) (-292.099) (-291.139) [-291.384] -- 0:00:38
331000 -- (-291.570) (-290.883) (-291.224) [-289.421] * [-290.051] (-294.647) (-290.521) (-292.922) -- 0:00:38
331500 -- [-289.181] (-291.453) (-290.992) (-290.496) * (-292.686) [-292.919] (-291.068) (-290.945) -- 0:00:38
332000 -- [-291.213] (-291.047) (-290.898) (-296.758) * (-294.333) (-298.081) (-291.137) [-291.937] -- 0:00:40
332500 -- (-289.293) (-292.882) [-289.547] (-292.405) * [-292.623] (-289.507) (-291.988) (-290.937) -- 0:00:40
333000 -- (-289.322) [-289.710] (-290.629) (-290.514) * (-290.349) (-291.269) (-293.531) [-294.796] -- 0:00:40
333500 -- (-290.692) [-291.135] (-294.054) (-290.142) * (-289.610) (-291.113) [-293.932] (-291.614) -- 0:00:39
334000 -- [-291.001] (-293.789) (-290.948) (-292.588) * (-292.780) (-290.491) [-289.170] (-291.703) -- 0:00:39
334500 -- (-289.352) (-294.807) (-290.619) [-292.885] * [-290.162] (-290.000) (-291.427) (-292.050) -- 0:00:39
335000 -- [-290.235] (-296.056) (-290.869) (-290.340) * [-290.364] (-290.380) (-289.387) (-294.409) -- 0:00:39
Average standard deviation of split frequencies: 0.010259
335500 -- (-291.758) (-295.780) [-290.149] (-290.155) * (-293.228) [-291.040] (-294.111) (-291.602) -- 0:00:39
336000 -- (-291.053) (-290.774) (-289.178) [-293.046] * (-296.562) (-300.027) (-291.538) [-291.547] -- 0:00:39
336500 -- (-290.555) (-291.896) (-289.102) [-289.776] * (-290.006) (-294.563) (-296.594) [-291.272] -- 0:00:39
337000 -- (-291.431) (-291.462) [-289.739] (-290.155) * (-289.441) [-293.257] (-290.852) (-291.737) -- 0:00:39
337500 -- [-289.652] (-292.834) (-292.356) (-290.860) * (-290.020) (-290.276) [-290.293] (-290.223) -- 0:00:39
338000 -- (-291.430) (-292.455) (-290.816) [-289.778] * (-289.471) (-290.509) (-294.962) [-289.430] -- 0:00:39
338500 -- (-290.130) (-289.564) (-290.841) [-291.060] * [-289.168] (-291.512) (-292.652) (-290.971) -- 0:00:39
339000 -- [-289.062] (-292.929) (-289.866) (-292.983) * (-290.322) (-289.777) [-293.452] (-288.746) -- 0:00:38
339500 -- [-290.073] (-293.842) (-291.984) (-291.302) * (-290.862) (-288.779) [-290.417] (-290.871) -- 0:00:38
340000 -- [-290.391] (-290.892) (-294.479) (-292.851) * [-291.090] (-291.065) (-290.131) (-296.703) -- 0:00:38
Average standard deviation of split frequencies: 0.010551
340500 -- (-292.322) (-292.677) (-293.078) [-291.588] * (-289.594) (-291.690) [-289.471] (-291.851) -- 0:00:38
341000 -- (-289.883) (-290.366) (-288.865) [-289.824] * (-290.016) [-290.497] (-289.883) (-292.262) -- 0:00:38
341500 -- (-292.327) (-291.203) (-290.505) [-290.052] * (-292.000) [-293.220] (-290.148) (-293.846) -- 0:00:38
342000 -- (-292.160) (-291.656) [-292.159] (-292.952) * (-292.016) (-293.802) [-293.346] (-291.159) -- 0:00:38
342500 -- (-292.587) (-290.026) [-291.494] (-290.759) * (-298.403) (-291.401) (-290.893) [-290.554] -- 0:00:38
343000 -- (-293.733) (-289.396) [-290.693] (-290.835) * [-290.817] (-292.773) (-292.700) (-292.897) -- 0:00:38
343500 -- [-293.951] (-289.251) (-292.722) (-292.797) * (-290.581) (-292.161) [-292.129] (-294.425) -- 0:00:38
344000 -- [-289.186] (-289.389) (-292.618) (-290.431) * (-289.278) (-290.620) [-295.144] (-292.776) -- 0:00:38
344500 -- [-292.711] (-292.900) (-291.580) (-291.012) * (-293.553) (-293.455) [-290.881] (-291.585) -- 0:00:38
345000 -- (-292.679) (-290.405) [-291.059] (-290.701) * (-293.409) (-293.468) [-296.358] (-293.298) -- 0:00:37
Average standard deviation of split frequencies: 0.010985
345500 -- (-293.118) [-289.323] (-291.285) (-290.295) * (-291.265) (-291.858) (-291.143) [-291.798] -- 0:00:37
346000 -- (-292.689) (-289.779) (-290.603) [-292.204] * (-294.784) [-292.730] (-291.442) (-293.699) -- 0:00:37
346500 -- [-289.855] (-290.442) (-294.333) (-290.992) * [-290.936] (-293.940) (-291.614) (-292.574) -- 0:00:37
347000 -- [-290.128] (-289.876) (-289.838) (-292.301) * [-289.830] (-292.220) (-290.766) (-291.275) -- 0:00:37
347500 -- (-293.398) (-289.551) (-289.726) [-292.403] * [-289.362] (-293.130) (-290.669) (-289.508) -- 0:00:37
348000 -- (-291.399) [-289.789] (-289.525) (-292.173) * (-293.499) (-290.869) [-291.645] (-290.507) -- 0:00:37
348500 -- [-293.344] (-289.930) (-290.385) (-297.521) * [-292.520] (-290.798) (-292.360) (-294.654) -- 0:00:37
349000 -- (-290.027) (-291.181) [-289.168] (-295.097) * (-290.240) [-290.051] (-291.738) (-298.950) -- 0:00:37
349500 -- (-292.087) (-295.755) [-291.475] (-291.443) * (-296.895) [-290.203] (-291.223) (-289.748) -- 0:00:39
350000 -- [-290.483] (-293.939) (-292.283) (-290.372) * [-289.572] (-292.118) (-292.710) (-292.324) -- 0:00:39
Average standard deviation of split frequencies: 0.008906
350500 -- [-289.245] (-291.301) (-289.387) (-289.419) * (-290.561) (-289.204) (-291.462) [-291.293] -- 0:00:38
351000 -- [-291.633] (-290.929) (-290.363) (-292.141) * (-291.182) [-292.175] (-290.561) (-289.849) -- 0:00:38
351500 -- (-291.410) (-293.152) [-295.801] (-289.564) * (-291.723) [-292.270] (-289.297) (-290.883) -- 0:00:38
352000 -- [-291.400] (-291.102) (-289.136) (-290.150) * (-290.962) (-292.116) (-290.249) [-294.793] -- 0:00:38
352500 -- (-290.663) (-289.289) [-292.395] (-291.686) * (-290.306) (-295.085) (-290.319) [-290.958] -- 0:00:38
353000 -- [-289.974] (-290.214) (-289.762) (-294.080) * (-294.076) [-295.365] (-295.892) (-288.998) -- 0:00:38
353500 -- (-291.084) (-290.261) (-290.458) [-294.171] * (-292.339) (-293.942) (-292.993) [-290.222] -- 0:00:38
354000 -- (-291.750) (-290.698) [-291.036] (-291.186) * [-295.298] (-289.206) (-291.533) (-289.963) -- 0:00:38
354500 -- (-293.726) [-292.988] (-288.852) (-291.528) * (-292.122) (-290.743) [-292.628] (-289.471) -- 0:00:38
355000 -- (-290.765) (-293.824) (-294.425) [-292.574] * (-291.754) [-291.890] (-292.762) (-293.860) -- 0:00:38
Average standard deviation of split frequencies: 0.008724
355500 -- (-289.768) (-291.686) [-295.744] (-289.910) * (-293.722) [-289.708] (-292.546) (-293.228) -- 0:00:38
356000 -- [-293.728] (-289.603) (-291.301) (-291.507) * (-294.303) [-296.444] (-292.219) (-289.501) -- 0:00:37
356500 -- (-292.142) (-290.068) [-293.011] (-290.463) * (-291.263) (-293.003) (-289.574) [-290.788] -- 0:00:37
357000 -- [-288.941] (-289.607) (-291.595) (-290.837) * (-291.055) (-289.090) (-289.523) [-290.799] -- 0:00:37
357500 -- (-290.304) (-294.645) (-291.050) [-296.468] * (-290.949) [-291.210] (-289.214) (-292.661) -- 0:00:37
358000 -- (-293.979) (-290.532) [-292.443] (-290.645) * (-290.285) (-290.296) [-290.969] (-290.901) -- 0:00:37
358500 -- (-290.377) (-293.686) [-291.820] (-290.871) * (-290.648) [-289.737] (-290.657) (-290.660) -- 0:00:37
359000 -- (-289.381) [-293.275] (-293.269) (-293.255) * (-292.142) (-293.291) (-291.997) [-291.342] -- 0:00:37
359500 -- (-295.743) (-289.876) [-294.379] (-292.174) * (-289.908) [-293.212] (-290.162) (-290.618) -- 0:00:37
360000 -- [-291.174] (-290.150) (-289.847) (-290.358) * (-292.498) (-289.059) [-289.979] (-291.557) -- 0:00:37
Average standard deviation of split frequencies: 0.009884
360500 -- [-291.390] (-292.145) (-291.052) (-297.251) * [-293.790] (-289.610) (-290.736) (-292.477) -- 0:00:37
361000 -- (-291.786) (-292.458) (-289.166) [-290.986] * (-290.310) [-292.573] (-297.078) (-290.426) -- 0:00:37
361500 -- (-292.181) [-292.999] (-292.317) (-290.436) * (-291.921) (-291.586) (-291.640) [-290.036] -- 0:00:37
362000 -- (-296.278) (-292.297) [-292.299] (-290.521) * (-291.829) [-289.779] (-290.408) (-290.785) -- 0:00:37
362500 -- (-289.392) (-289.993) (-290.958) [-291.847] * (-291.045) (-290.336) (-289.466) [-289.524] -- 0:00:36
363000 -- (-289.756) [-292.509] (-292.521) (-290.955) * (-290.510) [-291.008] (-291.271) (-293.287) -- 0:00:36
363500 -- (-291.270) (-292.793) [-290.536] (-289.261) * (-300.584) (-291.454) (-291.162) [-292.541] -- 0:00:36
364000 -- (-291.190) (-290.422) (-292.584) [-291.816] * (-292.103) [-291.306] (-290.659) (-290.523) -- 0:00:36
364500 -- (-290.242) (-295.607) (-292.446) [-290.268] * (-293.172) [-294.894] (-289.360) (-289.381) -- 0:00:36
365000 -- (-289.830) (-293.184) (-292.189) [-290.731] * [-289.536] (-290.968) (-292.381) (-289.304) -- 0:00:36
Average standard deviation of split frequencies: 0.010787
365500 -- (-289.688) (-291.355) (-292.058) [-289.186] * (-290.761) [-289.349] (-289.591) (-293.148) -- 0:00:36
366000 -- [-292.076] (-291.044) (-295.183) (-291.166) * (-292.990) (-290.176) (-297.007) [-289.477] -- 0:00:36
366500 -- (-289.303) (-290.002) (-293.024) [-290.393] * (-293.218) (-290.976) [-291.182] (-293.129) -- 0:00:38
367000 -- (-289.464) [-292.813] (-290.406) (-291.911) * (-293.641) (-291.656) [-290.013] (-296.477) -- 0:00:37
367500 -- (-294.143) (-289.621) (-294.280) [-290.030] * (-292.378) (-289.216) [-290.470] (-290.815) -- 0:00:37
368000 -- (-289.736) (-291.671) (-293.865) [-290.972] * (-297.518) [-291.465] (-292.278) (-290.300) -- 0:00:37
368500 -- (-289.052) [-292.639] (-292.801) (-290.586) * (-289.558) (-291.173) (-290.259) [-291.318] -- 0:00:37
369000 -- (-294.073) (-294.180) [-289.891] (-292.734) * (-291.033) (-292.828) [-290.970] (-292.153) -- 0:00:37
369500 -- (-290.830) (-290.214) [-289.322] (-291.395) * (-290.558) (-292.341) (-294.862) [-290.340] -- 0:00:37
370000 -- [-292.506] (-290.800) (-289.925) (-292.243) * [-291.738] (-295.241) (-290.438) (-289.572) -- 0:00:37
Average standard deviation of split frequencies: 0.010492
370500 -- [-291.366] (-292.553) (-289.117) (-292.348) * [-289.352] (-291.422) (-292.033) (-288.972) -- 0:00:37
371000 -- (-294.554) (-291.185) (-288.743) [-290.868] * (-293.030) (-295.859) (-290.945) [-290.509] -- 0:00:37
371500 -- (-298.467) (-294.805) [-290.978] (-292.756) * (-289.022) [-295.282] (-292.745) (-289.736) -- 0:00:37
372000 -- [-290.831] (-293.070) (-288.765) (-292.602) * (-290.399) (-294.925) (-290.972) [-295.630] -- 0:00:37
372500 -- (-290.206) (-294.647) (-291.705) [-290.707] * (-290.459) [-292.238] (-290.831) (-292.834) -- 0:00:37
373000 -- (-292.988) [-290.114] (-289.905) (-291.150) * (-289.341) (-290.174) (-291.749) [-291.411] -- 0:00:36
373500 -- [-290.029] (-290.497) (-290.632) (-292.653) * (-292.820) (-292.623) [-292.634] (-290.822) -- 0:00:36
374000 -- (-296.631) (-291.216) [-289.675] (-293.630) * [-295.497] (-292.741) (-291.604) (-293.797) -- 0:00:36
374500 -- (-290.251) (-293.046) (-294.717) [-293.071] * (-291.727) (-290.533) [-291.450] (-293.319) -- 0:00:36
375000 -- (-291.089) (-289.611) [-289.949] (-289.033) * (-291.396) (-290.283) (-290.813) [-293.707] -- 0:00:36
Average standard deviation of split frequencies: 0.010694
375500 -- [-291.622] (-294.487) (-293.312) (-290.418) * (-289.685) (-291.295) [-291.294] (-291.803) -- 0:00:36
376000 -- (-291.684) (-295.867) [-290.785] (-289.419) * (-289.366) [-290.752] (-289.798) (-289.714) -- 0:00:36
376500 -- (-291.894) (-297.129) [-289.340] (-296.455) * [-291.636] (-291.151) (-293.418) (-291.954) -- 0:00:36
377000 -- (-294.968) (-294.944) [-294.994] (-299.908) * (-289.504) (-290.172) (-291.456) [-291.259] -- 0:00:36
377500 -- (-291.482) (-289.497) (-295.930) [-289.520] * (-289.493) (-291.097) [-289.706] (-290.431) -- 0:00:36
378000 -- (-289.687) (-291.503) [-293.920] (-290.473) * [-289.790] (-291.848) (-290.469) (-292.148) -- 0:00:36
378500 -- (-291.195) (-291.482) [-290.161] (-291.576) * (-289.682) [-290.422] (-289.380) (-290.910) -- 0:00:36
379000 -- (-289.785) (-293.136) (-290.101) [-289.127] * [-291.297] (-294.288) (-289.923) (-289.693) -- 0:00:36
379500 -- (-291.555) (-291.967) [-290.149] (-292.426) * (-295.995) (-290.900) (-289.426) [-291.798] -- 0:00:35
380000 -- (-291.253) (-293.983) [-292.061] (-291.205) * (-289.832) (-290.006) [-290.663] (-291.297) -- 0:00:35
Average standard deviation of split frequencies: 0.010125
380500 -- (-289.573) (-295.988) [-291.755] (-294.299) * [-290.131] (-291.807) (-290.376) (-291.441) -- 0:00:35
381000 -- [-292.113] (-291.992) (-290.983) (-290.500) * (-292.099) (-296.234) (-292.977) [-291.208] -- 0:00:35
381500 -- (-292.874) [-292.631] (-295.899) (-289.516) * (-291.371) (-294.971) [-297.420] (-293.354) -- 0:00:35
382000 -- (-291.545) (-291.820) (-292.611) [-290.590] * (-292.406) [-294.731] (-290.895) (-290.032) -- 0:00:35
382500 -- (-297.287) (-293.871) [-290.557] (-289.547) * [-292.395] (-298.957) (-289.805) (-293.836) -- 0:00:35
383000 -- (-291.481) (-291.263) (-290.462) [-289.674] * (-289.818) (-291.600) [-291.092] (-290.589) -- 0:00:35
383500 -- (-292.759) (-290.720) (-292.813) [-291.099] * (-292.088) (-289.685) [-292.025] (-289.557) -- 0:00:35
384000 -- [-290.905] (-289.675) (-292.637) (-290.682) * (-292.044) (-289.805) [-291.329] (-292.756) -- 0:00:36
384500 -- [-290.208] (-289.884) (-292.132) (-291.020) * [-290.302] (-290.622) (-292.107) (-292.684) -- 0:00:36
385000 -- (-289.868) [-290.266] (-290.062) (-290.399) * (-290.343) (-292.294) (-290.786) [-289.081] -- 0:00:36
Average standard deviation of split frequencies: 0.009698
385500 -- (-290.402) [-291.284] (-292.107) (-289.063) * (-290.092) (-291.300) (-292.310) [-291.359] -- 0:00:36
386000 -- (-291.764) (-291.020) [-292.974] (-290.107) * (-291.485) [-290.839] (-298.044) (-290.914) -- 0:00:36
386500 -- (-289.835) [-291.242] (-291.760) (-291.617) * [-289.288] (-295.466) (-295.026) (-296.853) -- 0:00:36
387000 -- (-290.709) (-294.515) [-289.357] (-290.120) * [-290.661] (-289.688) (-300.298) (-291.881) -- 0:00:36
387500 -- (-291.677) [-289.871] (-290.521) (-290.384) * (-291.229) [-292.407] (-290.001) (-290.226) -- 0:00:36
388000 -- (-290.871) (-293.498) [-291.969] (-293.278) * [-292.999] (-293.450) (-289.826) (-290.001) -- 0:00:36
388500 -- [-293.518] (-299.673) (-288.772) (-289.941) * (-293.197) (-293.997) [-290.777] (-289.859) -- 0:00:36
389000 -- [-291.905] (-291.972) (-289.493) (-292.409) * (-292.536) (-295.547) [-292.521] (-290.826) -- 0:00:36
389500 -- (-292.633) (-292.741) (-292.433) [-291.710] * (-291.939) (-291.294) [-290.154] (-292.844) -- 0:00:36
390000 -- (-289.954) [-289.622] (-289.840) (-297.932) * (-290.048) (-288.845) [-292.835] (-290.524) -- 0:00:35
Average standard deviation of split frequencies: 0.009352
390500 -- (-290.487) (-291.868) (-296.414) [-290.577] * [-290.058] (-289.902) (-297.808) (-294.013) -- 0:00:35
391000 -- (-301.174) (-292.011) (-290.345) [-290.242] * (-291.665) (-289.952) (-292.708) [-290.816] -- 0:00:35
391500 -- (-296.977) (-291.579) [-290.644] (-293.382) * (-291.109) [-289.388] (-292.299) (-293.303) -- 0:00:35
392000 -- [-296.073] (-296.007) (-292.654) (-294.148) * (-290.985) (-289.935) [-289.364] (-290.782) -- 0:00:35
392500 -- (-290.203) [-291.337] (-290.341) (-293.098) * (-294.694) (-292.487) (-290.435) [-290.155] -- 0:00:35
393000 -- (-289.466) [-288.869] (-290.293) (-293.656) * [-291.213] (-290.362) (-292.736) (-289.695) -- 0:00:35
393500 -- (-292.397) (-290.503) [-289.435] (-292.726) * (-291.609) (-298.642) (-293.107) [-294.822] -- 0:00:35
394000 -- [-290.941] (-289.355) (-292.535) (-293.219) * (-291.630) (-290.755) [-290.650] (-291.143) -- 0:00:35
394500 -- (-290.822) (-290.174) (-291.414) [-289.500] * (-294.542) (-291.395) [-290.311] (-291.541) -- 0:00:35
395000 -- [-290.289] (-292.977) (-295.670) (-289.589) * [-290.311] (-290.028) (-289.966) (-291.139) -- 0:00:35
Average standard deviation of split frequencies: 0.009226
395500 -- [-290.706] (-292.745) (-289.627) (-291.488) * (-293.412) [-291.602] (-292.789) (-289.907) -- 0:00:35
396000 -- (-292.683) (-292.297) (-289.759) [-290.170] * [-290.611] (-290.916) (-289.377) (-289.038) -- 0:00:35
396500 -- [-291.016] (-293.154) (-292.900) (-291.877) * (-291.220) (-290.542) [-290.353] (-290.886) -- 0:00:35
397000 -- (-293.473) (-289.754) [-290.853] (-290.300) * [-292.091] (-290.976) (-289.858) (-293.108) -- 0:00:34
397500 -- (-290.933) (-289.726) (-292.888) [-289.543] * [-293.227] (-291.076) (-292.405) (-291.703) -- 0:00:34
398000 -- [-290.824] (-291.524) (-291.409) (-295.054) * (-294.255) (-293.511) (-289.967) [-290.931] -- 0:00:34
398500 -- (-293.453) [-291.474] (-292.848) (-292.267) * (-292.745) (-290.260) (-294.173) [-290.745] -- 0:00:34
399000 -- [-292.551] (-290.755) (-290.897) (-295.662) * (-292.513) (-292.242) (-289.710) [-292.374] -- 0:00:34
399500 -- [-288.948] (-290.920) (-291.176) (-297.438) * [-289.860] (-290.952) (-290.732) (-294.928) -- 0:00:34
400000 -- [-289.001] (-291.097) (-289.664) (-297.970) * (-290.742) (-290.775) (-291.371) [-289.790] -- 0:00:34
Average standard deviation of split frequencies: 0.009339
400500 -- (-289.798) (-290.432) (-290.369) [-295.793] * [-290.123] (-293.693) (-291.241) (-289.837) -- 0:00:34
401000 -- (-292.709) [-292.800] (-293.022) (-291.805) * (-290.860) (-292.223) [-292.819] (-289.851) -- 0:00:35
401500 -- (-294.537) (-293.276) [-289.222] (-291.688) * [-289.906] (-290.269) (-291.197) (-293.008) -- 0:00:35
402000 -- (-290.677) [-289.348] (-289.673) (-291.141) * [-291.013] (-290.898) (-290.686) (-292.185) -- 0:00:35
402500 -- (-290.712) (-291.746) (-289.306) [-290.477] * (-292.911) (-290.954) [-290.705] (-290.510) -- 0:00:35
403000 -- [-289.770] (-291.116) (-288.986) (-291.777) * (-294.566) (-297.819) (-292.504) [-291.982] -- 0:00:35
403500 -- (-292.346) [-293.396] (-290.069) (-291.456) * (-291.608) (-290.953) [-292.467] (-289.392) -- 0:00:35
404000 -- [-291.343] (-290.638) (-289.596) (-292.651) * (-292.072) [-291.552] (-289.423) (-291.133) -- 0:00:35
404500 -- (-289.917) [-292.681] (-292.071) (-293.357) * (-290.697) (-289.483) [-291.127] (-290.762) -- 0:00:35
405000 -- (-291.738) (-291.927) (-291.758) [-291.549] * (-290.388) [-289.331] (-297.520) (-293.852) -- 0:00:35
Average standard deviation of split frequencies: 0.009289
405500 -- (-296.403) (-291.746) [-291.213] (-289.136) * (-290.887) (-289.634) [-293.092] (-292.207) -- 0:00:35
406000 -- (-291.764) (-290.780) (-292.056) [-289.708] * (-289.849) (-289.687) (-290.713) [-292.390] -- 0:00:35
406500 -- (-299.627) (-292.832) [-290.690] (-290.180) * (-291.172) [-290.132] (-290.885) (-294.044) -- 0:00:35
407000 -- [-294.200] (-292.968) (-291.598) (-289.182) * [-290.772] (-290.078) (-290.182) (-291.793) -- 0:00:34
407500 -- (-293.504) (-290.762) (-289.749) [-290.316] * (-290.005) (-289.825) (-289.996) [-291.695] -- 0:00:34
408000 -- (-289.840) (-300.498) (-290.445) [-289.200] * (-291.123) (-296.379) (-290.549) [-290.763] -- 0:00:34
408500 -- (-291.355) (-290.859) [-292.303] (-291.119) * (-292.726) (-291.545) [-289.477] (-292.141) -- 0:00:34
409000 -- (-292.704) [-290.239] (-295.794) (-290.775) * [-289.623] (-291.659) (-292.519) (-294.363) -- 0:00:34
409500 -- [-291.488] (-291.129) (-295.425) (-293.123) * (-291.684) (-289.418) [-289.694] (-290.570) -- 0:00:34
410000 -- (-291.631) [-290.342] (-289.853) (-289.783) * (-292.922) (-290.752) [-289.528] (-291.649) -- 0:00:34
Average standard deviation of split frequencies: 0.009111
410500 -- (-291.999) [-290.952] (-289.255) (-292.044) * (-289.628) (-291.641) [-289.677] (-291.389) -- 0:00:34
411000 -- (-290.926) (-290.158) (-289.788) [-293.381] * (-289.275) (-292.933) [-290.465] (-288.945) -- 0:00:34
411500 -- (-289.486) (-290.154) [-293.930] (-302.213) * [-290.491] (-289.592) (-293.084) (-293.424) -- 0:00:34
412000 -- (-290.420) (-293.904) (-292.225) [-289.779] * (-291.862) (-290.053) (-292.193) [-290.327] -- 0:00:34
412500 -- [-290.476] (-290.436) (-291.418) (-290.029) * [-289.282] (-293.881) (-292.485) (-290.825) -- 0:00:34
413000 -- [-292.211] (-290.185) (-289.317) (-290.143) * (-289.485) [-290.657] (-298.032) (-291.609) -- 0:00:34
413500 -- (-293.122) (-290.047) (-290.152) [-288.744] * (-296.533) [-293.580] (-292.826) (-289.938) -- 0:00:34
414000 -- (-290.545) (-294.211) (-291.313) [-292.181] * (-290.988) [-290.032] (-290.390) (-290.693) -- 0:00:33
414500 -- (-290.144) [-289.010] (-291.398) (-290.762) * (-291.367) [-289.570] (-293.147) (-291.659) -- 0:00:33
415000 -- (-296.013) [-290.782] (-289.520) (-291.428) * (-291.660) (-289.942) (-291.798) [-289.176] -- 0:00:33
Average standard deviation of split frequencies: 0.008782
415500 -- (-294.446) [-289.527] (-289.511) (-290.182) * [-292.464] (-289.796) (-288.898) (-289.640) -- 0:00:33
416000 -- [-290.075] (-290.533) (-293.681) (-289.994) * [-293.650] (-293.340) (-290.120) (-289.534) -- 0:00:33
416500 -- (-290.599) (-293.934) [-290.735] (-290.459) * (-293.297) (-294.661) (-288.889) [-293.206] -- 0:00:33
417000 -- (-297.852) [-291.925] (-289.949) (-293.947) * (-290.267) (-293.307) (-291.984) [-293.287] -- 0:00:33
417500 -- (-291.645) (-291.329) (-293.043) [-291.699] * (-289.814) (-289.355) [-291.064] (-291.546) -- 0:00:33
418000 -- (-291.931) (-291.818) [-291.087] (-293.528) * (-292.170) [-292.288] (-292.543) (-290.695) -- 0:00:34
418500 -- [-289.779] (-295.166) (-289.677) (-293.790) * (-293.610) (-290.961) (-295.118) [-288.856] -- 0:00:34
419000 -- (-295.439) [-289.032] (-290.894) (-290.536) * (-292.456) (-291.485) [-292.353] (-290.506) -- 0:00:34
419500 -- (-291.907) (-290.216) [-293.849] (-294.930) * (-295.591) (-291.168) [-290.566] (-289.745) -- 0:00:34
420000 -- (-289.561) (-294.115) [-293.587] (-292.972) * (-292.295) [-291.395] (-290.694) (-289.504) -- 0:00:34
Average standard deviation of split frequencies: 0.008965
420500 -- (-291.968) [-288.937] (-290.643) (-290.125) * (-291.101) (-289.364) (-290.879) [-291.385] -- 0:00:34
421000 -- (-289.982) (-289.957) [-290.656] (-291.282) * [-290.291] (-290.129) (-294.666) (-290.001) -- 0:00:34
421500 -- [-292.848] (-292.072) (-290.566) (-289.672) * [-295.432] (-291.207) (-292.709) (-290.545) -- 0:00:34
422000 -- (-292.127) (-291.191) (-291.137) [-290.758] * [-289.172] (-291.143) (-289.642) (-290.257) -- 0:00:34
422500 -- (-289.805) (-288.791) [-289.782] (-294.713) * (-291.921) [-291.420] (-292.655) (-290.383) -- 0:00:34
423000 -- [-290.271] (-292.525) (-290.029) (-291.828) * (-290.398) (-289.827) [-290.902] (-291.278) -- 0:00:34
423500 -- [-292.593] (-294.411) (-292.204) (-291.923) * (-291.982) [-290.563] (-290.504) (-292.215) -- 0:00:34
424000 -- (-289.698) (-290.302) (-293.636) [-290.310] * (-292.755) [-291.231] (-292.340) (-290.670) -- 0:00:33
424500 -- (-290.497) [-290.828] (-293.279) (-290.262) * (-292.379) [-294.365] (-290.526) (-290.174) -- 0:00:33
425000 -- (-292.725) (-292.425) [-290.543] (-290.183) * (-290.487) (-292.143) (-290.737) [-289.640] -- 0:00:33
Average standard deviation of split frequencies: 0.008657
425500 -- [-290.221] (-290.063) (-290.216) (-290.427) * (-291.985) (-291.072) (-289.459) [-290.656] -- 0:00:33
426000 -- (-289.565) (-290.741) (-289.430) [-291.306] * [-289.224] (-292.723) (-295.656) (-289.400) -- 0:00:33
426500 -- (-289.614) [-295.724] (-291.957) (-296.196) * [-291.193] (-290.784) (-302.636) (-289.833) -- 0:00:33
427000 -- (-291.372) (-293.907) [-293.778] (-291.575) * (-291.838) (-291.371) (-291.167) [-289.397] -- 0:00:33
427500 -- [-290.539] (-290.434) (-291.236) (-290.456) * [-290.210] (-294.370) (-297.978) (-291.694) -- 0:00:33
428000 -- [-290.420] (-292.424) (-292.628) (-291.501) * (-290.364) (-293.242) (-292.683) [-295.122] -- 0:00:33
428500 -- [-292.991] (-289.121) (-294.814) (-291.235) * [-292.614] (-290.105) (-290.645) (-290.439) -- 0:00:33
429000 -- [-290.359] (-289.725) (-289.418) (-291.278) * (-290.469) (-291.766) (-291.933) [-290.241] -- 0:00:33
429500 -- (-291.357) [-293.889] (-294.797) (-289.000) * (-288.946) [-290.757] (-289.652) (-290.280) -- 0:00:33
430000 -- (-290.664) (-289.659) (-290.598) [-291.365] * [-289.069] (-290.416) (-291.069) (-291.667) -- 0:00:33
Average standard deviation of split frequencies: 0.009143
430500 -- (-291.746) (-289.950) [-288.905] (-292.503) * (-291.089) (-293.837) (-291.967) [-290.302] -- 0:00:33
431000 -- [-291.484] (-293.720) (-290.510) (-291.678) * (-288.952) (-295.050) (-291.429) [-290.322] -- 0:00:33
431500 -- (-290.121) [-293.062] (-289.648) (-290.258) * [-289.330] (-294.388) (-292.254) (-291.164) -- 0:00:32
432000 -- (-289.336) (-292.451) (-289.668) [-289.903] * [-291.940] (-292.575) (-289.490) (-290.518) -- 0:00:32
432500 -- (-293.698) [-292.878] (-288.979) (-289.369) * (-290.051) [-293.533] (-291.686) (-289.014) -- 0:00:32
433000 -- (-290.011) (-294.156) [-289.045] (-292.382) * (-289.320) (-291.185) [-292.314] (-290.012) -- 0:00:32
433500 -- (-289.323) [-289.965] (-292.127) (-294.828) * (-292.182) [-290.653] (-291.633) (-291.208) -- 0:00:32
434000 -- [-290.447] (-291.960) (-292.693) (-291.139) * [-293.601] (-289.816) (-291.312) (-291.703) -- 0:00:32
434500 -- (-289.845) [-291.284] (-291.723) (-293.594) * (-290.535) (-291.538) [-288.800] (-291.065) -- 0:00:32
435000 -- (-292.770) (-289.571) (-290.239) [-291.096] * (-294.017) (-290.664) [-291.287] (-290.408) -- 0:00:32
Average standard deviation of split frequencies: 0.008904
435500 -- (-294.361) [-289.459] (-291.234) (-290.973) * (-290.508) (-290.551) [-293.278] (-291.382) -- 0:00:33
436000 -- [-290.743] (-289.784) (-290.520) (-289.386) * (-290.314) (-290.657) (-293.072) [-291.090] -- 0:00:33
436500 -- (-291.364) (-290.355) [-291.111] (-289.128) * (-293.168) (-292.115) [-290.624] (-291.833) -- 0:00:33
437000 -- [-289.480] (-290.161) (-293.025) (-293.783) * (-293.226) [-290.260] (-291.014) (-291.125) -- 0:00:33
437500 -- [-291.008] (-288.948) (-291.029) (-296.584) * [-292.738] (-291.608) (-290.130) (-291.901) -- 0:00:33
438000 -- [-290.495] (-292.203) (-293.061) (-293.012) * (-291.329) (-294.664) (-290.876) [-290.571] -- 0:00:33
438500 -- (-289.392) (-292.315) [-290.363] (-291.159) * (-290.448) (-291.054) [-289.641] (-289.896) -- 0:00:33
439000 -- (-289.768) [-292.914] (-291.055) (-290.585) * (-292.546) [-289.721] (-289.696) (-293.621) -- 0:00:33
439500 -- (-290.584) (-289.288) (-289.186) [-289.647] * (-289.402) (-290.254) (-289.805) [-293.415] -- 0:00:33
440000 -- (-290.359) [-293.586] (-291.977) (-292.567) * (-289.572) [-291.372] (-291.341) (-290.206) -- 0:00:33
Average standard deviation of split frequencies: 0.009376
440500 -- [-290.255] (-291.250) (-288.929) (-289.179) * (-291.248) (-290.231) [-290.040] (-291.522) -- 0:00:33
441000 -- [-291.306] (-293.218) (-292.211) (-290.001) * (-291.939) [-290.919] (-292.101) (-290.484) -- 0:00:32
441500 -- (-289.287) (-296.467) (-291.764) [-290.811] * (-290.480) (-294.348) [-291.146] (-295.403) -- 0:00:32
442000 -- (-289.237) [-292.689] (-296.046) (-294.775) * (-289.043) [-291.146] (-295.016) (-292.118) -- 0:00:32
442500 -- (-290.444) (-289.896) [-289.454] (-290.986) * [-294.628] (-289.582) (-292.793) (-289.036) -- 0:00:32
443000 -- (-292.629) [-292.405] (-290.050) (-291.600) * (-293.127) (-289.591) [-289.706] (-293.477) -- 0:00:32
443500 -- [-291.858] (-291.795) (-289.696) (-291.757) * (-291.293) [-290.740] (-292.599) (-298.252) -- 0:00:32
444000 -- (-290.314) [-289.262] (-290.137) (-291.157) * (-290.501) (-290.018) (-290.947) [-293.481] -- 0:00:32
444500 -- [-289.099] (-290.362) (-289.043) (-291.839) * (-290.005) [-291.293] (-292.509) (-290.732) -- 0:00:32
445000 -- (-292.682) (-289.986) (-289.239) [-290.344] * (-290.679) [-289.654] (-289.767) (-293.350) -- 0:00:32
Average standard deviation of split frequencies: 0.009637
445500 -- (-293.218) (-293.152) [-290.747] (-289.669) * [-292.559] (-290.086) (-291.374) (-289.886) -- 0:00:32
446000 -- (-289.710) [-289.176] (-293.472) (-292.180) * (-291.577) (-289.263) [-289.368] (-290.065) -- 0:00:32
446500 -- (-290.663) (-289.586) (-291.754) [-293.789] * (-296.041) [-292.475] (-295.332) (-291.231) -- 0:00:32
447000 -- (-293.179) [-291.858] (-290.632) (-292.267) * (-292.579) (-290.597) [-292.988] (-290.102) -- 0:00:32
447500 -- (-293.682) (-292.009) [-289.731] (-293.121) * (-290.245) (-291.744) (-292.439) [-289.617] -- 0:00:32
448000 -- (-290.856) (-292.022) (-293.393) [-290.813] * (-291.188) (-291.987) [-292.026] (-290.585) -- 0:00:32
448500 -- (-289.855) (-292.684) (-291.145) [-290.013] * (-291.299) (-299.477) [-292.841] (-290.482) -- 0:00:31
449000 -- (-291.070) (-291.097) (-289.716) [-290.739] * (-292.604) (-292.135) [-292.158] (-291.521) -- 0:00:31
449500 -- (-292.072) [-294.434] (-293.204) (-290.155) * (-292.569) (-291.882) (-293.808) [-290.433] -- 0:00:31
450000 -- (-290.032) [-292.290] (-289.461) (-290.621) * (-292.178) (-291.448) (-294.381) [-290.694] -- 0:00:31
Average standard deviation of split frequencies: 0.009722
450500 -- [-289.837] (-292.421) (-289.864) (-290.495) * [-292.286] (-290.098) (-291.618) (-289.708) -- 0:00:31
451000 -- (-289.146) (-293.397) (-291.127) [-290.349] * (-289.954) (-290.238) (-290.934) [-291.187] -- 0:00:31
451500 -- (-290.062) (-294.438) (-291.513) [-290.459] * [-289.660] (-291.928) (-295.029) (-291.139) -- 0:00:31
452000 -- (-291.048) (-290.716) (-289.963) [-290.795] * [-290.000] (-291.196) (-290.441) (-289.466) -- 0:00:31
452500 -- (-289.157) (-290.072) [-290.499] (-297.901) * (-292.697) [-292.226] (-289.195) (-290.281) -- 0:00:32
453000 -- [-289.339] (-290.750) (-292.144) (-293.733) * (-290.187) (-290.377) [-289.321] (-289.182) -- 0:00:32
453500 -- (-292.856) [-291.583] (-291.894) (-290.631) * (-291.070) [-291.522] (-292.780) (-291.431) -- 0:00:32
454000 -- (-290.897) (-290.141) (-291.180) [-288.923] * (-293.260) [-288.936] (-293.308) (-291.184) -- 0:00:32
454500 -- (-291.491) (-291.016) (-289.097) [-289.874] * [-290.120] (-292.274) (-295.351) (-289.834) -- 0:00:32
455000 -- [-290.917] (-290.048) (-290.295) (-291.336) * (-294.846) [-290.734] (-293.753) (-290.761) -- 0:00:32
Average standard deviation of split frequencies: 0.009243
455500 -- [-290.761] (-290.401) (-291.839) (-293.005) * (-291.283) (-293.193) (-292.296) [-290.030] -- 0:00:32
456000 -- (-291.661) [-290.109] (-290.271) (-291.610) * (-292.772) (-291.317) (-291.351) [-289.520] -- 0:00:32
456500 -- (-292.030) [-293.813] (-293.033) (-293.853) * (-290.894) (-290.400) (-290.677) [-291.247] -- 0:00:32
457000 -- (-293.886) (-290.873) [-291.525] (-293.682) * (-295.188) (-290.616) [-290.883] (-292.779) -- 0:00:32
457500 -- (-291.317) (-290.030) [-290.578] (-293.203) * (-294.454) [-292.306] (-289.212) (-291.574) -- 0:00:32
458000 -- (-293.139) (-290.812) (-289.387) [-290.410] * (-293.663) [-292.078] (-291.469) (-290.049) -- 0:00:31
458500 -- (-290.237) (-291.093) [-291.739] (-290.803) * [-292.995] (-292.192) (-292.673) (-290.387) -- 0:00:31
459000 -- [-291.255] (-289.048) (-291.363) (-290.024) * [-289.848] (-293.281) (-292.219) (-292.119) -- 0:00:31
459500 -- (-289.593) [-291.535] (-291.785) (-289.226) * (-293.131) (-294.663) (-289.949) [-290.866] -- 0:00:31
460000 -- (-291.928) (-292.076) (-293.937) [-292.847] * (-294.044) (-293.490) (-290.339) [-292.481] -- 0:00:31
Average standard deviation of split frequencies: 0.009872
460500 -- (-290.348) (-292.751) [-289.616] (-292.116) * (-291.331) (-289.235) (-289.539) [-290.964] -- 0:00:31
461000 -- (-289.732) (-298.485) [-290.093] (-292.797) * (-290.503) (-290.118) (-292.583) [-290.975] -- 0:00:31
461500 -- (-289.223) (-299.033) [-290.447] (-291.765) * (-289.097) (-290.804) (-293.120) [-290.589] -- 0:00:31
462000 -- [-291.175] (-290.271) (-290.062) (-291.961) * (-291.471) [-289.917] (-289.679) (-291.022) -- 0:00:31
462500 -- (-299.318) (-290.811) [-289.840] (-289.990) * [-291.015] (-290.343) (-300.115) (-293.110) -- 0:00:31
463000 -- [-294.206] (-291.266) (-290.991) (-289.477) * (-292.491) [-290.755] (-294.714) (-293.839) -- 0:00:31
463500 -- (-290.609) [-291.393] (-292.114) (-290.354) * [-290.556] (-292.632) (-296.395) (-289.460) -- 0:00:31
464000 -- (-290.786) [-295.271] (-290.035) (-292.217) * (-290.680) [-290.155] (-295.883) (-289.602) -- 0:00:31
464500 -- (-289.313) [-291.575] (-289.351) (-290.304) * [-290.787] (-289.314) (-289.527) (-289.065) -- 0:00:31
465000 -- [-289.902] (-291.776) (-290.841) (-289.972) * (-289.606) [-289.315] (-291.086) (-292.252) -- 0:00:31
Average standard deviation of split frequencies: 0.009937
465500 -- (-291.292) (-290.455) (-293.764) [-290.446] * (-293.775) (-292.803) [-292.441] (-292.916) -- 0:00:31
466000 -- (-290.189) (-290.084) (-291.557) [-291.429] * (-290.704) (-289.795) (-290.856) [-292.889] -- 0:00:30
466500 -- (-289.905) (-292.363) (-292.887) [-289.434] * (-289.411) (-296.285) [-292.309] (-290.170) -- 0:00:30
467000 -- [-293.155] (-292.084) (-294.116) (-288.941) * (-290.975) (-289.991) (-289.059) [-291.602] -- 0:00:30
467500 -- [-293.214] (-292.244) (-291.743) (-291.776) * (-289.930) (-290.426) [-290.756] (-290.287) -- 0:00:30
468000 -- (-296.891) [-291.208] (-289.994) (-289.448) * (-289.988) [-292.883] (-292.273) (-291.226) -- 0:00:30
468500 -- (-291.049) [-289.640] (-292.575) (-291.525) * (-292.954) (-290.090) [-295.545] (-294.757) -- 0:00:30
469000 -- (-291.256) (-292.328) [-293.962] (-291.112) * (-291.647) (-292.955) [-291.118] (-290.662) -- 0:00:30
469500 -- (-290.207) (-293.855) (-290.791) [-291.053] * (-292.882) (-292.516) (-290.443) [-289.171] -- 0:00:30
470000 -- (-289.528) [-293.529] (-290.971) (-289.324) * [-290.472] (-294.612) (-292.639) (-290.688) -- 0:00:31
Average standard deviation of split frequencies: 0.010016
470500 -- [-291.584] (-295.104) (-293.470) (-291.292) * [-293.321] (-293.266) (-293.882) (-291.829) -- 0:00:31
471000 -- (-292.244) [-290.228] (-291.931) (-290.188) * (-289.499) (-290.866) (-291.548) [-290.271] -- 0:00:31
471500 -- [-290.258] (-293.802) (-290.233) (-290.281) * (-293.079) (-292.417) [-290.380] (-288.999) -- 0:00:31
472000 -- (-289.388) (-293.222) [-291.931] (-289.985) * [-291.705] (-290.161) (-291.736) (-290.403) -- 0:00:31
472500 -- [-290.210] (-291.895) (-290.560) (-290.315) * (-289.490) (-290.994) [-292.236] (-289.245) -- 0:00:31
473000 -- (-290.793) (-291.237) [-289.874] (-289.371) * [-289.468] (-291.738) (-290.439) (-291.315) -- 0:00:31
473500 -- (-290.263) (-291.757) [-290.256] (-293.787) * (-290.920) (-292.644) [-291.183] (-290.497) -- 0:00:31
474000 -- (-289.882) [-294.013] (-289.203) (-291.520) * [-291.115] (-290.601) (-290.606) (-289.855) -- 0:00:31
474500 -- (-289.684) [-293.953] (-291.994) (-289.986) * [-300.840] (-290.305) (-289.702) (-292.545) -- 0:00:31
475000 -- [-289.874] (-290.725) (-289.328) (-290.775) * (-289.354) [-289.152] (-289.681) (-290.627) -- 0:00:30
Average standard deviation of split frequencies: 0.009554
475500 -- (-293.088) (-290.271) [-290.178] (-290.125) * [-290.379] (-289.471) (-289.640) (-291.952) -- 0:00:30
476000 -- [-290.393] (-289.820) (-295.073) (-289.374) * (-295.089) (-291.232) [-289.532] (-289.727) -- 0:00:30
476500 -- (-290.391) (-290.079) (-291.676) [-293.467] * [-289.343] (-292.901) (-291.910) (-290.073) -- 0:00:30
477000 -- (-293.134) [-289.801] (-292.323) (-293.467) * (-291.581) (-294.788) [-293.348] (-290.101) -- 0:00:30
477500 -- (-293.245) [-290.314] (-289.743) (-293.490) * (-290.560) (-292.469) [-290.249] (-290.935) -- 0:00:30
478000 -- (-294.254) [-290.395] (-292.395) (-291.471) * [-291.059] (-290.773) (-292.888) (-290.749) -- 0:00:30
478500 -- (-293.593) (-290.123) (-294.589) [-291.927] * (-292.594) (-289.292) (-290.704) [-293.136] -- 0:00:30
479000 -- (-291.912) (-290.667) (-293.284) [-292.155] * (-290.176) (-291.651) (-292.401) [-291.041] -- 0:00:30
479500 -- (-293.655) (-290.797) (-291.779) [-291.728] * (-292.207) (-291.252) [-290.524] (-289.540) -- 0:00:30
480000 -- (-293.848) (-294.960) [-289.906] (-290.833) * [-291.319] (-293.328) (-290.241) (-289.325) -- 0:00:30
Average standard deviation of split frequencies: 0.008884
480500 -- (-291.991) [-291.243] (-290.958) (-292.250) * (-292.184) [-289.683] (-292.290) (-290.783) -- 0:00:30
481000 -- (-290.353) (-290.163) (-292.744) [-289.145] * (-289.933) [-290.634] (-295.494) (-290.216) -- 0:00:30
481500 -- (-290.717) (-289.363) (-291.107) [-289.454] * (-289.887) [-290.605] (-294.284) (-295.082) -- 0:00:30
482000 -- (-290.078) (-293.667) [-290.524] (-289.694) * (-289.762) [-291.136] (-291.117) (-292.023) -- 0:00:30
482500 -- [-293.363] (-289.371) (-291.006) (-292.827) * (-290.678) (-289.552) (-298.026) [-290.802] -- 0:00:30
483000 -- (-293.684) [-289.999] (-291.651) (-291.986) * (-291.440) (-292.007) [-290.549] (-294.529) -- 0:00:29
483500 -- [-296.116] (-290.805) (-292.652) (-291.839) * (-289.534) (-292.689) (-289.110) [-291.349] -- 0:00:29
484000 -- (-292.559) (-292.689) (-290.291) [-292.944] * (-295.609) (-294.727) [-290.411] (-291.117) -- 0:00:29
484500 -- [-293.281] (-290.238) (-291.268) (-291.601) * (-293.655) (-296.369) [-290.194] (-291.632) -- 0:00:29
485000 -- [-291.866] (-290.405) (-288.737) (-291.918) * (-291.617) [-289.966] (-290.494) (-293.977) -- 0:00:29
Average standard deviation of split frequencies: 0.008673
485500 -- (-290.817) (-293.186) [-289.079] (-291.237) * (-288.783) [-289.044] (-290.080) (-289.935) -- 0:00:29
486000 -- (-290.943) (-290.299) (-291.342) [-290.410] * (-291.432) (-293.378) (-293.821) [-290.821] -- 0:00:29
486500 -- [-290.577] (-292.351) (-290.512) (-292.313) * [-290.529] (-291.052) (-292.462) (-289.872) -- 0:00:29
487000 -- (-290.900) (-293.239) [-292.422] (-289.917) * (-289.467) [-289.744] (-291.395) (-291.658) -- 0:00:30
487500 -- (-290.049) [-292.591] (-291.153) (-289.710) * [-292.027] (-294.756) (-297.999) (-294.137) -- 0:00:30
488000 -- (-289.337) (-289.420) [-291.168] (-291.001) * (-291.582) [-289.632] (-291.404) (-290.018) -- 0:00:30
488500 -- [-289.601] (-290.098) (-289.441) (-290.119) * [-291.742] (-289.982) (-293.295) (-291.217) -- 0:00:30
489000 -- (-289.543) (-289.352) [-295.086] (-296.062) * [-290.304] (-289.848) (-292.067) (-290.534) -- 0:00:30
489500 -- (-294.215) [-291.289] (-290.371) (-292.326) * (-295.280) (-290.341) [-290.650] (-291.008) -- 0:00:30
490000 -- (-289.402) [-291.888] (-290.711) (-290.717) * (-291.742) [-289.187] (-289.807) (-292.202) -- 0:00:30
Average standard deviation of split frequencies: 0.008760
490500 -- (-293.009) (-293.028) (-292.578) [-289.787] * (-294.048) [-289.663] (-291.081) (-291.381) -- 0:00:30
491000 -- (-290.256) (-294.391) (-290.622) [-290.060] * (-291.444) (-290.760) (-295.553) [-288.953] -- 0:00:30
491500 -- [-291.116] (-289.446) (-290.053) (-292.559) * [-289.189] (-291.816) (-295.429) (-290.294) -- 0:00:30
492000 -- [-289.836] (-297.250) (-291.623) (-289.553) * [-289.739] (-295.119) (-290.132) (-290.893) -- 0:00:29
492500 -- (-290.877) (-293.349) [-290.026] (-289.522) * (-289.651) (-289.341) [-290.338] (-291.073) -- 0:00:29
493000 -- (-290.433) (-292.416) [-289.913] (-289.239) * (-289.629) [-295.788] (-292.096) (-291.370) -- 0:00:29
493500 -- (-290.304) (-289.837) (-294.525) [-293.143] * (-289.609) (-291.978) (-292.402) [-289.209] -- 0:00:29
494000 -- (-290.481) [-291.588] (-294.796) (-290.169) * (-294.472) (-290.847) (-291.654) [-289.954] -- 0:00:29
494500 -- (-290.632) [-294.737] (-292.696) (-294.279) * [-290.057] (-291.204) (-291.248) (-289.967) -- 0:00:29
495000 -- [-289.798] (-289.280) (-294.757) (-290.438) * (-291.702) (-290.048) [-293.523] (-289.563) -- 0:00:29
Average standard deviation of split frequencies: 0.008554
495500 -- (-289.960) [-289.693] (-289.007) (-294.622) * [-291.195] (-290.346) (-289.353) (-290.424) -- 0:00:29
496000 -- (-291.183) (-295.386) (-292.145) [-290.448] * (-290.860) [-290.082] (-289.733) (-289.508) -- 0:00:29
496500 -- (-290.462) (-293.217) [-289.524] (-291.148) * [-289.719] (-292.819) (-290.517) (-291.045) -- 0:00:29
497000 -- (-291.962) (-294.889) (-290.845) [-292.181] * (-290.403) [-292.250] (-291.364) (-290.356) -- 0:00:29
497500 -- (-295.692) (-291.501) [-291.644] (-291.961) * (-290.362) [-289.784] (-293.958) (-291.232) -- 0:00:29
498000 -- (-290.090) (-290.261) [-290.267] (-290.648) * (-291.493) (-290.346) [-289.987] (-291.854) -- 0:00:29
498500 -- (-289.234) (-290.653) [-289.485] (-293.376) * [-291.376] (-291.804) (-291.925) (-294.459) -- 0:00:29
499000 -- (-293.860) (-294.277) [-289.085] (-289.514) * (-289.487) [-290.937] (-289.062) (-289.431) -- 0:00:29
499500 -- (-292.042) (-290.438) (-295.493) [-290.923] * (-291.841) [-290.179] (-290.050) (-290.735) -- 0:00:29
500000 -- [-289.689] (-292.827) (-293.637) (-295.518) * [-290.476] (-294.769) (-289.074) (-292.538) -- 0:00:29
Average standard deviation of split frequencies: 0.007474
500500 -- (-291.543) (-293.503) (-289.070) [-290.021] * (-289.454) (-298.526) (-289.758) [-289.692] -- 0:00:28
501000 -- (-291.597) [-289.538] (-290.698) (-289.958) * (-289.606) [-292.552] (-295.174) (-291.238) -- 0:00:28
501500 -- (-290.775) (-290.298) (-292.610) [-290.758] * (-291.181) (-290.715) (-291.618) [-289.284] -- 0:00:28
502000 -- (-288.703) (-291.991) (-289.599) [-290.219] * (-291.516) (-289.468) [-289.953] (-294.779) -- 0:00:28
502500 -- (-291.077) [-294.113] (-289.790) (-290.398) * (-289.956) [-291.566] (-289.376) (-292.906) -- 0:00:28
503000 -- (-288.905) (-292.255) [-298.358] (-293.612) * (-290.510) (-292.981) [-295.361] (-291.472) -- 0:00:28
503500 -- (-295.429) [-290.801] (-292.846) (-290.591) * (-290.173) [-292.223] (-292.730) (-294.317) -- 0:00:28
504000 -- (-291.339) (-290.678) (-291.076) [-291.857] * (-290.606) (-292.149) [-295.982] (-292.719) -- 0:00:29
504500 -- (-290.171) (-290.121) [-290.592] (-292.112) * (-292.025) [-290.384] (-291.555) (-296.600) -- 0:00:29
505000 -- (-290.589) [-289.389] (-290.071) (-292.213) * (-293.371) [-292.529] (-291.224) (-291.584) -- 0:00:29
Average standard deviation of split frequencies: 0.007220
505500 -- [-288.875] (-293.381) (-289.420) (-291.315) * (-290.154) (-292.073) (-291.244) [-293.262] -- 0:00:29
506000 -- (-289.870) (-290.852) [-291.994] (-291.754) * (-289.615) (-295.567) [-293.988] (-289.396) -- 0:00:29
506500 -- (-291.575) (-291.823) (-290.391) [-289.195] * (-292.660) (-294.009) [-291.864] (-292.940) -- 0:00:29
507000 -- [-289.722] (-292.362) (-292.536) (-290.387) * (-294.303) [-291.028] (-289.435) (-295.998) -- 0:00:29
507500 -- (-289.959) (-290.498) [-290.545] (-290.408) * [-289.869] (-289.064) (-290.051) (-293.504) -- 0:00:29
508000 -- (-293.063) [-289.853] (-290.246) (-294.192) * [-290.295] (-291.887) (-291.177) (-300.863) -- 0:00:29
508500 -- (-290.896) (-292.011) (-291.111) [-297.411] * [-293.156] (-293.528) (-291.093) (-290.898) -- 0:00:28
509000 -- (-290.055) (-295.033) (-291.884) [-291.741] * (-297.270) (-292.780) (-288.800) [-289.452] -- 0:00:28
509500 -- (-290.863) [-295.972] (-291.384) (-292.272) * (-291.842) (-295.075) [-291.528] (-289.494) -- 0:00:28
510000 -- [-291.582] (-289.796) (-290.385) (-290.261) * [-293.104] (-290.768) (-298.431) (-290.596) -- 0:00:28
Average standard deviation of split frequencies: 0.007096
510500 -- (-290.260) [-293.539] (-291.570) (-290.407) * [-291.906] (-293.715) (-292.209) (-290.432) -- 0:00:28
511000 -- [-290.099] (-294.520) (-290.855) (-296.472) * (-291.451) (-292.191) (-293.534) [-289.200] -- 0:00:28
511500 -- (-293.892) (-291.938) (-289.924) [-292.526] * (-291.784) (-293.315) (-290.243) [-290.614] -- 0:00:28
512000 -- (-289.334) (-289.949) (-291.495) [-290.947] * (-290.653) (-290.471) [-290.417] (-294.359) -- 0:00:28
512500 -- (-289.915) (-297.780) [-289.278] (-292.672) * (-290.251) (-291.567) [-291.373] (-291.458) -- 0:00:28
513000 -- (-293.652) (-290.193) (-293.250) [-289.965] * (-290.848) (-289.940) [-291.427] (-289.450) -- 0:00:28
513500 -- (-293.592) [-291.761] (-295.460) (-291.854) * (-290.384) [-292.509] (-289.468) (-289.863) -- 0:00:28
514000 -- (-290.985) [-290.455] (-292.173) (-290.315) * (-297.345) (-290.790) (-290.256) [-289.049] -- 0:00:28
514500 -- (-291.212) (-292.023) [-290.127] (-291.586) * (-291.169) (-290.597) [-289.933] (-292.134) -- 0:00:28
515000 -- (-291.275) [-293.026] (-289.291) (-291.212) * (-290.316) (-294.067) [-290.601] (-292.942) -- 0:00:28
Average standard deviation of split frequencies: 0.007080
515500 -- [-292.323] (-295.096) (-291.624) (-294.068) * [-290.175] (-291.756) (-290.795) (-290.595) -- 0:00:28
516000 -- [-290.525] (-289.633) (-292.114) (-289.905) * (-289.536) (-292.960) (-291.643) [-290.085] -- 0:00:28
516500 -- (-293.321) (-294.194) (-290.781) [-291.429] * (-289.900) (-297.086) (-291.222) [-291.705] -- 0:00:28
517000 -- [-288.961] (-289.524) (-294.626) (-290.659) * [-291.213] (-293.766) (-294.893) (-297.126) -- 0:00:28
517500 -- [-289.960] (-295.508) (-291.182) (-290.264) * (-290.954) (-291.665) [-291.292] (-292.122) -- 0:00:27
518000 -- [-289.035] (-292.452) (-290.985) (-290.541) * [-290.498] (-293.021) (-289.872) (-294.116) -- 0:00:27
518500 -- (-291.065) (-290.380) (-289.823) [-289.910] * (-292.236) (-291.747) (-291.783) [-290.841] -- 0:00:27
519000 -- [-290.385] (-291.233) (-293.140) (-292.861) * [-289.924] (-291.213) (-291.945) (-292.535) -- 0:00:27
519500 -- (-288.723) (-292.912) (-295.979) [-291.961] * [-291.812] (-291.667) (-292.878) (-292.944) -- 0:00:27
520000 -- [-292.384] (-292.367) (-290.588) (-293.837) * (-291.010) (-292.211) (-291.245) [-291.315] -- 0:00:27
Average standard deviation of split frequencies: 0.007017
520500 -- (-289.871) (-289.921) (-292.878) [-291.131] * [-293.581] (-290.863) (-292.086) (-291.622) -- 0:00:27
521000 -- (-291.085) [-291.481] (-289.566) (-290.223) * [-291.688] (-290.168) (-292.502) (-289.334) -- 0:00:28
521500 -- (-290.453) (-291.290) [-291.279] (-289.663) * (-293.779) [-291.310] (-300.403) (-290.484) -- 0:00:28
522000 -- (-289.799) (-290.532) (-291.235) [-290.779] * (-290.482) (-292.248) [-291.259] (-293.906) -- 0:00:28
522500 -- (-290.659) (-289.582) [-290.317] (-292.546) * (-289.231) (-291.504) [-289.827] (-296.107) -- 0:00:28
523000 -- (-289.374) [-289.569] (-290.871) (-292.031) * (-289.594) (-290.089) (-297.318) [-291.128] -- 0:00:28
523500 -- [-290.677] (-291.315) (-292.889) (-296.151) * (-290.337) [-289.461] (-292.861) (-290.069) -- 0:00:28
524000 -- [-290.378] (-291.094) (-291.476) (-290.338) * (-289.947) (-291.346) [-295.410] (-294.862) -- 0:00:28
524500 -- (-290.715) [-291.303] (-289.714) (-293.728) * [-289.129] (-290.065) (-292.272) (-289.592) -- 0:00:28
525000 -- (-289.382) (-290.756) (-290.092) [-292.335] * [-290.162] (-290.710) (-294.749) (-293.662) -- 0:00:28
Average standard deviation of split frequencies: 0.007506
525500 -- (-290.417) [-290.710] (-290.923) (-290.503) * (-291.016) [-290.107] (-291.424) (-291.425) -- 0:00:27
526000 -- (-290.570) [-292.265] (-291.750) (-290.608) * (-292.970) (-291.597) (-289.419) [-292.124] -- 0:00:27
526500 -- (-290.585) (-292.852) [-293.113] (-293.817) * (-290.379) [-291.190] (-289.249) (-291.581) -- 0:00:27
527000 -- [-292.113] (-290.138) (-293.069) (-291.610) * (-292.704) (-292.906) (-291.913) [-289.360] -- 0:00:27
527500 -- (-292.189) (-292.408) [-290.752] (-291.603) * (-291.087) (-293.867) (-290.506) [-291.464] -- 0:00:27
528000 -- (-289.902) (-294.701) (-290.280) [-290.733] * (-290.029) [-291.646] (-292.064) (-289.677) -- 0:00:27
528500 -- [-292.915] (-291.393) (-292.888) (-289.145) * (-290.521) (-290.502) (-292.629) [-289.161] -- 0:00:27
529000 -- [-291.205] (-292.612) (-292.591) (-289.590) * (-291.051) (-291.957) (-292.179) [-289.438] -- 0:00:27
529500 -- (-292.428) [-291.659] (-290.366) (-292.428) * (-292.238) (-290.985) (-291.880) [-292.973] -- 0:00:27
530000 -- (-292.305) (-293.076) [-289.085] (-292.415) * (-292.528) [-289.256] (-295.143) (-290.467) -- 0:00:27
Average standard deviation of split frequencies: 0.007107
530500 -- (-291.576) [-291.679] (-294.431) (-290.696) * [-290.120] (-290.302) (-292.254) (-291.176) -- 0:00:27
531000 -- (-293.157) [-291.835] (-295.283) (-293.316) * [-293.889] (-292.365) (-292.914) (-293.816) -- 0:00:27
531500 -- [-295.768] (-290.427) (-293.103) (-297.072) * (-290.242) (-289.259) (-293.158) [-290.324] -- 0:00:27
532000 -- (-293.503) (-290.582) (-291.058) [-292.575] * (-290.082) (-293.018) [-289.384] (-292.471) -- 0:00:27
532500 -- (-291.236) (-292.027) (-292.671) [-291.218] * (-289.733) [-290.297] (-289.810) (-290.108) -- 0:00:27
533000 -- (-289.466) (-290.403) [-295.126] (-290.047) * (-290.959) [-291.884] (-292.025) (-293.824) -- 0:00:27
533500 -- (-290.239) [-292.358] (-291.868) (-289.155) * (-293.264) (-298.200) [-291.815] (-292.635) -- 0:00:27
534000 -- (-294.086) (-294.238) [-291.669] (-292.336) * (-292.075) [-295.164] (-291.586) (-294.967) -- 0:00:27
534500 -- [-294.008] (-292.414) (-290.674) (-291.539) * (-290.157) (-290.533) [-293.321] (-289.882) -- 0:00:26
535000 -- (-297.242) (-291.050) [-289.638] (-291.387) * [-290.298] (-292.829) (-292.543) (-289.009) -- 0:00:26
Average standard deviation of split frequencies: 0.007036
535500 -- (-292.429) (-289.413) [-289.714] (-290.425) * (-289.817) (-292.842) (-291.575) [-289.324] -- 0:00:26
536000 -- (-290.868) (-289.827) (-289.910) [-289.423] * (-290.335) (-294.383) [-292.592] (-291.679) -- 0:00:26
536500 -- (-292.785) [-292.213] (-289.297) (-290.006) * (-293.615) (-290.401) [-290.951] (-292.303) -- 0:00:26
537000 -- [-290.584] (-290.205) (-288.922) (-289.470) * [-289.943] (-291.140) (-294.403) (-290.557) -- 0:00:26
537500 -- (-289.162) [-292.513] (-289.831) (-290.421) * [-291.013] (-291.225) (-293.679) (-290.679) -- 0:00:26
538000 -- [-292.469] (-292.693) (-290.515) (-290.454) * [-289.484] (-292.654) (-293.379) (-290.497) -- 0:00:26
538500 -- (-291.198) (-293.099) [-291.582] (-290.468) * (-290.826) (-291.222) (-291.234) [-290.031] -- 0:00:27
539000 -- [-290.460] (-290.546) (-295.521) (-289.802) * (-289.187) (-292.695) (-294.547) [-291.525] -- 0:00:27
539500 -- (-290.449) (-292.333) (-290.659) [-289.885] * (-289.736) (-293.669) [-292.112] (-289.804) -- 0:00:27
540000 -- [-291.758] (-297.155) (-294.362) (-291.054) * [-291.669] (-293.506) (-290.228) (-291.729) -- 0:00:27
Average standard deviation of split frequencies: 0.007030
540500 -- (-290.995) (-289.741) [-291.276] (-293.834) * [-291.306] (-294.742) (-290.101) (-294.322) -- 0:00:27
541000 -- (-291.270) (-291.486) (-291.061) [-294.085] * (-293.481) (-289.193) (-290.446) [-291.201] -- 0:00:27
541500 -- (-290.823) (-290.615) (-291.184) [-292.436] * [-290.313] (-289.264) (-294.155) (-293.030) -- 0:00:27
542000 -- (-292.816) (-292.473) [-291.481] (-291.990) * (-289.987) [-289.595] (-289.945) (-294.358) -- 0:00:27
542500 -- [-290.847] (-292.598) (-294.909) (-291.274) * (-291.481) [-289.552] (-296.375) (-292.828) -- 0:00:26
543000 -- (-291.128) (-291.222) (-290.570) [-293.202] * (-289.760) (-291.057) [-292.364] (-291.078) -- 0:00:26
543500 -- (-290.702) (-289.133) [-290.724] (-293.045) * [-290.082] (-294.538) (-289.437) (-290.681) -- 0:00:26
544000 -- (-289.675) [-291.052] (-291.614) (-291.151) * [-290.147] (-293.619) (-289.994) (-289.632) -- 0:00:26
544500 -- (-292.164) (-290.351) [-292.115] (-292.747) * [-294.582] (-291.382) (-291.247) (-290.361) -- 0:00:26
545000 -- (-295.101) (-295.015) [-293.535] (-291.807) * (-291.647) [-290.320] (-289.700) (-291.288) -- 0:00:26
Average standard deviation of split frequencies: 0.006799
545500 -- (-289.281) (-290.797) (-290.871) [-290.063] * (-292.504) [-293.318] (-289.500) (-291.991) -- 0:00:26
546000 -- (-291.984) (-289.688) (-297.208) [-290.108] * (-299.144) (-290.644) (-291.278) [-292.294] -- 0:00:26
546500 -- [-294.798] (-296.450) (-292.380) (-292.162) * [-289.322] (-289.444) (-290.766) (-292.716) -- 0:00:26
547000 -- [-291.792] (-293.374) (-292.242) (-295.022) * (-289.162) (-289.749) [-289.318] (-294.697) -- 0:00:26
547500 -- (-291.315) [-291.448] (-293.304) (-293.161) * (-291.204) (-289.255) (-291.025) [-292.156] -- 0:00:26
548000 -- (-289.710) (-297.554) [-293.729] (-292.575) * (-290.998) [-290.351] (-290.119) (-291.004) -- 0:00:26
548500 -- (-291.299) [-290.849] (-292.247) (-288.948) * [-289.959] (-291.578) (-290.092) (-291.863) -- 0:00:26
549000 -- (-290.767) (-289.367) (-292.367) [-290.435] * (-291.310) (-290.059) (-291.122) [-290.803] -- 0:00:26
549500 -- [-290.525] (-294.309) (-291.717) (-291.216) * [-293.466] (-290.727) (-292.177) (-292.813) -- 0:00:26
550000 -- (-290.562) [-292.629] (-290.021) (-293.655) * (-292.533) (-294.557) (-290.368) [-291.070] -- 0:00:26
Average standard deviation of split frequencies: 0.007170
550500 -- (-292.293) [-291.885] (-291.246) (-292.021) * (-290.180) (-290.863) (-292.892) [-291.007] -- 0:00:26
551000 -- (-292.103) (-290.555) [-289.348] (-291.632) * (-290.428) [-293.089] (-292.486) (-290.511) -- 0:00:26
551500 -- (-290.416) (-291.176) (-289.073) [-292.473] * (-290.879) [-290.184] (-291.949) (-293.571) -- 0:00:26
552000 -- (-289.910) (-289.935) [-290.670] (-294.524) * [-290.117] (-289.711) (-290.975) (-290.605) -- 0:00:25
552500 -- (-289.975) (-289.825) [-289.950] (-291.034) * [-293.437] (-291.356) (-290.470) (-290.883) -- 0:00:25
553000 -- (-289.715) [-294.313] (-289.053) (-291.360) * (-293.236) (-290.913) [-289.305] (-293.430) -- 0:00:25
553500 -- (-293.451) [-293.748] (-292.444) (-291.221) * (-292.772) [-289.141] (-291.690) (-303.876) -- 0:00:25
554000 -- [-290.934] (-290.540) (-292.179) (-292.254) * (-298.875) (-291.672) (-292.782) [-294.832] -- 0:00:25
554500 -- (-289.618) [-291.224] (-292.564) (-295.003) * [-290.757] (-290.905) (-290.203) (-292.611) -- 0:00:25
555000 -- (-290.933) (-292.366) (-289.146) [-291.510] * (-295.432) (-289.780) [-291.238] (-290.435) -- 0:00:25
Average standard deviation of split frequencies: 0.007313
555500 -- (-288.967) (-291.215) [-292.060] (-294.134) * [-294.130] (-289.457) (-292.901) (-291.204) -- 0:00:26
556000 -- [-289.547] (-290.762) (-290.260) (-289.546) * (-290.526) (-292.871) [-290.695] (-291.002) -- 0:00:26
556500 -- (-290.626) [-292.220] (-292.982) (-289.352) * (-289.956) (-289.977) (-291.316) [-290.692] -- 0:00:26
557000 -- [-292.274] (-289.987) (-290.151) (-291.876) * (-292.654) [-293.583] (-293.398) (-291.860) -- 0:00:26
557500 -- [-291.963] (-290.285) (-294.534) (-290.484) * (-292.499) (-292.395) [-290.202] (-291.869) -- 0:00:26
558000 -- [-292.341] (-291.578) (-291.044) (-290.172) * (-289.985) (-291.847) [-290.724] (-290.025) -- 0:00:26
558500 -- (-291.328) (-290.318) (-289.809) [-290.687] * (-292.439) (-293.973) [-290.003] (-294.812) -- 0:00:26
559000 -- (-296.103) (-290.600) (-292.846) [-292.117] * [-290.550] (-296.080) (-292.711) (-290.402) -- 0:00:26
559500 -- (-296.510) (-292.147) [-290.032] (-292.455) * (-292.496) (-291.654) (-293.411) [-291.289] -- 0:00:25
560000 -- [-290.837] (-292.254) (-290.522) (-291.531) * (-294.227) (-290.657) [-289.658] (-291.366) -- 0:00:25
Average standard deviation of split frequencies: 0.007462
560500 -- (-294.102) (-292.779) [-292.331] (-291.063) * (-293.746) (-292.659) (-291.008) [-290.232] -- 0:00:25
561000 -- [-289.894] (-291.542) (-290.324) (-290.822) * (-290.748) (-291.173) [-289.746] (-290.501) -- 0:00:25
561500 -- (-296.094) (-290.702) [-289.271] (-292.995) * [-289.592] (-290.013) (-291.406) (-291.566) -- 0:00:25
562000 -- (-289.460) (-292.519) [-290.723] (-291.051) * [-290.041] (-291.435) (-293.214) (-291.826) -- 0:00:25
562500 -- (-289.313) (-292.307) (-290.693) [-291.669] * (-293.323) (-291.541) [-290.211] (-290.254) -- 0:00:25
563000 -- (-290.394) (-290.925) [-294.591] (-292.043) * (-291.377) [-292.273] (-292.588) (-292.310) -- 0:00:25
563500 -- [-289.537] (-289.344) (-296.796) (-291.826) * (-293.385) [-291.883] (-292.380) (-293.936) -- 0:00:25
564000 -- (-294.625) (-293.705) [-289.485] (-291.222) * (-290.970) [-291.845] (-289.754) (-290.388) -- 0:00:25
564500 -- (-291.485) (-291.937) [-289.667] (-293.373) * (-292.392) (-289.425) (-290.389) [-290.209] -- 0:00:25
565000 -- (-290.660) (-291.383) (-290.163) [-293.596] * (-293.321) (-292.361) [-288.953] (-293.043) -- 0:00:25
Average standard deviation of split frequencies: 0.007184
565500 -- (-289.862) (-291.078) (-290.322) [-292.824] * (-291.273) (-289.631) (-291.602) [-290.781] -- 0:00:25
566000 -- [-290.859] (-289.565) (-292.022) (-294.320) * (-289.660) (-291.589) [-294.937] (-292.769) -- 0:00:25
566500 -- [-288.808] (-290.659) (-291.850) (-290.643) * (-290.452) [-290.607] (-290.748) (-295.611) -- 0:00:25
567000 -- (-293.391) [-290.662] (-293.066) (-290.588) * [-289.900] (-290.174) (-289.388) (-292.262) -- 0:00:25
567500 -- (-292.833) (-290.451) [-289.697] (-292.312) * (-289.562) (-292.051) (-291.196) [-289.948] -- 0:00:25
568000 -- (-292.416) (-295.824) (-293.306) [-290.698] * [-289.585] (-294.032) (-289.222) (-290.761) -- 0:00:25
568500 -- [-292.951] (-293.524) (-292.833) (-289.709) * (-293.132) (-289.828) (-292.192) [-289.547] -- 0:00:25
569000 -- (-290.618) [-289.208] (-290.897) (-291.754) * (-289.201) [-290.071] (-295.095) (-289.612) -- 0:00:24
569500 -- [-289.335] (-291.537) (-290.382) (-293.309) * (-294.125) [-289.741] (-294.918) (-290.521) -- 0:00:24
570000 -- (-291.011) (-291.929) (-290.086) [-289.402] * (-295.082) (-291.221) (-291.640) [-290.331] -- 0:00:24
Average standard deviation of split frequencies: 0.007331
570500 -- [-290.986] (-290.614) (-295.113) (-289.736) * (-293.203) (-292.351) (-292.116) [-289.753] -- 0:00:24
571000 -- (-291.162) (-289.394) (-291.450) [-290.988] * [-292.123] (-293.093) (-289.745) (-291.178) -- 0:00:24
571500 -- (-294.281) [-292.772] (-291.118) (-292.751) * (-291.140) (-290.159) [-290.590] (-292.417) -- 0:00:24
572000 -- [-290.072] (-290.757) (-289.261) (-292.028) * (-291.597) (-292.368) (-293.317) [-289.380] -- 0:00:24
572500 -- [-289.904] (-289.780) (-291.503) (-289.156) * (-291.641) [-290.355] (-293.226) (-289.915) -- 0:00:25
573000 -- (-294.901) (-289.898) [-291.852] (-290.535) * (-292.711) (-290.724) (-291.048) [-289.070] -- 0:00:25
573500 -- (-289.920) [-291.239] (-291.351) (-293.214) * (-291.965) (-290.594) (-293.244) [-291.872] -- 0:00:25
574000 -- [-290.457] (-293.874) (-289.688) (-297.241) * [-295.244] (-290.748) (-290.542) (-297.888) -- 0:00:25
574500 -- (-291.893) (-293.509) [-290.074] (-289.966) * (-293.028) (-290.982) (-290.103) [-291.746] -- 0:00:25
575000 -- (-289.024) (-289.268) (-290.455) [-291.940] * (-289.640) (-292.625) (-293.446) [-290.833] -- 0:00:25
Average standard deviation of split frequencies: 0.007826
575500 -- (-291.272) (-290.401) (-288.994) [-292.560] * (-291.313) (-295.547) (-293.433) [-290.711] -- 0:00:25
576000 -- (-292.917) (-290.669) [-289.620] (-290.728) * (-290.698) [-291.280] (-293.187) (-291.512) -- 0:00:25
576500 -- [-292.598] (-290.906) (-293.749) (-292.576) * (-291.153) [-290.202] (-294.667) (-290.606) -- 0:00:24
577000 -- (-289.930) (-290.474) (-294.009) [-290.618] * (-292.936) (-293.072) (-290.536) [-289.890] -- 0:00:24
577500 -- (-290.097) [-289.319] (-292.464) (-290.868) * (-289.455) (-290.353) (-289.920) [-289.103] -- 0:00:24
578000 -- [-292.777] (-289.698) (-292.012) (-292.204) * [-290.189] (-289.365) (-290.587) (-290.747) -- 0:00:24
578500 -- (-290.206) (-290.203) (-293.338) [-293.205] * (-295.248) (-291.965) (-290.442) [-291.675] -- 0:00:24
579000 -- (-295.707) [-291.742] (-300.065) (-289.496) * (-292.231) [-292.150] (-290.341) (-290.459) -- 0:00:24
579500 -- [-290.432] (-290.273) (-290.764) (-293.489) * (-290.784) [-290.596] (-291.857) (-290.437) -- 0:00:24
580000 -- (-292.323) [-290.260] (-292.643) (-290.950) * (-289.388) (-289.903) [-290.277] (-292.051) -- 0:00:24
Average standard deviation of split frequencies: 0.007509
580500 -- (-293.197) [-289.299] (-291.462) (-290.545) * (-290.567) (-291.056) [-290.622] (-290.871) -- 0:00:24
581000 -- (-290.720) (-292.406) [-289.486] (-291.684) * (-292.173) [-289.556] (-289.312) (-293.085) -- 0:00:24
581500 -- [-291.733] (-296.310) (-295.199) (-289.613) * (-289.939) [-290.555] (-290.014) (-298.279) -- 0:00:24
582000 -- (-295.555) (-295.146) (-291.011) [-290.019] * (-291.999) [-289.437] (-293.917) (-292.201) -- 0:00:24
582500 -- (-290.691) [-291.106] (-291.267) (-290.183) * (-289.873) (-291.730) (-297.371) [-295.559] -- 0:00:24
583000 -- [-290.998] (-289.837) (-292.454) (-290.506) * (-292.784) (-292.513) [-291.690] (-291.837) -- 0:00:24
583500 -- (-290.248) (-292.819) [-291.153] (-290.184) * (-292.907) (-292.945) [-295.469] (-292.349) -- 0:00:24
584000 -- [-290.747] (-294.509) (-290.537) (-292.723) * (-291.921) (-291.925) (-290.797) [-289.762] -- 0:00:24
584500 -- (-291.376) (-291.222) (-289.022) [-294.356] * (-293.774) (-290.431) (-297.802) [-292.949] -- 0:00:24
585000 -- [-291.291] (-290.436) (-290.582) (-290.545) * (-294.965) (-290.258) [-292.754] (-290.777) -- 0:00:24
Average standard deviation of split frequencies: 0.007592
585500 -- [-292.057] (-293.134) (-290.064) (-294.629) * (-292.169) (-294.737) [-289.362] (-293.651) -- 0:00:24
586000 -- (-294.699) [-292.227] (-292.795) (-289.568) * (-291.004) (-290.679) (-294.281) [-293.635] -- 0:00:24
586500 -- (-292.626) (-291.583) (-292.187) [-289.128] * (-292.603) [-292.264] (-290.877) (-294.127) -- 0:00:23
587000 -- (-295.918) (-289.120) [-289.882] (-289.812) * [-292.902] (-290.476) (-291.133) (-290.391) -- 0:00:23
587500 -- (-290.958) (-290.491) [-292.620] (-290.222) * (-291.984) [-290.659] (-291.041) (-290.346) -- 0:00:23
588000 -- [-292.654] (-291.044) (-292.365) (-292.404) * [-291.082] (-290.373) (-291.952) (-290.317) -- 0:00:23
588500 -- [-291.635] (-293.147) (-290.915) (-292.099) * (-293.008) (-290.705) (-293.651) [-291.335] -- 0:00:23
589000 -- (-291.263) (-291.421) [-290.840] (-289.649) * (-291.172) (-294.445) [-292.125] (-291.649) -- 0:00:23
589500 -- [-291.838] (-290.293) (-292.607) (-290.282) * [-290.729] (-294.516) (-290.747) (-291.571) -- 0:00:24
590000 -- (-291.382) (-290.416) (-292.846) [-291.792] * [-293.560] (-293.290) (-292.227) (-290.927) -- 0:00:24
Average standard deviation of split frequencies: 0.007382
590500 -- [-290.366] (-290.518) (-291.582) (-289.194) * (-295.031) (-290.786) (-290.105) [-293.401] -- 0:00:24
591000 -- (-292.183) (-290.412) [-290.690] (-289.169) * (-293.275) (-291.171) [-294.858] (-291.282) -- 0:00:24
591500 -- (-289.896) (-291.533) [-291.485] (-291.410) * (-294.040) (-289.471) [-294.970] (-290.881) -- 0:00:24
592000 -- (-291.796) (-291.592) [-292.103] (-296.868) * (-291.203) (-289.702) [-292.221] (-291.337) -- 0:00:24
592500 -- (-290.483) [-289.594] (-289.495) (-289.766) * (-289.170) (-289.045) [-291.238] (-294.732) -- 0:00:24
593000 -- (-291.064) [-290.184] (-289.125) (-293.968) * [-292.307] (-291.373) (-290.366) (-292.049) -- 0:00:24
593500 -- (-292.939) (-290.738) (-290.124) [-290.860] * [-290.488] (-289.485) (-290.904) (-291.979) -- 0:00:23
594000 -- (-290.983) (-289.874) [-290.002] (-290.850) * (-292.523) (-295.557) (-289.864) [-289.883] -- 0:00:23
594500 -- (-290.170) (-292.757) [-292.618] (-292.765) * [-291.292] (-289.981) (-289.947) (-289.154) -- 0:00:23
595000 -- (-291.637) (-292.615) (-289.779) [-290.106] * (-289.564) (-293.411) (-293.796) [-290.981] -- 0:00:23
Average standard deviation of split frequencies: 0.008058
595500 -- (-293.619) [-291.458] (-288.986) (-292.939) * (-289.184) (-291.221) [-289.984] (-292.365) -- 0:00:23
596000 -- [-289.275] (-289.685) (-293.252) (-293.032) * [-291.673] (-290.219) (-291.353) (-290.561) -- 0:00:23
596500 -- (-289.414) (-296.566) (-298.942) [-290.941] * [-292.272] (-288.921) (-292.840) (-289.536) -- 0:00:23
597000 -- [-292.052] (-289.919) (-294.002) (-292.926) * (-295.257) (-291.316) (-293.353) [-292.906] -- 0:00:23
597500 -- (-290.440) [-291.800] (-290.767) (-289.961) * (-290.947) [-289.999] (-290.382) (-293.539) -- 0:00:23
598000 -- (-291.559) (-293.233) [-289.079] (-294.304) * (-291.849) (-291.730) (-294.222) [-293.424] -- 0:00:23
598500 -- (-289.590) (-294.432) [-289.141] (-294.043) * (-291.750) (-290.276) [-294.371] (-295.477) -- 0:00:23
599000 -- (-291.004) [-289.866] (-291.203) (-290.476) * (-291.326) [-290.187] (-292.095) (-295.470) -- 0:00:23
599500 -- (-290.289) (-291.305) [-290.368] (-290.350) * (-291.824) [-290.349] (-292.862) (-293.800) -- 0:00:23
600000 -- (-290.502) (-292.718) (-293.558) [-290.390] * (-290.922) (-289.750) (-292.210) [-290.375] -- 0:00:23
Average standard deviation of split frequencies: 0.008437
600500 -- (-293.481) [-293.214] (-291.303) (-292.232) * (-291.496) (-291.106) (-289.569) [-290.113] -- 0:00:23
601000 -- (-291.506) [-291.277] (-289.611) (-291.862) * [-295.042] (-290.369) (-290.597) (-290.029) -- 0:00:23
601500 -- (-291.579) (-291.093) (-297.556) [-291.116] * (-291.294) [-291.054] (-290.273) (-289.569) -- 0:00:23
602000 -- [-291.160] (-289.570) (-292.855) (-293.338) * (-289.389) (-291.230) (-290.856) [-292.223] -- 0:00:23
602500 -- (-288.996) (-293.171) [-293.220] (-290.498) * (-297.166) (-292.195) [-290.466] (-291.810) -- 0:00:23
603000 -- (-288.957) (-292.251) [-289.732] (-289.642) * (-291.144) (-291.989) (-291.195) [-292.334] -- 0:00:23
603500 -- [-289.431] (-289.839) (-288.969) (-289.553) * (-289.856) [-290.669] (-289.720) (-295.295) -- 0:00:22
604000 -- (-290.682) (-289.572) (-290.449) [-290.309] * (-290.049) [-292.114] (-296.801) (-289.991) -- 0:00:22
604500 -- (-289.478) [-291.994] (-290.228) (-292.041) * (-290.846) (-290.657) (-295.856) [-290.378] -- 0:00:22
605000 -- [-290.159] (-290.055) (-295.202) (-289.502) * (-292.758) (-289.530) [-289.490] (-292.044) -- 0:00:22
Average standard deviation of split frequencies: 0.009189
605500 -- [-289.649] (-297.254) (-296.578) (-292.271) * (-290.155) [-290.451] (-292.771) (-293.027) -- 0:00:22
606000 -- (-294.654) (-289.617) (-295.333) [-289.970] * [-291.030] (-295.730) (-292.186) (-289.506) -- 0:00:22
606500 -- (-290.758) (-291.435) (-292.158) [-289.713] * [-289.683] (-290.378) (-292.556) (-290.123) -- 0:00:22
607000 -- [-289.670] (-291.916) (-289.305) (-290.614) * [-291.893] (-291.532) (-289.509) (-289.685) -- 0:00:23
607500 -- (-289.823) [-292.105] (-291.907) (-292.044) * [-289.411] (-290.499) (-293.004) (-294.053) -- 0:00:23
608000 -- (-290.206) (-295.876) [-290.637] (-289.649) * (-292.852) [-291.505] (-293.361) (-293.458) -- 0:00:23
608500 -- (-291.573) (-290.765) [-291.622] (-289.798) * (-292.042) (-292.660) [-291.488] (-289.968) -- 0:00:23
609000 -- (-293.817) (-291.458) [-290.257] (-291.100) * (-290.333) (-290.929) (-290.184) [-289.312] -- 0:00:23
609500 -- (-289.785) (-292.076) (-292.925) [-289.723] * [-289.851] (-294.623) (-290.641) (-291.282) -- 0:00:23
610000 -- (-289.659) (-294.516) [-291.122] (-291.384) * (-289.967) (-289.018) [-290.399] (-289.471) -- 0:00:23
Average standard deviation of split frequencies: 0.009215
610500 -- (-292.905) [-289.375] (-294.192) (-295.057) * (-290.717) (-292.437) [-289.654] (-289.442) -- 0:00:22
611000 -- (-293.906) (-289.105) [-291.474] (-290.648) * (-291.829) (-290.804) [-291.188] (-293.877) -- 0:00:22
611500 -- [-292.197] (-289.932) (-290.959) (-291.707) * (-293.076) (-290.263) (-293.348) [-293.499] -- 0:00:22
612000 -- [-290.802] (-289.862) (-291.057) (-290.961) * [-293.214] (-292.313) (-291.907) (-289.450) -- 0:00:22
612500 -- [-290.707] (-289.994) (-291.732) (-290.098) * (-292.278) (-294.910) [-292.069] (-290.248) -- 0:00:22
613000 -- (-290.173) (-290.184) [-293.869] (-293.323) * (-292.766) (-294.706) (-292.011) [-290.160] -- 0:00:22
613500 -- (-290.631) (-292.468) (-290.472) [-291.332] * [-291.018] (-292.859) (-289.160) (-289.979) -- 0:00:22
614000 -- (-290.275) (-290.158) (-291.902) [-289.079] * [-291.436] (-290.864) (-290.502) (-290.202) -- 0:00:22
614500 -- [-289.910] (-295.054) (-291.951) (-288.797) * [-290.586] (-294.168) (-290.235) (-289.651) -- 0:00:22
615000 -- (-295.228) [-294.190] (-290.887) (-290.885) * (-290.322) (-294.311) (-292.342) [-291.163] -- 0:00:22
Average standard deviation of split frequencies: 0.009279
615500 -- (-293.262) (-290.327) (-290.895) [-289.436] * (-290.228) [-301.055] (-292.054) (-294.157) -- 0:00:22
616000 -- (-290.175) [-290.912] (-289.100) (-290.516) * (-291.265) (-291.526) [-290.223] (-290.627) -- 0:00:22
616500 -- (-292.861) [-289.723] (-289.589) (-291.744) * (-290.160) [-289.142] (-289.553) (-288.887) -- 0:00:22
617000 -- (-290.535) [-290.091] (-290.498) (-291.568) * [-294.514] (-291.546) (-290.986) (-291.051) -- 0:00:22
617500 -- (-292.273) (-290.051) [-290.596] (-291.411) * (-293.483) [-292.016] (-291.122) (-290.915) -- 0:00:22
618000 -- (-291.796) [-291.068] (-289.836) (-289.646) * (-295.154) [-290.436] (-290.646) (-290.849) -- 0:00:22
618500 -- (-293.315) (-290.137) [-291.293] (-292.334) * (-292.772) (-289.993) [-290.482] (-291.122) -- 0:00:22
619000 -- (-293.474) [-292.870] (-292.218) (-289.655) * [-292.977] (-292.033) (-289.221) (-290.469) -- 0:00:22
619500 -- (-290.594) (-289.587) (-290.996) [-291.324] * (-290.144) (-289.151) [-290.847] (-289.879) -- 0:00:22
620000 -- (-290.981) (-289.418) (-290.905) [-290.484] * (-291.032) [-290.112] (-292.467) (-291.813) -- 0:00:22
Average standard deviation of split frequencies: 0.009541
620500 -- [-290.167] (-289.686) (-294.468) (-291.857) * (-290.261) [-289.316] (-291.315) (-289.932) -- 0:00:22
621000 -- (-289.879) [-290.613] (-289.394) (-291.346) * [-289.340] (-289.212) (-289.843) (-293.926) -- 0:00:21
621500 -- (-289.858) (-292.655) [-289.518] (-291.956) * (-292.054) [-290.432] (-289.631) (-290.442) -- 0:00:21
622000 -- (-289.554) (-292.211) [-289.106] (-294.493) * (-289.966) (-289.683) (-293.999) [-291.051] -- 0:00:21
622500 -- (-290.247) [-290.879] (-292.088) (-289.201) * [-290.047] (-291.514) (-294.629) (-289.904) -- 0:00:21
623000 -- [-291.071] (-290.191) (-299.432) (-290.320) * [-290.202] (-291.584) (-292.544) (-291.180) -- 0:00:21
623500 -- [-289.761] (-291.996) (-297.299) (-294.345) * (-291.006) (-292.087) [-290.866] (-295.659) -- 0:00:21
624000 -- (-292.889) [-290.422] (-296.572) (-291.000) * [-290.554] (-291.124) (-294.660) (-292.159) -- 0:00:22
624500 -- (-291.336) (-291.895) (-292.840) [-290.628] * (-291.653) (-289.746) [-292.349] (-289.424) -- 0:00:22
625000 -- (-289.565) (-293.836) (-288.889) [-291.244] * (-291.778) (-289.882) [-290.646] (-290.470) -- 0:00:22
Average standard deviation of split frequencies: 0.008754
625500 -- [-297.322] (-289.633) (-289.666) (-291.402) * (-289.433) [-290.459] (-289.916) (-291.731) -- 0:00:22
626000 -- [-289.863] (-289.612) (-292.024) (-289.924) * (-291.268) [-292.552] (-289.891) (-289.377) -- 0:00:22
626500 -- (-290.365) (-291.182) [-293.824] (-292.177) * (-294.119) (-293.410) [-292.080] (-290.752) -- 0:00:22
627000 -- (-292.418) (-290.126) (-297.211) [-290.456] * (-290.681) (-290.139) (-289.528) [-294.284] -- 0:00:22
627500 -- (-292.778) (-288.896) [-291.154] (-291.665) * [-290.165] (-292.007) (-289.834) (-290.271) -- 0:00:21
628000 -- (-291.995) [-291.761] (-291.061) (-291.196) * (-288.876) (-290.526) (-290.508) [-289.576] -- 0:00:21
628500 -- [-289.633] (-292.711) (-293.333) (-292.554) * [-289.214] (-290.204) (-291.874) (-291.324) -- 0:00:21
629000 -- [-291.308] (-291.580) (-291.457) (-291.993) * (-293.437) [-289.411] (-291.518) (-291.081) -- 0:00:21
629500 -- (-291.565) (-289.552) [-292.582] (-290.910) * (-292.913) (-291.263) [-289.410] (-291.400) -- 0:00:21
630000 -- (-291.585) [-290.742] (-291.145) (-289.737) * [-290.095] (-292.270) (-291.393) (-292.322) -- 0:00:21
Average standard deviation of split frequencies: 0.009250
630500 -- (-292.816) (-290.527) [-289.463] (-291.066) * (-295.053) (-291.158) (-293.262) [-290.453] -- 0:00:21
631000 -- [-292.196] (-291.869) (-289.978) (-292.993) * (-291.443) (-295.213) (-291.327) [-291.773] -- 0:00:21
631500 -- (-291.005) (-291.713) [-289.460] (-293.177) * (-292.263) (-294.119) [-292.156] (-290.049) -- 0:00:21
632000 -- (-290.217) (-291.446) [-289.539] (-292.625) * (-289.592) (-293.277) [-291.864] (-292.457) -- 0:00:21
632500 -- (-294.070) (-290.539) [-292.614] (-291.217) * [-289.492] (-295.286) (-289.800) (-295.898) -- 0:00:21
633000 -- (-299.261) (-290.735) (-290.479) [-289.992] * (-290.169) (-289.488) (-291.442) [-291.459] -- 0:00:21
633500 -- (-292.112) (-292.701) [-289.395] (-289.766) * (-290.441) [-290.643] (-291.350) (-290.860) -- 0:00:21
634000 -- (-294.818) (-289.737) [-290.142] (-293.782) * (-290.707) (-291.822) (-291.226) [-291.668] -- 0:00:21
634500 -- [-291.124] (-293.384) (-291.125) (-297.905) * [-290.152] (-289.270) (-290.302) (-291.811) -- 0:00:21
635000 -- (-293.355) [-290.432] (-290.849) (-291.735) * [-290.592] (-295.374) (-291.447) (-293.711) -- 0:00:21
Average standard deviation of split frequencies: 0.009543
635500 -- (-294.849) (-289.665) [-289.643] (-290.744) * (-294.102) (-292.183) [-289.988] (-294.359) -- 0:00:21
636000 -- (-291.341) (-290.932) (-289.333) [-291.727] * (-290.993) (-291.421) (-290.259) [-290.797] -- 0:00:21
636500 -- (-289.825) (-292.046) [-293.236] (-291.576) * (-290.031) (-292.858) [-291.466] (-292.406) -- 0:00:21
637000 -- [-289.446] (-299.109) (-292.820) (-293.384) * [-288.847] (-290.605) (-290.076) (-292.106) -- 0:00:21
637500 -- (-290.975) [-294.771] (-291.682) (-289.970) * [-289.557] (-289.827) (-295.260) (-291.903) -- 0:00:21
638000 -- (-289.291) [-291.427] (-290.609) (-292.818) * [-289.178] (-292.945) (-291.891) (-292.709) -- 0:00:20
638500 -- [-293.229] (-291.635) (-291.014) (-294.049) * (-289.559) [-291.074] (-291.929) (-289.243) -- 0:00:20
639000 -- [-292.008] (-291.038) (-289.717) (-292.744) * [-288.944] (-293.634) (-291.137) (-292.337) -- 0:00:20
639500 -- (-292.139) (-294.170) (-292.467) [-290.794] * (-289.794) [-292.414] (-291.079) (-292.978) -- 0:00:20
640000 -- (-291.529) (-292.234) [-291.801] (-290.789) * (-289.150) [-292.489] (-290.231) (-293.945) -- 0:00:20
Average standard deviation of split frequencies: 0.009152
640500 -- (-292.585) (-297.757) [-289.689] (-290.507) * (-292.627) (-289.612) [-290.552] (-293.546) -- 0:00:20
641000 -- (-290.354) (-289.920) [-290.374] (-289.385) * (-294.621) (-290.439) (-291.984) [-290.958] -- 0:00:21
641500 -- (-292.297) (-292.890) [-289.442] (-289.674) * [-291.615] (-291.194) (-291.700) (-294.978) -- 0:00:21
642000 -- (-290.838) (-290.271) [-290.916] (-289.860) * (-290.324) [-291.453] (-289.669) (-297.543) -- 0:00:21
642500 -- (-289.748) (-289.901) (-290.508) [-290.723] * [-290.857] (-293.023) (-292.568) (-293.356) -- 0:00:21
643000 -- (-290.431) [-290.838] (-292.136) (-291.825) * [-290.669] (-290.170) (-289.199) (-291.819) -- 0:00:21
643500 -- (-291.344) (-291.219) (-291.097) [-289.825] * (-290.816) (-290.073) (-290.467) [-290.105] -- 0:00:21
644000 -- (-291.350) (-289.200) (-291.243) [-290.041] * (-289.683) (-289.717) [-290.123] (-290.248) -- 0:00:21
644500 -- (-290.877) (-290.406) (-290.586) [-292.683] * (-291.014) (-291.995) (-290.526) [-292.752] -- 0:00:20
645000 -- (-290.373) (-293.813) [-291.340] (-291.220) * (-290.367) [-291.450] (-291.816) (-290.551) -- 0:00:20
Average standard deviation of split frequencies: 0.009122
645500 -- [-290.359] (-291.484) (-289.208) (-292.535) * (-290.834) (-291.016) [-289.363] (-290.982) -- 0:00:20
646000 -- (-293.876) (-291.580) (-290.993) [-289.199] * (-289.793) (-295.035) (-291.970) [-290.165] -- 0:00:20
646500 -- (-294.205) (-289.459) (-292.319) [-291.358] * (-289.983) (-292.364) [-291.025] (-289.660) -- 0:00:20
647000 -- [-292.069] (-295.615) (-290.907) (-290.666) * (-290.094) [-290.305] (-290.241) (-290.764) -- 0:00:20
647500 -- (-290.712) (-290.677) [-290.132] (-290.057) * (-292.946) [-292.829] (-292.323) (-294.031) -- 0:00:20
648000 -- (-293.805) (-290.455) (-290.064) [-290.962] * [-289.670] (-291.312) (-289.770) (-294.102) -- 0:00:20
648500 -- [-291.229] (-295.327) (-288.848) (-291.788) * (-290.096) (-291.269) (-291.509) [-291.087] -- 0:00:20
649000 -- (-290.382) [-295.184] (-290.435) (-290.123) * (-289.493) (-292.969) [-289.736] (-290.072) -- 0:00:20
649500 -- [-292.822] (-291.688) (-290.068) (-289.626) * (-292.431) (-289.889) (-289.781) [-290.480] -- 0:00:20
650000 -- (-290.318) [-290.971] (-295.615) (-292.731) * (-294.974) [-290.860] (-291.186) (-291.189) -- 0:00:20
Average standard deviation of split frequencies: 0.009101
650500 -- (-290.986) (-290.814) (-292.380) [-290.399] * (-290.262) (-293.595) [-291.396] (-290.174) -- 0:00:20
651000 -- (-290.829) (-291.052) [-293.004] (-289.923) * (-292.512) (-290.381) (-292.776) [-290.526] -- 0:00:20
651500 -- [-290.598] (-292.399) (-293.230) (-294.106) * (-291.841) [-290.806] (-291.388) (-289.749) -- 0:00:20
652000 -- (-290.789) (-291.725) (-291.441) [-293.106] * (-290.778) (-289.692) [-290.787] (-289.571) -- 0:00:20
652500 -- (-289.425) (-293.591) [-294.342] (-293.102) * [-293.198] (-290.078) (-291.828) (-292.737) -- 0:00:20
653000 -- [-289.972] (-291.706) (-293.843) (-298.534) * (-289.314) (-290.272) (-291.938) [-291.564] -- 0:00:20
653500 -- (-291.712) (-289.685) [-295.346] (-292.689) * [-290.829] (-295.159) (-296.026) (-289.428) -- 0:00:20
654000 -- (-289.683) (-289.718) (-292.667) [-292.284] * [-290.546] (-291.559) (-293.168) (-293.377) -- 0:00:20
654500 -- (-290.500) [-290.585] (-295.003) (-293.927) * (-293.096) (-289.801) (-290.459) [-289.347] -- 0:00:20
655000 -- [-289.958] (-292.519) (-290.786) (-292.813) * (-293.575) (-290.525) [-291.042] (-292.826) -- 0:00:20
Average standard deviation of split frequencies: 0.008713
655500 -- (-289.381) [-292.817] (-290.629) (-290.984) * (-291.952) (-289.877) [-293.000] (-290.289) -- 0:00:19
656000 -- (-291.007) (-290.797) (-291.667) [-289.442] * (-290.805) [-292.823] (-297.994) (-290.103) -- 0:00:19
656500 -- (-295.738) [-289.572] (-292.976) (-291.937) * [-292.586] (-295.582) (-292.676) (-291.374) -- 0:00:19
657000 -- (-291.752) (-288.991) [-296.418] (-295.222) * (-293.170) (-290.766) [-289.363] (-295.000) -- 0:00:19
657500 -- (-290.537) [-289.192] (-290.542) (-291.301) * [-290.781] (-294.781) (-291.499) (-291.118) -- 0:00:19
658000 -- [-291.009] (-289.594) (-298.460) (-290.659) * (-294.142) (-290.227) (-289.885) [-290.758] -- 0:00:19
658500 -- (-295.631) [-289.501] (-290.592) (-291.882) * [-290.688] (-295.119) (-289.519) (-290.227) -- 0:00:19
659000 -- [-289.630] (-291.127) (-293.523) (-290.107) * (-291.087) (-292.291) [-289.522] (-289.975) -- 0:00:20
659500 -- (-289.345) (-291.756) (-291.477) [-290.859] * [-290.766] (-289.859) (-294.173) (-289.590) -- 0:00:20
660000 -- (-289.868) (-293.419) [-295.453] (-290.202) * (-290.540) (-289.767) (-292.404) [-292.876] -- 0:00:20
Average standard deviation of split frequencies: 0.008652
660500 -- (-291.526) [-292.739] (-292.129) (-290.092) * (-289.298) (-292.519) (-290.307) [-294.968] -- 0:00:20
661000 -- (-289.701) (-289.274) (-291.406) [-290.460] * (-291.109) (-294.548) [-291.008] (-296.343) -- 0:00:20
661500 -- (-292.131) [-291.556] (-293.944) (-291.634) * (-291.287) [-290.230] (-290.735) (-293.139) -- 0:00:19
662000 -- (-290.096) (-291.515) (-290.660) [-290.433] * (-290.249) (-292.560) (-290.045) [-289.458] -- 0:00:19
662500 -- (-292.817) (-289.135) [-291.579] (-290.511) * [-292.022] (-295.642) (-291.620) (-290.389) -- 0:00:19
663000 -- [-290.492] (-292.857) (-291.918) (-292.381) * (-290.340) [-290.440] (-289.348) (-291.487) -- 0:00:19
663500 -- (-291.822) [-291.331] (-291.825) (-291.540) * (-290.335) [-289.303] (-292.509) (-290.839) -- 0:00:19
664000 -- (-290.267) (-290.100) (-291.254) [-290.808] * (-293.974) [-288.895] (-290.700) (-292.003) -- 0:00:19
664500 -- (-289.416) [-291.428] (-292.036) (-292.841) * (-290.651) (-289.654) [-293.278] (-294.206) -- 0:00:19
665000 -- (-294.046) [-290.016] (-297.282) (-292.257) * (-290.564) (-290.183) [-290.983] (-292.895) -- 0:00:19
Average standard deviation of split frequencies: 0.008848
665500 -- (-289.975) [-289.610] (-296.737) (-292.919) * (-294.309) (-290.135) [-292.253] (-290.577) -- 0:00:19
666000 -- (-292.780) (-291.666) [-292.009] (-293.126) * (-291.600) [-291.535] (-291.036) (-291.065) -- 0:00:19
666500 -- (-290.798) [-289.523] (-294.775) (-292.562) * (-291.491) [-290.559] (-290.523) (-289.843) -- 0:00:19
667000 -- (-292.536) [-289.628] (-291.443) (-291.730) * (-290.055) (-297.061) [-290.092] (-291.420) -- 0:00:19
667500 -- (-293.199) (-290.914) (-292.873) [-294.632] * (-293.137) (-292.975) [-291.008] (-290.491) -- 0:00:19
668000 -- [-290.696] (-290.000) (-291.323) (-297.259) * (-291.230) (-292.518) [-290.752] (-290.955) -- 0:00:19
668500 -- (-289.886) (-290.054) [-289.612] (-291.444) * [-291.093] (-293.661) (-290.262) (-289.681) -- 0:00:19
669000 -- (-292.490) (-292.424) (-289.161) [-289.325] * [-289.898] (-293.339) (-291.355) (-291.125) -- 0:00:19
669500 -- (-292.054) [-291.147] (-289.729) (-291.034) * (-289.211) [-290.700] (-293.334) (-291.862) -- 0:00:19
670000 -- [-293.857] (-293.059) (-294.725) (-291.467) * (-289.744) [-292.520] (-292.991) (-292.023) -- 0:00:19
Average standard deviation of split frequencies: 0.008918
670500 -- (-291.917) (-291.230) (-291.270) [-289.981] * (-293.704) (-293.355) [-290.515] (-289.512) -- 0:00:19
671000 -- [-290.792] (-291.545) (-291.089) (-292.881) * [-294.102] (-290.308) (-290.446) (-289.261) -- 0:00:19
671500 -- (-292.031) (-293.201) (-292.587) [-289.679] * (-291.186) (-292.285) (-290.366) [-291.514] -- 0:00:19
672000 -- [-290.306] (-289.247) (-298.438) (-291.694) * (-290.613) (-291.361) (-291.160) [-293.027] -- 0:00:19
672500 -- (-291.925) [-292.591] (-294.187) (-291.489) * (-289.365) [-292.073] (-291.610) (-291.672) -- 0:00:18
673000 -- (-296.231) (-290.436) (-290.489) [-289.954] * [-291.049] (-291.211) (-290.009) (-290.889) -- 0:00:18
673500 -- (-294.317) (-289.947) (-292.696) [-289.985] * (-289.091) [-289.497] (-292.512) (-291.085) -- 0:00:18
674000 -- [-293.118] (-290.000) (-294.783) (-290.768) * (-294.260) (-290.384) [-289.713] (-289.975) -- 0:00:18
674500 -- (-291.651) (-291.647) [-289.707] (-291.870) * [-289.519] (-289.135) (-289.869) (-290.159) -- 0:00:18
675000 -- [-293.021] (-290.855) (-289.118) (-290.414) * (-290.476) (-291.281) [-289.926] (-290.405) -- 0:00:18
Average standard deviation of split frequencies: 0.008630
675500 -- (-291.754) [-290.412] (-292.092) (-292.502) * [-294.334] (-290.238) (-292.961) (-292.099) -- 0:00:18
676000 -- [-289.574] (-293.167) (-292.191) (-289.953) * (-290.113) [-289.590] (-291.273) (-294.265) -- 0:00:18
676500 -- [-289.833] (-293.881) (-293.540) (-289.109) * (-290.668) [-289.602] (-293.856) (-296.106) -- 0:00:19
677000 -- (-289.063) [-289.773] (-291.579) (-290.854) * [-290.983] (-289.088) (-292.742) (-297.952) -- 0:00:19
677500 -- (-289.832) (-294.678) (-290.185) [-291.073] * [-291.826] (-291.190) (-293.611) (-290.756) -- 0:00:19
678000 -- (-289.928) [-289.424] (-290.620) (-291.825) * (-292.925) (-290.620) (-290.907) [-290.220] -- 0:00:18
678500 -- (-293.980) (-291.854) (-291.500) [-293.215] * (-291.694) [-292.447] (-292.907) (-293.976) -- 0:00:18
679000 -- [-291.418] (-289.947) (-295.669) (-291.303) * (-289.713) (-291.082) (-290.297) [-291.424] -- 0:00:18
679500 -- (-291.400) [-292.195] (-292.084) (-293.476) * (-292.903) (-289.635) (-291.060) [-295.214] -- 0:00:18
680000 -- [-291.269] (-299.364) (-293.983) (-290.583) * [-290.466] (-290.402) (-288.911) (-292.623) -- 0:00:18
Average standard deviation of split frequencies: 0.008614
680500 -- (-292.918) (-292.602) [-290.781] (-290.062) * (-290.691) (-289.917) [-289.950] (-290.222) -- 0:00:18
681000 -- [-290.648] (-292.074) (-290.701) (-290.168) * (-291.086) [-291.967] (-288.960) (-293.099) -- 0:00:18
681500 -- (-295.550) (-289.682) [-291.997] (-291.542) * (-290.509) (-294.235) [-289.047] (-293.311) -- 0:00:18
682000 -- [-291.021] (-293.221) (-291.605) (-291.898) * (-291.739) (-294.468) (-291.576) [-290.543] -- 0:00:18
682500 -- (-292.290) (-293.061) (-291.218) [-290.178] * [-291.162] (-293.860) (-291.791) (-292.888) -- 0:00:18
683000 -- (-292.387) (-290.650) (-290.769) [-290.742] * [-289.700] (-295.807) (-291.193) (-298.837) -- 0:00:18
683500 -- [-292.363] (-291.422) (-294.648) (-290.834) * (-290.327) (-292.967) (-291.228) [-290.639] -- 0:00:18
684000 -- (-292.800) (-293.514) (-293.986) [-290.373] * (-290.952) (-292.804) [-290.501] (-291.648) -- 0:00:18
684500 -- (-293.973) (-295.141) (-292.040) [-290.144] * (-289.887) [-292.883] (-291.586) (-290.830) -- 0:00:18
685000 -- (-291.368) [-289.756] (-290.016) (-289.923) * [-289.907] (-291.062) (-290.164) (-291.243) -- 0:00:18
Average standard deviation of split frequencies: 0.008762
685500 -- (-291.000) [-293.905] (-291.708) (-290.163) * (-289.963) [-290.112] (-290.124) (-291.203) -- 0:00:18
686000 -- (-291.022) (-292.141) (-289.963) [-293.170] * [-291.779] (-293.376) (-290.393) (-292.068) -- 0:00:18
686500 -- [-292.219] (-291.080) (-293.850) (-293.271) * (-290.158) [-294.298] (-289.435) (-291.933) -- 0:00:18
687000 -- (-289.820) (-291.764) [-289.294] (-289.553) * [-291.378] (-290.265) (-290.842) (-291.690) -- 0:00:18
687500 -- (-292.391) (-291.541) [-292.459] (-289.746) * (-289.781) [-289.950] (-289.870) (-290.694) -- 0:00:18
688000 -- (-290.965) (-296.538) (-290.310) [-289.126] * [-289.134] (-290.939) (-292.295) (-289.616) -- 0:00:18
688500 -- [-291.128] (-290.087) (-290.646) (-289.640) * (-293.369) [-290.088] (-291.047) (-289.893) -- 0:00:18
689000 -- [-291.864] (-290.849) (-290.625) (-292.047) * [-289.344] (-291.819) (-292.023) (-289.540) -- 0:00:18
689500 -- (-290.582) (-294.224) [-291.110] (-290.781) * [-289.687] (-289.642) (-289.020) (-290.896) -- 0:00:18
690000 -- [-290.997] (-294.609) (-290.673) (-289.580) * [-291.431] (-292.863) (-296.261) (-291.918) -- 0:00:17
Average standard deviation of split frequencies: 0.008830
690500 -- (-291.198) (-289.164) (-291.852) [-290.944] * [-289.283] (-289.532) (-291.395) (-291.320) -- 0:00:17
691000 -- (-292.432) [-288.960] (-291.514) (-292.012) * (-295.532) (-289.807) (-290.260) [-293.126] -- 0:00:17
691500 -- (-292.899) [-288.995] (-290.106) (-291.733) * (-296.035) (-289.892) (-292.993) [-292.118] -- 0:00:17
692000 -- (-294.712) (-292.831) (-291.607) [-289.548] * (-293.228) [-291.727] (-289.557) (-291.506) -- 0:00:17
692500 -- (-293.094) (-293.704) [-290.430] (-291.776) * (-290.949) [-289.662] (-295.054) (-291.473) -- 0:00:17
693000 -- (-292.018) (-291.217) [-292.937] (-291.594) * (-291.785) (-290.873) (-299.462) [-290.885] -- 0:00:17
693500 -- (-291.259) [-291.830] (-292.044) (-290.086) * (-291.158) (-290.569) [-289.415] (-291.684) -- 0:00:17
694000 -- (-289.671) (-294.153) (-294.391) [-289.113] * [-292.105] (-291.693) (-289.528) (-289.415) -- 0:00:18
694500 -- [-291.125] (-289.315) (-293.074) (-290.466) * [-291.686] (-294.084) (-290.471) (-290.240) -- 0:00:18
695000 -- (-290.056) (-289.636) (-291.821) [-291.238] * (-290.932) (-289.641) [-292.689] (-291.364) -- 0:00:17
Average standard deviation of split frequencies: 0.008424
695500 -- (-291.042) (-293.139) [-289.448] (-289.921) * (-293.795) (-289.248) (-291.722) [-290.553] -- 0:00:17
696000 -- [-289.123] (-294.826) (-293.885) (-290.076) * (-290.552) (-289.448) (-294.622) [-290.118] -- 0:00:17
696500 -- [-294.516] (-292.877) (-290.731) (-295.224) * (-291.271) [-290.297] (-291.837) (-291.935) -- 0:00:17
697000 -- [-289.010] (-291.408) (-292.491) (-296.425) * [-292.420] (-291.124) (-289.910) (-293.518) -- 0:00:17
697500 -- (-290.049) (-289.276) (-291.767) [-291.252] * (-290.895) [-291.406] (-291.326) (-292.961) -- 0:00:17
698000 -- [-291.072] (-289.731) (-289.780) (-290.381) * [-291.193] (-294.161) (-295.056) (-291.294) -- 0:00:17
698500 -- (-291.072) (-290.795) [-289.657] (-292.171) * (-291.106) (-294.988) (-291.028) [-289.142] -- 0:00:17
699000 -- (-290.190) (-294.591) (-289.065) [-290.606] * (-291.793) [-289.723] (-294.850) (-292.191) -- 0:00:17
699500 -- (-289.016) [-290.223] (-289.192) (-293.111) * (-289.563) [-291.354] (-295.829) (-291.555) -- 0:00:17
700000 -- (-290.958) (-291.752) (-289.759) [-294.653] * (-291.034) (-290.392) (-292.062) [-292.816] -- 0:00:17
Average standard deviation of split frequencies: 0.008116
700500 -- (-289.313) [-289.471] (-295.225) (-292.283) * (-290.385) (-292.275) (-290.739) [-291.264] -- 0:00:17
701000 -- (-290.976) (-292.970) [-294.317] (-289.826) * (-290.508) [-289.786] (-293.348) (-290.267) -- 0:00:17
701500 -- (-292.432) [-290.872] (-290.474) (-290.602) * (-291.309) (-292.296) [-290.263] (-290.954) -- 0:00:17
702000 -- (-293.883) (-292.275) [-291.546] (-291.016) * (-292.773) (-293.583) [-289.539] (-289.357) -- 0:00:17
702500 -- (-292.382) (-290.361) (-293.049) [-292.290] * (-292.638) (-289.472) [-290.008] (-291.120) -- 0:00:17
703000 -- [-292.081] (-290.554) (-293.323) (-291.614) * (-290.878) (-290.422) (-293.425) [-291.110] -- 0:00:17
703500 -- (-291.647) (-294.220) [-289.878] (-292.529) * (-290.409) [-291.137] (-296.719) (-292.624) -- 0:00:17
704000 -- (-294.620) (-289.943) [-290.581] (-290.649) * (-294.497) (-291.999) [-292.548] (-293.495) -- 0:00:17
704500 -- (-291.854) (-291.480) [-292.675] (-293.315) * [-292.826] (-290.513) (-295.406) (-291.950) -- 0:00:17
705000 -- (-297.827) [-291.312] (-294.075) (-291.375) * (-289.947) [-291.502] (-290.066) (-292.359) -- 0:00:17
Average standard deviation of split frequencies: 0.008138
705500 -- [-290.681] (-291.014) (-291.565) (-292.993) * (-289.176) (-292.353) [-289.703] (-291.727) -- 0:00:17
706000 -- (-290.807) (-289.868) [-294.909] (-297.790) * (-288.916) (-289.779) [-289.857] (-291.253) -- 0:00:17
706500 -- [-290.951] (-289.718) (-290.486) (-290.099) * (-291.799) [-290.181] (-293.041) (-293.758) -- 0:00:17
707000 -- (-292.424) (-292.650) [-289.578] (-289.845) * (-293.000) (-289.071) [-291.116] (-290.575) -- 0:00:16
707500 -- (-290.408) (-293.259) (-291.845) [-289.764] * (-292.356) (-289.321) (-292.113) [-291.018] -- 0:00:16
708000 -- (-290.349) [-290.033] (-290.647) (-289.155) * (-295.952) (-294.497) [-290.781] (-292.298) -- 0:00:16
708500 -- (-290.448) (-289.965) [-292.178] (-290.437) * (-293.508) (-293.605) (-290.570) [-291.521] -- 0:00:16
709000 -- [-290.070] (-292.388) (-291.314) (-293.121) * (-289.943) (-292.588) (-291.489) [-289.449] -- 0:00:16
709500 -- (-293.329) (-291.434) (-292.678) [-290.164] * (-291.633) (-295.787) [-291.095] (-293.210) -- 0:00:16
710000 -- (-290.281) (-293.320) (-291.138) [-289.939] * [-289.315] (-292.507) (-289.708) (-294.308) -- 0:00:16
Average standard deviation of split frequencies: 0.008001
710500 -- [-289.876] (-289.935) (-293.758) (-290.642) * (-290.102) [-290.133] (-291.232) (-291.394) -- 0:00:16
711000 -- [-289.865] (-291.218) (-290.475) (-292.545) * [-289.110] (-290.072) (-291.017) (-293.086) -- 0:00:17
711500 -- (-292.484) (-289.543) (-292.480) [-292.575] * (-291.587) (-294.015) [-290.465] (-289.841) -- 0:00:17
712000 -- (-291.084) [-289.836] (-291.932) (-293.230) * [-291.931] (-292.238) (-289.802) (-290.230) -- 0:00:16
712500 -- (-292.052) (-289.664) (-290.696) [-290.186] * [-294.004] (-295.463) (-291.702) (-291.889) -- 0:00:16
713000 -- (-290.229) (-292.748) (-290.171) [-289.949] * (-290.705) [-291.615] (-292.057) (-289.340) -- 0:00:16
713500 -- (-292.309) [-293.249] (-291.854) (-293.187) * (-291.155) (-290.676) [-291.285] (-289.163) -- 0:00:16
714000 -- (-295.875) [-289.968] (-290.928) (-290.490) * [-292.047] (-290.583) (-291.257) (-291.777) -- 0:00:16
714500 -- (-293.698) (-291.140) (-290.016) [-289.803] * [-290.265] (-289.305) (-291.518) (-289.904) -- 0:00:16
715000 -- (-289.398) [-290.350] (-291.537) (-290.921) * (-291.029) (-289.543) (-290.221) [-289.854] -- 0:00:16
Average standard deviation of split frequencies: 0.007654
715500 -- (-291.354) (-293.956) [-291.831] (-290.924) * (-290.685) [-289.737] (-298.495) (-292.096) -- 0:00:16
716000 -- (-291.603) (-290.154) (-292.516) [-290.728] * [-294.915] (-294.322) (-292.759) (-293.286) -- 0:00:16
716500 -- (-289.190) (-289.421) (-292.505) [-290.453] * [-292.092] (-293.448) (-293.707) (-291.676) -- 0:00:16
717000 -- (-291.057) [-293.321] (-290.465) (-292.168) * (-290.873) (-289.446) (-289.227) [-289.970] -- 0:00:16
717500 -- (-292.973) (-290.918) [-291.515] (-290.501) * (-294.492) [-291.740] (-289.085) (-291.987) -- 0:00:16
718000 -- [-289.728] (-290.303) (-289.924) (-292.993) * [-293.846] (-289.682) (-289.807) (-292.332) -- 0:00:16
718500 -- (-291.359) (-291.951) (-293.619) [-294.051] * (-294.215) [-292.093] (-292.065) (-290.759) -- 0:00:16
719000 -- (-289.212) [-289.714] (-290.191) (-291.743) * (-291.098) [-290.227] (-291.699) (-294.573) -- 0:00:16
719500 -- [-291.329] (-290.426) (-291.103) (-290.875) * (-290.401) (-289.343) [-294.752] (-292.714) -- 0:00:16
720000 -- (-290.528) (-291.947) [-293.424] (-289.792) * (-291.112) (-290.388) [-291.572] (-289.656) -- 0:00:16
Average standard deviation of split frequencies: 0.008095
720500 -- [-291.240] (-291.907) (-295.485) (-290.477) * (-290.731) [-291.482] (-293.266) (-290.292) -- 0:00:16
721000 -- (-293.149) (-289.761) (-290.366) [-290.534] * (-296.204) [-292.528] (-294.869) (-290.899) -- 0:00:16
721500 -- (-292.628) [-289.582] (-293.030) (-291.754) * [-293.603] (-292.016) (-293.810) (-291.258) -- 0:00:16
722000 -- (-291.083) (-290.761) [-291.270] (-294.790) * (-291.264) (-291.154) (-292.774) [-294.812] -- 0:00:16
722500 -- (-291.510) (-292.590) [-290.362] (-292.389) * (-290.167) (-291.181) [-290.174] (-293.047) -- 0:00:16
723000 -- (-291.793) (-295.387) (-294.202) [-290.063] * (-289.147) [-294.199] (-289.631) (-292.413) -- 0:00:16
723500 -- (-291.744) (-294.526) [-293.181] (-291.246) * [-291.546] (-291.004) (-292.616) (-290.205) -- 0:00:16
724000 -- (-291.033) (-290.716) [-293.853] (-290.855) * (-293.119) (-291.950) (-291.725) [-289.959] -- 0:00:16
724500 -- [-289.225] (-289.432) (-293.572) (-290.708) * (-294.073) (-291.735) [-292.369] (-292.050) -- 0:00:15
725000 -- (-290.035) (-289.449) [-290.403] (-296.207) * (-290.391) (-290.344) (-289.757) [-291.145] -- 0:00:15
Average standard deviation of split frequencies: 0.008401
725500 -- [-291.181] (-290.214) (-293.453) (-291.311) * (-289.863) (-289.967) [-290.457] (-289.123) -- 0:00:15
726000 -- [-289.343] (-290.019) (-290.616) (-290.935) * (-289.278) (-291.221) [-290.177] (-289.793) -- 0:00:15
726500 -- (-290.120) [-290.193] (-292.528) (-289.770) * [-292.911] (-290.824) (-291.917) (-291.465) -- 0:00:15
727000 -- (-290.463) (-293.295) [-293.196] (-290.539) * (-291.762) (-289.925) [-289.868] (-293.941) -- 0:00:15
727500 -- (-290.827) (-292.594) [-291.278] (-291.782) * (-293.807) (-290.763) [-289.213] (-291.394) -- 0:00:15
728000 -- (-291.754) [-290.903] (-292.259) (-297.188) * (-289.794) [-290.831] (-290.267) (-290.994) -- 0:00:15
728500 -- (-291.839) (-290.695) (-289.575) [-294.127] * (-290.544) (-293.791) [-289.592] (-295.134) -- 0:00:16
729000 -- [-291.133] (-295.784) (-290.144) (-290.117) * (-289.834) [-289.661] (-291.376) (-291.549) -- 0:00:15
729500 -- (-289.342) [-290.863] (-289.586) (-291.519) * (-292.789) [-292.892] (-291.747) (-292.182) -- 0:00:15
730000 -- (-290.238) (-292.521) [-290.426] (-297.908) * (-296.074) (-293.052) [-289.990] (-290.605) -- 0:00:15
Average standard deviation of split frequencies: 0.008790
730500 -- (-291.007) (-294.131) [-289.846] (-290.381) * (-300.050) (-289.358) (-292.675) [-293.791] -- 0:00:15
731000 -- [-289.539] (-292.203) (-290.342) (-292.223) * (-290.937) [-292.168] (-290.740) (-293.527) -- 0:00:15
731500 -- (-289.991) (-293.965) (-292.007) [-290.432] * (-289.441) (-290.926) (-291.521) [-290.621] -- 0:00:15
732000 -- [-291.430] (-290.077) (-292.667) (-291.029) * (-291.235) (-289.821) (-291.464) [-291.027] -- 0:00:15
732500 -- (-291.292) (-290.742) [-289.486] (-291.699) * [-291.356] (-290.834) (-291.562) (-289.731) -- 0:00:15
733000 -- [-289.552] (-289.703) (-292.078) (-290.522) * (-290.256) (-288.965) [-292.229] (-292.647) -- 0:00:15
733500 -- (-292.657) [-290.455] (-290.218) (-293.788) * (-290.634) (-289.295) [-293.141] (-289.382) -- 0:00:15
734000 -- [-289.521] (-290.578) (-292.774) (-290.919) * (-292.105) (-294.162) (-291.085) [-291.155] -- 0:00:15
734500 -- (-292.972) [-292.567] (-289.607) (-290.987) * [-294.054] (-290.203) (-291.259) (-291.980) -- 0:00:15
735000 -- (-289.670) [-292.315] (-293.326) (-289.847) * [-291.479] (-290.997) (-290.959) (-292.115) -- 0:00:15
Average standard deviation of split frequencies: 0.009207
735500 -- (-291.146) (-291.948) (-295.219) [-289.870] * [-294.736] (-293.694) (-289.810) (-289.419) -- 0:00:15
736000 -- (-290.311) (-289.902) [-290.154] (-290.183) * [-289.300] (-290.623) (-290.269) (-289.510) -- 0:00:15
736500 -- (-289.277) [-291.013] (-291.299) (-290.760) * [-290.000] (-290.232) (-291.921) (-290.617) -- 0:00:15
737000 -- (-292.028) (-291.139) (-292.653) [-288.818] * [-289.915] (-290.335) (-291.874) (-297.522) -- 0:00:15
737500 -- (-290.569) [-290.606] (-289.606) (-290.065) * [-289.000] (-293.554) (-290.145) (-293.448) -- 0:00:15
738000 -- [-291.375] (-291.389) (-289.516) (-289.911) * [-289.917] (-294.638) (-289.143) (-291.005) -- 0:00:15
738500 -- (-293.849) (-297.257) [-293.820] (-291.370) * (-288.851) (-291.712) (-290.225) [-288.973] -- 0:00:15
739000 -- [-289.131] (-293.983) (-291.962) (-290.641) * (-289.322) (-289.891) (-289.393) [-291.270] -- 0:00:15
739500 -- (-292.057) [-290.437] (-291.884) (-293.313) * (-290.433) [-291.971] (-289.681) (-290.521) -- 0:00:15
740000 -- (-289.077) [-291.020] (-293.113) (-290.437) * (-291.474) (-290.224) (-289.046) [-291.829] -- 0:00:15
Average standard deviation of split frequencies: 0.009229
740500 -- (-293.101) (-291.809) [-292.018] (-290.758) * (-295.161) [-289.900] (-292.968) (-295.241) -- 0:00:15
741000 -- (-290.023) (-291.575) [-293.616] (-289.622) * (-292.110) [-294.413] (-290.576) (-290.715) -- 0:00:15
741500 -- (-290.989) (-291.733) (-295.249) [-289.832] * (-294.056) [-291.413] (-294.308) (-289.827) -- 0:00:14
742000 -- (-292.359) [-293.172] (-291.546) (-290.224) * [-289.989] (-292.176) (-297.419) (-294.787) -- 0:00:14
742500 -- (-291.774) (-293.890) [-290.591] (-290.085) * [-289.694] (-292.809) (-296.923) (-291.406) -- 0:00:14
743000 -- (-293.462) (-293.353) (-291.706) [-289.204] * (-289.818) [-291.912] (-291.086) (-292.339) -- 0:00:14
743500 -- (-291.955) [-292.065] (-291.637) (-289.034) * (-290.057) (-297.295) [-290.024] (-293.455) -- 0:00:14
744000 -- (-290.899) (-292.730) (-291.795) [-293.225] * (-292.053) (-292.502) [-290.567] (-290.366) -- 0:00:14
744500 -- (-291.757) (-297.994) [-289.078] (-290.645) * (-290.865) (-294.722) [-289.735] (-292.869) -- 0:00:14
745000 -- [-292.981] (-291.165) (-289.352) (-293.773) * (-290.316) (-293.978) [-292.254] (-289.136) -- 0:00:14
Average standard deviation of split frequencies: 0.009044
745500 -- [-290.656] (-290.082) (-290.643) (-290.936) * (-289.279) [-292.189] (-289.702) (-289.961) -- 0:00:14
746000 -- (-291.807) [-293.634] (-291.318) (-295.683) * [-290.765] (-294.808) (-291.177) (-294.967) -- 0:00:14
746500 -- [-290.887] (-293.988) (-290.889) (-292.264) * (-290.759) (-289.224) [-290.924] (-294.031) -- 0:00:14
747000 -- [-290.625] (-290.341) (-289.209) (-289.977) * (-289.358) (-292.022) (-292.262) [-292.591] -- 0:00:14
747500 -- (-290.742) (-290.604) (-290.448) [-290.324] * [-295.730] (-291.415) (-294.339) (-290.220) -- 0:00:14
748000 -- [-292.185] (-292.750) (-296.168) (-293.070) * (-291.423) (-290.036) (-291.729) [-289.946] -- 0:00:14
748500 -- (-293.303) (-290.225) (-291.349) [-290.239] * (-295.067) (-290.846) [-292.283] (-290.478) -- 0:00:14
749000 -- [-290.640] (-290.835) (-292.859) (-294.773) * (-292.413) [-288.972] (-291.626) (-296.552) -- 0:00:14
749500 -- (-291.616) (-292.780) (-292.146) [-289.705] * (-291.504) (-290.387) (-292.487) [-291.383] -- 0:00:14
750000 -- (-293.692) (-290.242) (-292.314) [-294.628] * (-293.787) (-290.518) (-289.360) [-292.973] -- 0:00:14
Average standard deviation of split frequencies: 0.009106
750500 -- (-293.247) (-292.725) (-291.444) [-289.724] * [-291.611] (-294.682) (-289.988) (-289.047) -- 0:00:14
751000 -- [-290.655] (-288.927) (-290.178) (-291.485) * (-293.034) (-292.516) [-294.484] (-288.955) -- 0:00:14
751500 -- [-292.238] (-292.691) (-294.722) (-289.610) * (-292.055) (-291.228) (-291.840) [-290.059] -- 0:00:14
752000 -- [-291.308] (-294.473) (-290.817) (-290.860) * (-297.072) (-290.285) [-289.670] (-291.200) -- 0:00:14
752500 -- (-291.566) (-292.446) [-289.634] (-291.124) * (-290.373) (-292.484) (-289.184) [-289.713] -- 0:00:14
753000 -- (-290.246) [-289.883] (-289.353) (-290.560) * (-291.838) [-290.098] (-290.846) (-290.201) -- 0:00:14
753500 -- [-290.039] (-291.009) (-290.518) (-291.755) * (-293.400) [-291.122] (-290.457) (-294.055) -- 0:00:14
754000 -- (-293.251) (-290.091) (-292.247) [-292.035] * (-288.865) (-292.297) [-290.153] (-295.721) -- 0:00:14
754500 -- (-289.916) (-294.579) [-290.694] (-291.580) * [-289.517] (-290.787) (-292.207) (-290.352) -- 0:00:14
755000 -- [-289.759] (-291.586) (-291.016) (-289.837) * (-289.843) (-290.620) [-291.177] (-295.403) -- 0:00:14
Average standard deviation of split frequencies: 0.009003
755500 -- (-289.246) (-296.480) (-290.843) [-289.915] * (-289.877) [-290.678] (-290.484) (-293.159) -- 0:00:14
756000 -- [-294.669] (-291.718) (-296.196) (-292.744) * (-292.029) (-292.054) (-290.929) [-290.207] -- 0:00:14
756500 -- [-294.583] (-291.854) (-296.952) (-291.426) * (-289.598) (-292.302) (-290.797) [-289.615] -- 0:00:14
757000 -- (-291.674) (-293.148) (-292.198) [-290.692] * [-290.191] (-291.842) (-290.741) (-290.113) -- 0:00:14
757500 -- (-292.725) [-289.570] (-290.837) (-293.144) * (-293.439) (-292.403) [-289.808] (-292.226) -- 0:00:14
758000 -- (-291.239) (-289.122) (-290.320) [-289.375] * (-290.445) [-291.064] (-289.189) (-289.499) -- 0:00:14
758500 -- (-290.501) [-292.017] (-290.741) (-294.628) * (-292.405) (-288.738) [-291.043] (-291.466) -- 0:00:14
759000 -- (-291.789) (-291.108) [-289.071] (-290.254) * (-292.845) [-288.957] (-290.489) (-292.618) -- 0:00:13
759500 -- (-291.152) (-292.416) [-291.307] (-293.233) * (-289.648) (-298.625) [-292.208] (-290.132) -- 0:00:13
760000 -- (-290.508) (-290.726) [-290.735] (-291.921) * (-289.284) (-291.183) [-295.127] (-290.418) -- 0:00:13
Average standard deviation of split frequencies: 0.009412
760500 -- [-291.916] (-290.055) (-291.278) (-290.366) * (-289.729) (-292.098) [-289.824] (-289.446) -- 0:00:13
761000 -- [-290.724] (-294.067) (-292.384) (-292.677) * (-289.470) (-292.339) [-289.454] (-295.612) -- 0:00:13
761500 -- (-289.748) (-291.531) [-292.779] (-292.333) * (-290.802) (-293.559) (-291.142) [-294.793] -- 0:00:13
762000 -- (-290.561) [-291.393] (-291.113) (-293.116) * (-291.939) [-291.541] (-290.126) (-291.391) -- 0:00:13
762500 -- (-292.910) (-291.962) (-293.747) [-290.479] * (-294.287) (-289.496) [-289.833] (-290.298) -- 0:00:13
763000 -- (-295.801) (-295.111) (-292.811) [-291.917] * (-289.409) (-290.686) (-291.540) [-291.216] -- 0:00:13
763500 -- (-290.570) (-293.468) (-290.968) [-292.308] * (-289.604) (-291.216) [-291.790] (-290.575) -- 0:00:13
764000 -- (-291.748) [-291.600] (-290.767) (-295.343) * [-290.821] (-290.399) (-291.606) (-290.230) -- 0:00:13
764500 -- (-291.384) (-290.871) [-289.817] (-291.649) * (-291.133) (-290.138) (-291.691) [-291.513] -- 0:00:13
765000 -- (-290.677) (-291.332) [-290.603] (-293.155) * (-291.247) (-289.423) [-292.216] (-294.289) -- 0:00:13
Average standard deviation of split frequencies: 0.008808
765500 -- (-295.633) (-290.678) (-292.355) [-289.990] * [-290.928] (-291.468) (-290.164) (-289.861) -- 0:00:13
766000 -- [-289.944] (-291.562) (-294.796) (-292.358) * (-291.025) (-292.801) [-289.218] (-293.163) -- 0:00:13
766500 -- (-289.587) [-291.376] (-291.873) (-293.643) * [-292.956] (-291.552) (-291.814) (-291.382) -- 0:00:13
767000 -- (-290.935) (-290.435) [-290.482] (-293.917) * (-293.592) (-289.770) (-290.269) [-290.904] -- 0:00:13
767500 -- (-290.671) (-289.757) [-292.232] (-290.107) * (-290.721) [-290.573] (-297.023) (-289.139) -- 0:00:13
768000 -- (-293.227) (-291.074) (-295.387) [-290.992] * [-290.508] (-291.804) (-292.096) (-289.863) -- 0:00:13
768500 -- (-291.257) [-290.364] (-290.052) (-289.518) * [-289.981] (-294.352) (-290.852) (-291.578) -- 0:00:13
769000 -- (-291.052) (-289.680) [-291.814] (-289.696) * (-294.968) [-293.052] (-289.728) (-290.424) -- 0:00:13
769500 -- (-289.799) (-291.766) [-298.205] (-289.177) * [-290.702] (-293.112) (-295.086) (-290.469) -- 0:00:13
770000 -- [-296.179] (-289.669) (-292.628) (-291.653) * (-290.744) (-294.966) (-292.401) [-291.277] -- 0:00:13
Average standard deviation of split frequencies: 0.008602
770500 -- (-290.718) (-291.595) [-290.602] (-291.226) * (-289.640) [-291.375] (-293.017) (-289.341) -- 0:00:13
771000 -- (-289.794) (-291.137) (-291.442) [-291.706] * (-290.867) [-290.419] (-293.108) (-290.221) -- 0:00:13
771500 -- (-290.850) [-291.500] (-292.830) (-288.879) * (-291.504) (-291.420) (-290.032) [-291.858] -- 0:00:13
772000 -- (-290.533) (-289.998) [-292.222] (-290.204) * (-292.213) [-290.582] (-294.226) (-289.524) -- 0:00:13
772500 -- (-289.050) (-290.607) [-290.703] (-292.541) * (-291.188) [-289.008] (-292.078) (-295.061) -- 0:00:13
773000 -- (-291.892) [-291.501] (-293.159) (-290.953) * [-293.108] (-292.902) (-293.068) (-291.605) -- 0:00:13
773500 -- (-289.269) [-291.845] (-289.310) (-292.358) * (-291.483) (-294.014) [-292.741] (-289.790) -- 0:00:13
774000 -- [-292.422] (-291.693) (-289.213) (-293.002) * (-289.732) (-289.463) [-295.031] (-290.593) -- 0:00:13
774500 -- (-291.029) (-289.870) [-290.552] (-291.500) * [-288.875] (-291.179) (-291.780) (-290.894) -- 0:00:13
775000 -- (-290.807) (-289.379) (-293.204) [-292.865] * (-288.917) (-292.089) [-290.792] (-292.612) -- 0:00:13
Average standard deviation of split frequencies: 0.008201
775500 -- (-293.576) (-292.200) (-291.848) [-291.601] * [-289.892] (-289.253) (-291.556) (-294.150) -- 0:00:13
776000 -- (-289.798) (-293.831) [-292.478] (-291.293) * [-289.101] (-292.561) (-291.967) (-290.228) -- 0:00:12
776500 -- (-295.470) (-294.439) (-289.703) [-290.267] * (-291.251) [-292.287] (-290.874) (-290.031) -- 0:00:12
777000 -- (-294.720) (-290.405) [-291.394] (-294.153) * (-292.732) (-290.825) (-289.885) [-291.452] -- 0:00:12
777500 -- (-289.926) (-290.872) (-293.124) [-289.214] * [-290.174] (-290.760) (-290.193) (-292.041) -- 0:00:12
778000 -- (-289.976) [-292.710] (-289.784) (-291.399) * (-290.992) (-294.831) [-289.821] (-292.415) -- 0:00:12
778500 -- [-290.327] (-289.545) (-290.234) (-290.394) * (-292.723) (-292.153) (-291.890) [-291.592] -- 0:00:12
779000 -- (-291.583) (-289.817) (-292.445) [-290.237] * [-290.795] (-290.219) (-291.941) (-293.675) -- 0:00:12
779500 -- [-290.365] (-289.783) (-296.291) (-292.177) * (-292.001) (-290.604) (-289.843) [-291.926] -- 0:00:12
780000 -- (-289.627) [-289.507] (-295.291) (-294.552) * [-292.709] (-289.931) (-291.377) (-291.404) -- 0:00:12
Average standard deviation of split frequencies: 0.007699
780500 -- (-289.970) (-291.332) (-289.425) [-290.420] * (-289.957) (-289.230) [-290.459] (-289.764) -- 0:00:12
781000 -- [-291.595] (-292.389) (-290.567) (-290.294) * [-291.577] (-289.445) (-290.634) (-290.978) -- 0:00:12
781500 -- (-290.981) (-289.743) (-290.880) [-290.161] * (-289.656) (-291.182) [-291.020] (-290.195) -- 0:00:12
782000 -- (-290.025) (-289.590) [-289.610] (-290.686) * (-290.636) [-295.150] (-291.735) (-290.436) -- 0:00:12
782500 -- [-289.461] (-290.730) (-291.796) (-291.937) * [-289.537] (-292.343) (-289.540) (-291.416) -- 0:00:12
783000 -- [-289.387] (-290.530) (-293.243) (-289.001) * (-290.064) (-292.465) [-290.603] (-292.915) -- 0:00:12
783500 -- [-290.326] (-291.211) (-293.750) (-290.355) * [-291.165] (-290.231) (-290.740) (-291.534) -- 0:00:12
784000 -- (-293.273) (-292.711) [-298.725] (-289.277) * (-289.600) (-289.652) [-289.063] (-291.349) -- 0:00:12
784500 -- (-293.724) [-288.915] (-289.782) (-290.630) * (-290.609) (-290.563) (-289.983) [-290.381] -- 0:00:12
785000 -- (-289.911) [-290.649] (-289.880) (-291.024) * (-290.786) (-291.141) (-290.857) [-294.673] -- 0:00:12
Average standard deviation of split frequencies: 0.007872
785500 -- [-293.565] (-290.616) (-290.514) (-290.914) * [-289.492] (-290.609) (-291.351) (-290.519) -- 0:00:12
786000 -- (-290.247) (-291.798) (-296.075) [-292.501] * (-290.176) (-291.997) (-291.857) [-290.828] -- 0:00:12
786500 -- (-290.080) (-290.348) (-292.351) [-291.390] * (-293.012) (-290.686) (-291.757) [-291.272] -- 0:00:12
787000 -- (-289.768) [-289.833] (-292.457) (-290.033) * [-292.521] (-293.415) (-291.150) (-290.557) -- 0:00:12
787500 -- (-296.317) [-290.443] (-295.392) (-291.267) * (-290.315) [-294.007] (-292.294) (-293.390) -- 0:00:12
788000 -- [-293.543] (-290.337) (-291.768) (-290.250) * (-291.853) [-291.176] (-292.461) (-296.067) -- 0:00:12
788500 -- (-290.453) (-289.104) [-290.928] (-292.033) * [-289.118] (-289.491) (-292.639) (-291.390) -- 0:00:12
789000 -- [-289.669] (-289.237) (-290.084) (-291.835) * (-289.189) (-290.202) (-291.998) [-292.545] -- 0:00:12
789500 -- (-291.607) [-289.329] (-290.415) (-290.785) * (-289.677) (-289.549) [-289.640] (-291.821) -- 0:00:12
790000 -- (-296.153) (-290.345) (-293.302) [-290.504] * [-290.624] (-290.687) (-291.205) (-290.367) -- 0:00:12
Average standard deviation of split frequencies: 0.008459
790500 -- (-290.458) (-292.810) [-291.601] (-292.727) * (-290.960) (-291.696) [-289.238] (-291.260) -- 0:00:12
791000 -- [-291.331] (-291.245) (-291.148) (-292.771) * (-290.265) (-289.765) [-290.259] (-293.266) -- 0:00:12
791500 -- [-291.049] (-294.348) (-296.430) (-290.533) * (-291.041) (-294.626) [-291.813] (-290.156) -- 0:00:12
792000 -- [-291.257] (-290.621) (-291.546) (-290.020) * (-290.867) (-295.582) (-290.422) [-291.071] -- 0:00:12
792500 -- (-292.143) (-289.498) [-293.428] (-292.452) * (-292.184) [-292.410] (-291.094) (-290.748) -- 0:00:12
793000 -- (-289.899) [-289.886] (-290.569) (-290.990) * (-292.694) (-289.048) (-294.634) [-295.871] -- 0:00:12
793500 -- [-291.613] (-290.706) (-294.549) (-292.281) * (-289.269) (-289.779) (-290.950) [-290.431] -- 0:00:11
794000 -- (-298.034) (-291.526) [-289.623] (-290.686) * (-289.097) [-290.380] (-291.037) (-289.922) -- 0:00:11
794500 -- [-291.334] (-293.571) (-290.157) (-291.633) * (-288.963) [-289.621] (-289.754) (-296.231) -- 0:00:11
795000 -- (-291.918) (-292.795) [-293.764] (-295.096) * (-289.494) (-292.463) [-290.520] (-291.678) -- 0:00:11
Average standard deviation of split frequencies: 0.008883
795500 -- (-291.104) (-291.086) [-293.432] (-291.654) * (-290.372) [-290.230] (-290.181) (-289.883) -- 0:00:11
796000 -- (-293.607) (-290.018) (-290.692) [-289.919] * (-291.271) (-293.202) [-292.326] (-297.292) -- 0:00:11
796500 -- [-291.447] (-290.160) (-292.367) (-289.874) * (-294.898) (-291.296) (-291.842) [-292.025] -- 0:00:11
797000 -- (-290.781) (-291.757) (-289.489) [-289.417] * (-293.053) (-289.182) [-295.248] (-291.361) -- 0:00:11
797500 -- (-290.678) [-294.185] (-290.173) (-289.019) * (-294.390) [-293.134] (-290.269) (-295.733) -- 0:00:11
798000 -- (-290.408) (-291.756) [-291.591] (-289.705) * (-292.711) [-290.789] (-289.756) (-296.181) -- 0:00:11
798500 -- (-292.096) (-290.925) [-289.275] (-290.758) * (-291.196) (-290.993) [-291.695] (-290.299) -- 0:00:11
799000 -- (-291.067) (-292.283) [-289.452] (-290.167) * (-301.762) (-289.043) [-292.642] (-288.742) -- 0:00:11
799500 -- (-293.066) (-290.842) (-289.852) [-289.412] * (-293.248) [-290.603] (-290.199) (-291.520) -- 0:00:11
800000 -- [-291.520] (-289.821) (-294.269) (-289.275) * [-292.654] (-291.188) (-293.353) (-292.251) -- 0:00:11
Average standard deviation of split frequencies: 0.008758
800500 -- (-292.980) (-292.383) [-290.071] (-294.110) * [-296.173] (-293.927) (-288.833) (-292.810) -- 0:00:11
801000 -- (-291.220) (-289.777) [-290.956] (-291.638) * (-290.527) (-291.832) (-294.970) [-293.226] -- 0:00:11
801500 -- (-292.107) [-290.726] (-291.846) (-291.104) * (-293.634) (-290.655) [-295.521] (-299.364) -- 0:00:11
802000 -- [-289.741] (-290.536) (-292.790) (-293.690) * [-292.169] (-295.183) (-289.944) (-290.012) -- 0:00:11
802500 -- (-290.469) [-290.738] (-292.150) (-290.511) * (-292.091) [-290.067] (-291.863) (-289.800) -- 0:00:11
803000 -- (-291.410) [-292.139] (-289.199) (-292.496) * (-290.057) (-294.207) [-290.995] (-290.949) -- 0:00:11
803500 -- (-294.605) (-291.109) [-295.845] (-295.598) * (-290.331) (-293.289) (-292.279) [-289.645] -- 0:00:11
804000 -- (-290.207) (-291.252) [-295.310] (-297.824) * (-290.637) (-294.854) [-291.047] (-290.447) -- 0:00:11
804500 -- [-290.580] (-297.460) (-295.367) (-294.487) * [-294.279] (-295.016) (-289.675) (-291.836) -- 0:00:11
805000 -- (-289.397) (-291.259) [-297.989] (-293.390) * (-296.876) [-290.123] (-293.963) (-289.536) -- 0:00:11
Average standard deviation of split frequencies: 0.008919
805500 -- (-290.214) [-291.481] (-297.359) (-291.349) * [-292.850] (-290.376) (-288.935) (-290.458) -- 0:00:11
806000 -- (-290.135) (-290.240) [-291.066] (-290.352) * (-289.994) (-290.239) [-289.172] (-291.249) -- 0:00:11
806500 -- (-290.445) [-289.309] (-291.491) (-291.997) * (-291.745) [-291.638] (-290.225) (-294.099) -- 0:00:11
807000 -- (-290.134) (-289.365) [-292.587] (-290.198) * [-291.710] (-291.054) (-290.187) (-291.293) -- 0:00:11
807500 -- (-292.731) [-292.339] (-289.575) (-292.522) * (-291.338) (-289.807) [-290.742] (-291.184) -- 0:00:11
808000 -- [-292.654] (-292.801) (-289.624) (-290.906) * (-290.457) [-292.411] (-291.523) (-292.333) -- 0:00:11
808500 -- (-290.059) [-291.961] (-289.427) (-289.242) * (-291.261) (-290.491) (-289.318) [-291.886] -- 0:00:11
809000 -- (-291.567) (-292.092) [-290.196] (-290.200) * (-292.768) (-291.583) (-297.297) [-290.438] -- 0:00:11
809500 -- (-290.045) (-290.537) (-289.723) [-290.486] * (-291.750) (-292.541) [-296.333] (-289.629) -- 0:00:11
810000 -- (-289.546) (-290.244) [-289.225] (-296.287) * (-290.799) [-291.451] (-290.828) (-289.459) -- 0:00:11
Average standard deviation of split frequencies: 0.008832
810500 -- (-292.109) (-294.631) [-289.079] (-296.171) * (-289.955) [-289.187] (-292.161) (-291.815) -- 0:00:10
811000 -- (-290.330) [-290.872] (-289.858) (-291.349) * (-291.444) [-289.378] (-291.392) (-294.752) -- 0:00:10
811500 -- (-289.228) (-290.916) [-291.391] (-292.586) * (-290.199) (-295.406) [-294.534] (-291.705) -- 0:00:10
812000 -- (-291.187) [-289.069] (-292.595) (-289.314) * (-295.254) (-291.355) (-295.993) [-295.233] -- 0:00:10
812500 -- [-290.387] (-289.690) (-290.970) (-290.577) * (-292.005) (-296.059) (-291.863) [-291.528] -- 0:00:10
813000 -- (-290.617) [-291.000] (-293.748) (-291.663) * (-290.483) [-290.761] (-291.134) (-290.205) -- 0:00:10
813500 -- (-290.907) (-290.322) (-297.132) [-294.556] * (-291.580) [-293.162] (-291.556) (-291.301) -- 0:00:10
814000 -- (-291.000) [-289.583] (-294.449) (-293.318) * (-292.096) [-291.462] (-290.104) (-290.670) -- 0:00:10
814500 -- [-291.801] (-290.382) (-293.272) (-295.220) * (-289.182) (-290.893) [-290.745] (-290.232) -- 0:00:10
815000 -- [-290.390] (-290.097) (-292.293) (-291.330) * (-290.103) [-290.313] (-292.171) (-294.855) -- 0:00:10
Average standard deviation of split frequencies: 0.008774
815500 -- [-293.771] (-289.307) (-292.686) (-292.704) * (-290.117) (-291.367) [-289.729] (-290.575) -- 0:00:10
816000 -- (-295.622) (-290.892) [-296.344] (-294.576) * (-289.309) (-289.986) [-292.606] (-291.083) -- 0:00:10
816500 -- (-290.695) [-291.139] (-291.052) (-292.712) * (-291.615) (-289.911) [-289.020] (-295.224) -- 0:00:10
817000 -- (-289.517) [-290.628] (-293.309) (-294.387) * (-295.194) (-290.413) (-294.117) [-292.502] -- 0:00:10
817500 -- [-290.998] (-289.607) (-292.935) (-293.445) * (-289.810) (-290.008) [-290.954] (-289.087) -- 0:00:10
818000 -- (-290.574) (-290.611) [-290.944] (-290.892) * [-291.471] (-289.290) (-292.162) (-292.160) -- 0:00:10
818500 -- (-290.128) [-294.238] (-291.334) (-289.985) * (-292.490) [-290.648] (-291.935) (-291.648) -- 0:00:10
819000 -- (-292.011) (-294.456) [-289.783] (-291.122) * (-292.148) (-289.498) [-293.572] (-292.417) -- 0:00:10
819500 -- (-292.434) [-289.487] (-289.322) (-290.766) * (-294.797) [-290.511] (-291.341) (-290.876) -- 0:00:10
820000 -- (-293.996) (-290.655) [-290.447] (-294.497) * (-292.471) (-292.672) (-291.984) [-292.616] -- 0:00:10
Average standard deviation of split frequencies: 0.008796
820500 -- (-293.639) [-291.618] (-290.453) (-291.110) * (-295.379) (-293.296) [-289.324] (-295.539) -- 0:00:10
821000 -- (-295.464) [-292.685] (-291.508) (-292.498) * (-291.517) [-291.046] (-291.152) (-290.919) -- 0:00:10
821500 -- (-290.283) [-290.126] (-290.069) (-295.067) * (-290.446) (-292.203) (-289.438) [-289.316] -- 0:00:10
822000 -- (-292.228) (-295.747) (-292.856) [-289.708] * (-289.174) [-293.986] (-289.784) (-290.224) -- 0:00:10
822500 -- (-294.046) (-291.088) [-289.819] (-293.432) * (-291.476) (-290.841) [-291.560] (-289.312) -- 0:00:10
823000 -- (-293.457) (-289.498) (-291.177) [-290.801] * (-289.883) (-290.973) (-292.310) [-288.783] -- 0:00:10
823500 -- (-290.943) (-290.489) (-290.443) [-289.552] * (-289.822) [-289.881] (-292.608) (-291.114) -- 0:00:10
824000 -- (-290.533) [-289.202] (-289.574) (-293.595) * (-289.668) (-291.356) (-291.522) [-291.186] -- 0:00:10
824500 -- (-290.691) [-292.056] (-289.124) (-290.020) * (-292.722) (-292.414) (-289.979) [-292.453] -- 0:00:10
825000 -- (-292.776) (-290.734) (-289.215) [-293.176] * (-292.060) (-292.235) (-290.506) [-292.526] -- 0:00:10
Average standard deviation of split frequencies: 0.008668
825500 -- [-292.858] (-299.098) (-290.127) (-293.970) * (-292.378) (-292.441) (-291.940) [-291.361] -- 0:00:10
826000 -- (-294.584) (-294.464) (-289.995) [-294.690] * (-292.307) (-290.634) (-291.824) [-289.598] -- 0:00:10
826500 -- (-294.026) (-293.513) [-290.439] (-289.402) * (-291.934) [-292.982] (-291.245) (-289.655) -- 0:00:10
827000 -- (-290.589) (-292.729) [-290.272] (-289.041) * (-290.643) (-290.518) [-290.254] (-291.211) -- 0:00:10
827500 -- (-290.863) (-291.438) [-291.409] (-291.181) * [-289.305] (-289.564) (-291.578) (-289.396) -- 0:00:10
828000 -- (-290.118) (-289.559) [-289.883] (-291.311) * [-290.596] (-290.618) (-291.985) (-295.150) -- 0:00:09
828500 -- (-292.140) (-290.349) [-291.460] (-289.364) * (-291.620) (-290.582) (-291.432) [-291.612] -- 0:00:09
829000 -- (-293.596) (-293.971) (-291.546) [-289.666] * (-291.168) (-290.012) [-290.554] (-294.532) -- 0:00:09
829500 -- (-293.977) (-291.613) [-291.493] (-291.178) * (-291.062) [-288.880] (-291.756) (-292.338) -- 0:00:09
830000 -- (-289.438) [-292.196] (-290.776) (-290.538) * (-293.186) [-290.087] (-294.265) (-289.771) -- 0:00:09
Average standard deviation of split frequencies: 0.009013
830500 -- (-294.633) (-293.750) [-294.109] (-290.412) * (-290.255) [-291.490] (-291.268) (-289.863) -- 0:00:09
831000 -- [-291.103] (-290.406) (-292.614) (-292.635) * (-290.266) (-289.964) [-291.731] (-290.796) -- 0:00:09
831500 -- (-291.424) (-291.725) (-291.165) [-290.629] * [-292.461] (-298.151) (-289.836) (-292.456) -- 0:00:09
832000 -- [-291.377] (-291.469) (-295.104) (-290.102) * (-289.201) (-293.979) (-291.170) [-289.347] -- 0:00:09
832500 -- [-290.395] (-291.855) (-294.803) (-291.931) * (-291.672) (-292.312) (-290.644) [-293.151] -- 0:00:09
833000 -- (-293.265) [-290.242] (-290.482) (-293.393) * [-290.624] (-294.588) (-294.129) (-290.353) -- 0:00:09
833500 -- (-292.445) (-289.963) [-291.827] (-292.341) * (-290.025) (-292.552) (-290.881) [-294.509] -- 0:00:09
834000 -- (-292.276) (-290.074) [-290.325] (-291.993) * (-290.624) (-290.158) [-296.464] (-291.666) -- 0:00:09
834500 -- [-290.550] (-289.453) (-289.975) (-291.074) * (-289.450) [-290.278] (-293.011) (-291.628) -- 0:00:09
835000 -- (-290.401) (-291.331) (-291.049) [-296.923] * (-288.974) (-294.290) (-290.706) [-290.636] -- 0:00:09
Average standard deviation of split frequencies: 0.008212
835500 -- (-291.466) (-290.146) [-292.814] (-295.951) * (-289.140) (-291.665) [-290.014] (-291.399) -- 0:00:09
836000 -- (-289.390) [-289.020] (-292.206) (-291.193) * (-289.475) [-290.859] (-290.734) (-292.258) -- 0:00:09
836500 -- (-293.582) (-291.873) (-289.665) [-292.529] * [-289.018] (-296.074) (-291.052) (-290.874) -- 0:00:09
837000 -- (-293.947) [-290.701] (-288.973) (-289.283) * (-295.334) [-289.812] (-290.987) (-289.686) -- 0:00:09
837500 -- (-293.701) (-290.084) (-290.386) [-290.201] * (-291.613) (-296.589) (-292.298) [-290.516] -- 0:00:09
838000 -- (-293.010) [-291.406] (-289.768) (-294.753) * (-291.328) (-294.222) [-291.297] (-291.232) -- 0:00:09
838500 -- (-289.385) (-296.006) [-290.279] (-290.897) * [-292.459] (-292.715) (-290.643) (-292.369) -- 0:00:09
839000 -- (-289.798) [-294.443] (-289.250) (-289.632) * (-291.894) (-295.265) [-290.021] (-290.425) -- 0:00:09
839500 -- (-290.511) (-289.854) (-290.740) [-291.900] * (-290.039) (-291.739) (-294.811) [-289.196] -- 0:00:09
840000 -- (-289.881) [-292.541] (-292.562) (-293.967) * (-290.919) [-292.990] (-289.691) (-290.022) -- 0:00:09
Average standard deviation of split frequencies: 0.008271
840500 -- (-291.255) (-290.780) (-289.981) [-289.650] * (-293.424) (-293.524) [-291.286] (-290.878) -- 0:00:09
841000 -- (-289.252) (-296.300) [-290.459] (-290.642) * (-295.075) (-294.114) (-295.177) [-289.167] -- 0:00:09
841500 -- (-294.258) [-292.476] (-289.040) (-290.885) * (-293.774) (-294.723) (-289.284) [-290.273] -- 0:00:09
842000 -- [-290.125] (-294.765) (-290.678) (-290.819) * (-291.372) [-298.166] (-290.259) (-292.411) -- 0:00:09
842500 -- (-290.239) [-290.484] (-290.191) (-294.571) * (-291.248) (-290.121) [-290.084] (-289.749) -- 0:00:09
843000 -- (-289.448) (-292.529) (-292.032) [-290.021] * [-291.850] (-292.615) (-291.061) (-292.263) -- 0:00:09
843500 -- (-294.075) (-290.826) (-294.305) [-290.549] * (-291.634) [-291.065] (-291.166) (-291.407) -- 0:00:09
844000 -- (-289.564) (-292.530) (-297.513) [-294.940] * [-291.397] (-290.429) (-295.336) (-293.684) -- 0:00:09
844500 -- (-292.611) (-290.672) (-296.275) [-293.906] * [-288.899] (-290.191) (-293.174) (-295.263) -- 0:00:09
845000 -- (-289.449) (-290.812) (-292.371) [-290.502] * (-293.433) (-290.958) (-291.834) [-295.613] -- 0:00:08
Average standard deviation of split frequencies: 0.008498
845500 -- (-289.383) [-293.244] (-290.339) (-290.181) * [-292.912] (-290.663) (-291.585) (-292.983) -- 0:00:08
846000 -- (-294.918) [-291.320] (-289.817) (-290.857) * (-292.736) [-291.155] (-296.837) (-290.928) -- 0:00:08
846500 -- (-290.872) [-289.637] (-293.194) (-291.932) * (-291.293) (-291.014) (-295.207) [-289.193] -- 0:00:08
847000 -- (-291.842) (-289.673) (-291.423) [-291.101] * [-290.654] (-293.474) (-294.522) (-288.936) -- 0:00:08
847500 -- (-289.432) (-291.284) (-291.567) [-289.345] * [-291.300] (-292.578) (-294.913) (-290.834) -- 0:00:08
848000 -- [-291.283] (-290.453) (-289.869) (-291.149) * [-290.218] (-291.171) (-293.154) (-290.457) -- 0:00:08
848500 -- (-291.079) (-290.584) (-292.700) [-292.438] * (-293.390) (-289.832) [-291.890] (-289.416) -- 0:00:08
849000 -- [-293.754] (-291.040) (-290.141) (-294.247) * (-290.854) (-291.640) (-289.506) [-291.193] -- 0:00:08
849500 -- (-297.580) (-293.268) [-292.363] (-291.938) * [-289.497] (-291.000) (-291.923) (-292.200) -- 0:00:08
850000 -- (-295.116) (-295.066) [-290.947] (-290.694) * [-292.235] (-291.074) (-293.146) (-292.773) -- 0:00:08
Average standard deviation of split frequencies: 0.008347
850500 -- [-291.666] (-292.977) (-292.262) (-295.216) * [-289.862] (-290.146) (-290.563) (-290.209) -- 0:00:08
851000 -- [-290.946] (-293.725) (-291.409) (-293.923) * (-290.155) (-297.916) [-293.495] (-289.509) -- 0:00:08
851500 -- (-293.832) [-289.956] (-292.924) (-293.185) * (-289.934) (-296.369) [-293.222] (-289.793) -- 0:00:08
852000 -- (-292.701) (-289.562) (-292.582) [-291.778] * (-290.772) [-294.087] (-289.140) (-289.893) -- 0:00:08
852500 -- (-297.049) [-290.843] (-293.198) (-289.670) * [-289.438] (-296.512) (-294.973) (-293.469) -- 0:00:08
853000 -- (-293.123) (-295.280) (-291.343) [-289.078] * (-291.722) [-291.842] (-297.808) (-290.707) -- 0:00:08
853500 -- (-295.935) (-291.855) (-291.422) [-290.419] * [-291.472] (-292.588) (-295.397) (-295.836) -- 0:00:08
854000 -- (-291.413) (-296.144) [-290.766] (-291.334) * (-291.094) (-294.138) [-292.328] (-293.159) -- 0:00:08
854500 -- (-294.010) (-292.715) [-291.690] (-293.497) * (-292.930) (-292.446) [-290.719] (-292.829) -- 0:00:08
855000 -- (-291.315) (-291.957) (-291.897) [-289.368] * (-292.647) [-291.528] (-292.437) (-291.427) -- 0:00:08
Average standard deviation of split frequencies: 0.008536
855500 -- (-292.722) (-291.004) [-290.449] (-289.585) * (-292.684) [-290.237] (-293.074) (-292.436) -- 0:00:08
856000 -- (-292.259) [-290.953] (-292.817) (-290.204) * [-290.975] (-294.003) (-292.870) (-291.889) -- 0:00:08
856500 -- (-296.053) (-290.799) (-291.785) [-291.441] * (-290.905) (-291.182) (-291.146) [-292.182] -- 0:00:08
857000 -- (-293.420) (-292.165) [-290.383] (-291.584) * (-290.782) [-291.140] (-294.071) (-291.880) -- 0:00:08
857500 -- (-292.577) (-291.734) [-290.276] (-290.967) * [-292.167] (-289.207) (-295.767) (-291.891) -- 0:00:08
858000 -- [-292.165] (-294.821) (-293.237) (-292.049) * (-293.494) [-291.569] (-293.541) (-289.924) -- 0:00:08
858500 -- (-290.070) (-291.123) [-291.426] (-294.755) * (-290.221) (-293.269) [-296.447] (-289.467) -- 0:00:08
859000 -- [-293.035] (-290.137) (-290.816) (-296.077) * (-290.599) (-291.637) [-294.742] (-292.682) -- 0:00:08
859500 -- (-292.455) (-291.300) [-292.468] (-292.320) * (-289.971) (-293.423) [-291.433] (-292.518) -- 0:00:08
860000 -- (-293.370) [-289.807] (-292.898) (-291.067) * [-291.278] (-291.546) (-289.147) (-292.732) -- 0:00:08
Average standard deviation of split frequencies: 0.008284
860500 -- (-297.610) [-292.988] (-294.497) (-289.142) * [-288.950] (-292.763) (-290.011) (-289.813) -- 0:00:08
861000 -- (-292.784) (-291.298) (-290.238) [-289.062] * [-290.918] (-289.397) (-290.782) (-292.035) -- 0:00:08
861500 -- [-292.997] (-290.595) (-292.745) (-291.048) * (-291.987) (-291.965) [-292.128] (-290.716) -- 0:00:08
862000 -- (-289.528) [-290.412] (-290.946) (-289.430) * (-291.159) [-291.769] (-292.689) (-293.641) -- 0:00:08
862500 -- [-291.963] (-289.411) (-289.945) (-290.438) * [-290.714] (-289.632) (-293.581) (-288.975) -- 0:00:07
863000 -- (-290.576) (-289.956) (-294.529) [-293.166] * (-290.775) (-290.845) (-292.993) [-289.290] -- 0:00:07
863500 -- (-297.070) [-290.338] (-288.907) (-295.903) * (-289.383) (-291.406) (-292.059) [-291.762] -- 0:00:07
864000 -- (-294.183) (-289.592) [-289.622] (-293.132) * (-289.578) (-289.751) (-293.916) [-290.782] -- 0:00:07
864500 -- (-290.962) (-292.314) (-292.865) [-290.241] * (-290.329) (-288.864) (-291.811) [-289.788] -- 0:00:07
865000 -- [-291.660] (-291.379) (-292.438) (-290.860) * (-290.569) [-289.204] (-289.317) (-289.264) -- 0:00:07
Average standard deviation of split frequencies: 0.008097
865500 -- (-291.933) [-290.760] (-291.456) (-289.675) * (-290.047) (-292.067) [-290.549] (-289.907) -- 0:00:07
866000 -- [-291.177] (-293.011) (-293.242) (-290.999) * (-292.917) [-290.062] (-290.518) (-292.808) -- 0:00:07
866500 -- (-295.693) (-290.839) (-293.049) [-291.148] * (-291.233) (-293.048) [-291.835] (-290.212) -- 0:00:07
867000 -- (-293.317) [-291.284] (-290.895) (-293.715) * (-291.590) (-293.759) [-290.271] (-289.966) -- 0:00:07
867500 -- (-294.266) [-291.918] (-294.173) (-290.201) * (-289.091) (-292.729) (-291.925) [-294.976] -- 0:00:07
868000 -- (-295.843) [-292.463] (-290.675) (-289.541) * (-290.087) (-290.610) [-289.600] (-291.604) -- 0:00:07
868500 -- (-292.510) (-291.093) (-290.727) [-291.027] * (-290.449) [-289.440] (-293.792) (-293.550) -- 0:00:07
869000 -- (-293.198) (-291.938) (-294.345) [-290.236] * [-290.920] (-293.494) (-289.405) (-291.573) -- 0:00:07
869500 -- (-291.008) (-291.513) [-294.093] (-290.415) * [-290.050] (-290.027) (-289.149) (-290.683) -- 0:00:07
870000 -- (-291.210) [-292.239] (-291.202) (-289.765) * (-291.569) (-290.413) [-292.185] (-295.123) -- 0:00:07
Average standard deviation of split frequencies: 0.007715
870500 -- (-294.142) (-289.171) [-290.153] (-293.123) * [-289.497] (-290.666) (-291.503) (-289.724) -- 0:00:07
871000 -- (-289.747) (-290.823) (-292.942) [-290.403] * (-291.662) [-291.003] (-293.270) (-290.238) -- 0:00:07
871500 -- (-289.809) (-290.650) (-289.854) [-290.325] * (-294.696) [-292.113] (-291.643) (-295.317) -- 0:00:07
872000 -- [-289.337] (-289.412) (-292.132) (-292.022) * [-293.802] (-289.624) (-292.227) (-296.266) -- 0:00:07
872500 -- (-289.141) [-290.891] (-292.648) (-292.115) * (-295.534) [-292.618] (-292.468) (-291.025) -- 0:00:07
873000 -- (-293.691) [-289.344] (-293.237) (-297.661) * [-290.204] (-292.846) (-291.377) (-291.056) -- 0:00:07
873500 -- (-291.155) [-289.461] (-293.885) (-293.110) * (-292.578) (-290.682) (-291.811) [-290.375] -- 0:00:07
874000 -- [-289.792] (-289.476) (-292.871) (-291.395) * [-290.417] (-290.932) (-295.059) (-291.975) -- 0:00:07
874500 -- [-289.915] (-291.826) (-291.537) (-291.430) * [-291.400] (-289.683) (-290.158) (-291.533) -- 0:00:07
875000 -- (-293.150) [-290.658] (-292.667) (-291.020) * (-295.865) (-291.554) [-294.254] (-290.397) -- 0:00:07
Average standard deviation of split frequencies: 0.007399
875500 -- (-295.215) [-290.762] (-292.096) (-289.582) * (-289.622) (-289.511) [-292.026] (-289.594) -- 0:00:07
876000 -- (-290.392) (-292.680) [-289.468] (-290.062) * [-288.933] (-295.302) (-293.759) (-291.544) -- 0:00:07
876500 -- [-291.836] (-291.791) (-293.583) (-292.842) * (-290.680) (-291.538) (-292.868) [-289.443] -- 0:00:07
877000 -- (-292.543) (-291.263) (-290.952) [-290.762] * (-293.026) (-295.216) [-291.148] (-292.365) -- 0:00:07
877500 -- (-291.096) (-289.942) [-289.474] (-293.392) * [-296.738] (-290.863) (-293.366) (-291.438) -- 0:00:07
878000 -- (-292.825) (-289.785) (-292.174) [-293.818] * (-291.309) (-290.444) [-289.724] (-290.151) -- 0:00:07
878500 -- (-291.415) (-291.592) [-290.831] (-293.893) * [-290.211] (-289.539) (-291.189) (-289.612) -- 0:00:07
879000 -- (-290.081) (-291.555) [-291.547] (-291.222) * (-292.495) (-289.647) (-291.298) [-290.536] -- 0:00:07
879500 -- (-293.518) [-290.937] (-292.138) (-290.513) * (-292.380) (-291.162) [-289.559] (-290.708) -- 0:00:06
880000 -- (-294.922) (-289.110) (-291.107) [-292.712] * (-290.655) (-290.774) (-290.084) [-292.826] -- 0:00:06
Average standard deviation of split frequencies: 0.007360
880500 -- (-290.482) (-289.672) [-291.344] (-289.383) * [-291.978] (-291.093) (-291.339) (-290.385) -- 0:00:06
881000 -- (-291.044) (-290.550) [-292.801] (-290.686) * (-293.082) [-290.052] (-291.801) (-293.064) -- 0:00:06
881500 -- [-289.778] (-289.045) (-292.979) (-288.966) * (-291.316) (-291.537) [-295.469] (-290.763) -- 0:00:06
882000 -- (-289.971) (-292.440) (-290.853) [-291.032] * (-289.617) [-290.956] (-293.313) (-293.430) -- 0:00:06
882500 -- (-289.306) (-293.169) [-290.481] (-292.380) * (-290.266) (-290.362) (-290.293) [-291.344] -- 0:00:06
883000 -- [-293.518] (-289.851) (-290.326) (-290.970) * (-290.513) (-289.739) (-293.063) [-290.703] -- 0:00:06
883500 -- (-290.374) (-289.484) (-297.054) [-292.524] * (-290.013) (-295.641) [-292.324] (-292.980) -- 0:00:06
884000 -- (-289.448) [-290.726] (-291.483) (-290.854) * (-292.540) (-290.905) [-291.569] (-289.853) -- 0:00:06
884500 -- (-290.022) (-292.292) (-290.053) [-291.241] * (-290.001) (-292.953) [-290.871] (-291.826) -- 0:00:06
885000 -- (-290.157) (-293.932) (-290.984) [-291.575] * (-290.737) [-289.561] (-291.981) (-292.733) -- 0:00:06
Average standard deviation of split frequencies: 0.007482
885500 -- [-292.385] (-293.997) (-292.918) (-290.952) * (-291.710) (-290.878) (-293.550) [-291.366] -- 0:00:06
886000 -- (-293.774) (-290.280) (-290.095) [-291.643] * [-292.596] (-292.071) (-295.422) (-291.765) -- 0:00:06
886500 -- (-295.494) (-291.554) (-290.137) [-291.423] * [-293.121] (-293.659) (-291.616) (-292.806) -- 0:00:06
887000 -- [-291.610] (-290.184) (-289.596) (-290.264) * (-295.198) (-291.567) (-292.180) [-290.823] -- 0:00:06
887500 -- [-291.823] (-289.833) (-289.916) (-292.168) * (-296.437) [-293.473] (-289.083) (-289.782) -- 0:00:06
888000 -- (-290.861) [-290.418] (-294.756) (-289.730) * (-292.251) (-293.275) [-291.132] (-290.065) -- 0:00:06
888500 -- [-289.490] (-295.005) (-291.840) (-291.498) * (-290.307) [-293.570] (-289.811) (-291.174) -- 0:00:06
889000 -- [-291.689] (-292.923) (-292.727) (-296.346) * [-290.457] (-293.534) (-289.424) (-292.591) -- 0:00:06
889500 -- (-293.200) [-289.404] (-291.262) (-289.910) * (-290.481) (-293.878) [-295.241] (-291.843) -- 0:00:06
890000 -- (-293.999) (-289.190) [-291.899] (-291.423) * [-289.787] (-291.743) (-294.820) (-289.625) -- 0:00:06
Average standard deviation of split frequencies: 0.007178
890500 -- (-294.967) (-289.282) (-292.141) [-291.955] * [-291.599] (-291.729) (-291.259) (-294.329) -- 0:00:06
891000 -- [-293.469] (-290.329) (-290.041) (-292.775) * (-291.244) (-292.208) [-290.100] (-290.683) -- 0:00:06
891500 -- [-291.441] (-292.027) (-292.990) (-290.214) * (-291.373) (-290.593) (-292.730) [-289.539] -- 0:00:06
892000 -- (-292.775) [-291.356] (-295.004) (-290.217) * [-291.036] (-291.655) (-293.295) (-293.009) -- 0:00:06
892500 -- [-291.088] (-289.735) (-295.007) (-289.522) * (-289.712) [-290.705] (-291.823) (-290.775) -- 0:00:06
893000 -- (-289.342) [-291.200] (-291.714) (-290.171) * (-290.302) (-290.222) [-291.766] (-290.168) -- 0:00:06
893500 -- (-294.621) [-291.602] (-291.075) (-292.411) * (-290.163) [-290.944] (-290.526) (-293.452) -- 0:00:06
894000 -- [-290.982] (-291.531) (-294.979) (-292.793) * (-290.200) (-294.292) [-289.066] (-290.703) -- 0:00:06
894500 -- (-290.203) [-290.908] (-294.798) (-290.435) * (-289.261) (-293.216) [-292.103] (-293.831) -- 0:00:06
895000 -- (-289.830) (-292.357) [-290.111] (-292.064) * (-289.361) (-292.040) [-293.275] (-289.388) -- 0:00:06
Average standard deviation of split frequencies: 0.007300
895500 -- (-291.294) (-292.431) [-289.385] (-290.551) * [-291.090] (-289.563) (-289.023) (-290.058) -- 0:00:06
896000 -- (-291.879) (-293.413) [-288.947] (-291.744) * [-293.016] (-291.488) (-294.313) (-291.174) -- 0:00:06
896500 -- (-293.458) (-293.244) [-292.791] (-297.930) * [-295.541] (-290.162) (-291.756) (-290.602) -- 0:00:06
897000 -- [-292.000] (-290.292) (-289.760) (-291.051) * (-297.382) (-290.218) [-289.972] (-293.924) -- 0:00:05
897500 -- (-293.795) [-290.820] (-293.895) (-290.738) * (-289.776) [-291.017] (-293.357) (-297.181) -- 0:00:05
898000 -- [-290.960] (-291.709) (-291.991) (-294.060) * [-289.621] (-291.251) (-294.375) (-294.496) -- 0:00:05
898500 -- (-290.466) (-292.772) [-291.982] (-288.749) * (-291.019) (-293.965) [-292.741] (-293.766) -- 0:00:05
899000 -- (-294.334) (-298.329) (-290.095) [-290.569] * [-291.011] (-289.778) (-294.473) (-290.624) -- 0:00:05
899500 -- [-291.212] (-291.864) (-292.513) (-292.484) * (-290.059) (-289.636) (-292.495) [-290.112] -- 0:00:05
900000 -- (-294.495) (-291.202) (-290.801) [-291.192] * (-290.552) [-292.724] (-291.676) (-292.107) -- 0:00:05
Average standard deviation of split frequencies: 0.007164
900500 -- (-292.358) (-295.609) [-288.720] (-290.194) * (-290.009) (-294.131) (-294.319) [-292.423] -- 0:00:05
901000 -- (-290.129) (-291.859) [-291.727] (-291.053) * (-289.567) [-292.033] (-295.374) (-290.656) -- 0:00:05
901500 -- (-294.903) [-293.103] (-292.661) (-289.049) * [-290.485] (-291.749) (-293.633) (-289.448) -- 0:00:05
902000 -- (-298.869) [-290.955] (-292.943) (-291.416) * (-289.135) (-290.405) (-294.023) [-290.047] -- 0:00:05
902500 -- (-292.428) [-290.628] (-292.953) (-292.632) * (-290.792) (-293.902) (-289.753) [-290.062] -- 0:00:05
903000 -- (-291.631) (-292.330) [-290.302] (-289.960) * (-289.882) (-292.972) [-290.031] (-291.338) -- 0:00:05
903500 -- (-295.461) (-291.336) [-289.727] (-291.793) * (-290.348) (-290.044) [-291.743] (-293.541) -- 0:00:05
904000 -- (-290.371) (-299.642) (-292.941) [-292.755] * (-290.283) (-289.976) (-291.831) [-292.561] -- 0:00:05
904500 -- (-291.521) (-291.259) [-290.825] (-290.879) * [-289.637] (-290.933) (-296.962) (-289.024) -- 0:00:05
905000 -- (-289.896) [-295.916] (-292.322) (-291.637) * (-289.911) (-290.173) (-291.013) [-289.528] -- 0:00:05
Average standard deviation of split frequencies: 0.007447
905500 -- (-290.171) (-297.585) [-289.609] (-292.010) * (-295.024) (-293.313) [-292.773] (-289.481) -- 0:00:05
906000 -- (-293.934) [-290.482] (-291.406) (-290.265) * (-293.011) (-296.937) [-289.855] (-289.130) -- 0:00:05
906500 -- (-289.721) (-291.753) (-291.151) [-297.877] * (-290.756) (-295.341) [-290.686] (-291.008) -- 0:00:05
907000 -- (-288.879) (-291.465) (-293.279) [-290.833] * (-289.948) (-291.432) (-290.085) [-290.279] -- 0:00:05
907500 -- [-294.395] (-291.744) (-293.039) (-292.305) * (-290.031) [-291.029] (-291.526) (-289.953) -- 0:00:05
908000 -- (-289.760) (-291.151) [-290.797] (-293.365) * [-291.717] (-291.678) (-292.972) (-294.442) -- 0:00:05
908500 -- [-291.332] (-289.658) (-290.723) (-293.808) * (-290.889) [-290.879] (-296.730) (-290.673) -- 0:00:05
909000 -- (-291.446) [-289.543] (-291.820) (-295.383) * (-289.990) [-289.497] (-293.093) (-289.795) -- 0:00:05
909500 -- (-291.473) (-290.318) (-289.623) [-295.842] * (-291.371) [-289.817] (-290.351) (-291.019) -- 0:00:05
910000 -- (-293.202) [-290.445] (-289.127) (-289.875) * (-291.846) (-289.685) [-293.769] (-292.367) -- 0:00:05
Average standard deviation of split frequencies: 0.007409
910500 -- [-290.066] (-289.938) (-289.609) (-290.554) * (-290.093) [-289.256] (-292.167) (-291.705) -- 0:00:05
911000 -- [-289.730] (-295.300) (-293.381) (-290.503) * (-291.115) (-290.131) [-290.248] (-291.683) -- 0:00:05
911500 -- (-289.847) [-290.536] (-293.973) (-289.289) * (-291.958) (-294.519) [-290.644] (-290.225) -- 0:00:05
912000 -- [-293.377] (-290.693) (-293.148) (-289.925) * [-292.766] (-291.209) (-293.542) (-290.585) -- 0:00:05
912500 -- (-291.824) (-291.289) (-293.490) [-290.590] * (-291.359) (-292.028) [-292.910] (-295.595) -- 0:00:05
913000 -- [-293.249] (-289.974) (-289.659) (-290.039) * [-291.291] (-289.420) (-293.351) (-291.540) -- 0:00:05
913500 -- (-291.271) [-289.550] (-289.605) (-291.600) * [-293.977] (-289.636) (-292.341) (-291.468) -- 0:00:05
914000 -- [-291.293] (-293.044) (-288.906) (-290.763) * [-292.514] (-291.727) (-294.161) (-291.041) -- 0:00:04
914500 -- (-292.940) (-290.876) [-292.170] (-289.519) * (-291.018) (-290.615) (-290.914) [-289.625] -- 0:00:04
915000 -- (-292.036) [-292.534] (-290.294) (-291.571) * [-289.505] (-291.705) (-290.628) (-293.639) -- 0:00:04
Average standard deviation of split frequencies: 0.007462
915500 -- [-291.601] (-290.673) (-293.357) (-290.341) * (-290.374) [-291.308] (-289.850) (-293.713) -- 0:00:04
916000 -- [-294.214] (-291.466) (-294.105) (-292.906) * [-291.020] (-289.229) (-290.410) (-290.474) -- 0:00:04
916500 -- (-291.901) (-294.087) (-290.935) [-293.424] * [-292.073] (-293.666) (-290.452) (-289.913) -- 0:00:04
917000 -- (-292.302) (-290.739) [-291.811] (-291.168) * [-289.317] (-291.321) (-291.416) (-292.587) -- 0:00:04
917500 -- (-291.033) (-290.258) [-291.049] (-288.817) * (-293.372) (-289.982) (-293.831) [-290.079] -- 0:00:04
918000 -- (-291.099) (-289.741) (-292.273) [-289.624] * (-290.305) (-293.526) [-291.047] (-292.582) -- 0:00:04
918500 -- (-290.380) (-291.177) [-294.002] (-292.846) * (-290.482) (-290.829) [-291.231] (-291.909) -- 0:00:04
919000 -- [-294.994] (-293.105) (-296.888) (-293.315) * (-290.944) (-296.860) [-289.891] (-291.995) -- 0:00:04
919500 -- (-294.161) (-290.369) (-294.924) [-292.684] * (-290.069) (-289.959) (-291.988) [-290.695] -- 0:00:04
920000 -- (-296.258) (-289.524) [-290.197] (-290.237) * (-290.822) (-292.818) [-291.316] (-290.391) -- 0:00:04
Average standard deviation of split frequencies: 0.007392
920500 -- (-294.606) (-299.625) [-289.750] (-292.211) * (-289.583) (-291.984) (-293.041) [-290.902] -- 0:00:04
921000 -- (-296.801) [-289.382] (-292.172) (-290.464) * [-291.894] (-292.826) (-291.843) (-290.779) -- 0:00:04
921500 -- (-292.711) (-289.003) (-289.882) [-289.082] * (-290.366) [-288.978] (-297.236) (-291.694) -- 0:00:04
922000 -- (-290.509) [-291.934] (-290.734) (-290.884) * (-292.211) (-289.592) (-296.942) [-290.294] -- 0:00:04
922500 -- (-290.403) (-290.059) (-292.982) [-291.505] * (-291.993) (-290.304) (-298.789) [-289.996] -- 0:00:04
923000 -- (-289.892) (-291.973) [-289.858] (-290.459) * (-290.824) (-292.423) (-294.996) [-291.314] -- 0:00:04
923500 -- (-293.773) (-293.136) (-289.163) [-290.891] * [-291.461] (-295.482) (-292.360) (-291.205) -- 0:00:04
924000 -- (-290.941) (-289.911) (-289.127) [-289.760] * (-291.284) (-293.657) [-291.039] (-289.206) -- 0:00:04
924500 -- [-292.118] (-291.743) (-290.061) (-291.677) * [-296.949] (-293.421) (-290.032) (-292.314) -- 0:00:04
925000 -- [-288.783] (-293.284) (-290.095) (-297.648) * (-292.778) [-290.948] (-291.278) (-294.353) -- 0:00:04
Average standard deviation of split frequencies: 0.007382
925500 -- (-293.129) (-291.024) (-291.233) [-290.476] * [-289.505] (-291.258) (-295.362) (-296.083) -- 0:00:04
926000 -- (-290.575) (-289.476) (-292.501) [-290.501] * [-288.964] (-290.802) (-294.048) (-290.112) -- 0:00:04
926500 -- (-293.117) (-291.023) [-290.592] (-289.485) * (-290.073) (-292.341) (-293.162) [-290.094] -- 0:00:04
927000 -- (-294.348) (-291.648) (-290.217) [-289.171] * [-292.332] (-292.237) (-291.201) (-296.023) -- 0:00:04
927500 -- (-293.292) (-290.411) [-289.081] (-293.069) * (-294.403) [-291.589] (-290.482) (-290.148) -- 0:00:04
928000 -- (-291.423) [-289.482] (-290.518) (-290.302) * [-289.630] (-291.885) (-292.682) (-293.174) -- 0:00:04
928500 -- (-290.092) [-291.365] (-293.922) (-290.273) * (-290.395) (-291.952) (-292.281) [-294.835] -- 0:00:04
929000 -- (-291.621) (-289.573) (-293.655) [-290.484] * (-291.994) [-289.890] (-292.929) (-294.708) -- 0:00:04
929500 -- (-291.058) [-290.752] (-292.004) (-295.554) * (-289.844) (-290.243) [-290.124] (-291.482) -- 0:00:04
930000 -- (-289.871) (-292.914) [-292.588] (-291.348) * [-292.494] (-289.542) (-291.720) (-291.939) -- 0:00:04
Average standard deviation of split frequencies: 0.007345
930500 -- (-293.986) (-290.250) [-290.547] (-290.111) * [-292.008] (-290.698) (-292.202) (-292.364) -- 0:00:04
931000 -- (-292.597) (-290.796) (-292.522) [-288.721] * (-290.527) [-290.649] (-291.601) (-290.286) -- 0:00:04
931500 -- (-289.444) [-291.650] (-290.697) (-289.345) * (-289.636) [-290.435] (-290.283) (-290.643) -- 0:00:03
932000 -- (-293.353) (-293.610) [-289.685] (-290.585) * (-289.206) (-293.583) (-294.125) [-290.301] -- 0:00:03
932500 -- (-291.281) (-291.152) (-291.591) [-291.871] * (-291.054) (-288.742) (-289.938) [-290.091] -- 0:00:03
933000 -- [-291.048] (-291.070) (-292.293) (-291.379) * (-289.843) [-288.841] (-290.130) (-291.296) -- 0:00:03
933500 -- (-289.890) (-290.526) [-291.149] (-289.655) * (-292.220) (-289.195) (-292.952) [-292.595] -- 0:00:03
934000 -- (-289.939) (-295.417) (-291.249) [-293.152] * (-290.777) (-290.767) [-293.021] (-291.091) -- 0:00:03
934500 -- (-289.714) (-292.920) [-290.515] (-290.386) * (-293.221) [-292.449] (-296.487) (-290.099) -- 0:00:03
935000 -- [-289.818] (-291.039) (-291.395) (-292.063) * [-290.894] (-289.677) (-299.026) (-293.258) -- 0:00:03
Average standard deviation of split frequencies: 0.007177
935500 -- (-292.197) (-295.092) (-291.820) [-291.634] * (-293.190) (-290.704) [-297.083] (-293.639) -- 0:00:03
936000 -- (-291.670) (-291.462) (-290.290) [-294.816] * (-292.564) (-292.051) (-292.914) [-292.578] -- 0:00:03
936500 -- [-292.295] (-296.270) (-290.343) (-293.826) * (-291.781) (-290.390) (-291.855) [-292.789] -- 0:00:03
937000 -- (-292.272) (-296.855) [-289.757] (-290.622) * (-289.799) [-289.996] (-292.062) (-293.859) -- 0:00:03
937500 -- (-291.973) (-290.081) [-292.184] (-289.926) * [-289.796] (-289.628) (-294.454) (-292.070) -- 0:00:03
938000 -- (-289.787) [-288.901] (-295.815) (-290.832) * [-290.706] (-289.598) (-291.476) (-292.182) -- 0:00:03
938500 -- (-289.179) (-291.952) (-291.202) [-291.178] * (-291.796) [-291.703] (-290.217) (-292.564) -- 0:00:03
939000 -- [-289.231] (-291.666) (-292.096) (-289.319) * [-290.639] (-289.751) (-291.486) (-293.028) -- 0:00:03
939500 -- (-291.651) (-290.036) (-294.807) [-290.041] * (-292.226) [-290.351] (-289.464) (-292.185) -- 0:00:03
940000 -- [-290.707] (-289.516) (-290.931) (-291.675) * (-292.316) (-292.643) (-289.764) [-289.946] -- 0:00:03
Average standard deviation of split frequencies: 0.007454
940500 -- [-290.609] (-289.269) (-294.452) (-291.754) * (-292.463) (-292.313) (-294.793) [-291.016] -- 0:00:03
941000 -- (-290.974) (-290.379) (-290.533) [-290.399] * (-292.188) [-291.764] (-291.531) (-290.427) -- 0:00:03
941500 -- (-290.660) (-291.558) [-290.778] (-291.477) * [-292.649] (-293.313) (-290.697) (-290.349) -- 0:00:03
942000 -- (-291.005) [-289.149] (-290.022) (-292.194) * [-289.803] (-290.878) (-290.015) (-290.186) -- 0:00:03
942500 -- (-290.671) [-289.345] (-290.275) (-291.134) * (-291.143) (-292.563) [-293.284] (-291.316) -- 0:00:03
943000 -- (-289.593) (-292.903) [-290.560] (-291.343) * (-291.207) (-293.801) [-291.179] (-291.299) -- 0:00:03
943500 -- (-289.671) (-293.178) [-292.506] (-290.160) * (-293.145) (-292.011) [-289.650] (-291.281) -- 0:00:03
944000 -- (-289.919) (-289.785) (-289.193) [-289.840] * [-293.179] (-292.743) (-294.942) (-292.996) -- 0:00:03
944500 -- (-289.819) (-293.776) (-290.715) [-290.515] * (-291.904) (-290.483) [-295.183] (-291.661) -- 0:00:03
945000 -- [-292.304] (-293.259) (-289.429) (-295.786) * (-293.094) (-290.455) (-294.160) [-292.581] -- 0:00:03
Average standard deviation of split frequencies: 0.007257
945500 -- [-290.155] (-290.490) (-293.731) (-293.479) * [-292.261] (-292.805) (-295.392) (-294.648) -- 0:00:03
946000 -- (-291.262) (-290.443) [-289.621] (-289.256) * (-291.088) (-290.876) (-295.178) [-289.121] -- 0:00:03
946500 -- (-291.181) [-293.072] (-291.968) (-292.497) * [-289.861] (-289.522) (-294.706) (-291.117) -- 0:00:03
947000 -- (-297.035) (-295.538) [-290.039] (-294.546) * (-291.835) [-294.520] (-295.614) (-291.791) -- 0:00:03
947500 -- (-292.216) (-291.584) (-294.772) [-289.451] * (-293.206) (-292.163) [-293.722] (-291.160) -- 0:00:03
948000 -- (-291.896) (-290.807) [-292.411] (-292.152) * (-293.889) (-291.213) [-292.439] (-291.929) -- 0:00:03
948500 -- (-290.382) [-292.995] (-290.273) (-290.717) * [-290.560] (-289.569) (-290.363) (-289.430) -- 0:00:02
949000 -- (-291.487) (-289.740) [-291.379] (-292.206) * (-293.252) [-293.713] (-294.345) (-289.986) -- 0:00:02
949500 -- [-290.290] (-291.068) (-289.258) (-291.040) * [-295.588] (-294.551) (-294.080) (-290.656) -- 0:00:02
950000 -- (-290.300) (-289.457) (-290.566) [-291.162] * [-290.388] (-290.124) (-290.415) (-291.032) -- 0:00:02
Average standard deviation of split frequencies: 0.007500
950500 -- (-292.530) (-291.229) (-289.346) [-290.734] * (-292.798) [-291.934] (-289.635) (-293.834) -- 0:00:02
951000 -- (-292.022) (-289.735) [-293.725] (-289.796) * (-290.952) [-290.799] (-292.041) (-289.941) -- 0:00:02
951500 -- (-291.406) (-289.755) (-293.713) [-293.260] * (-291.749) (-292.791) [-294.606] (-289.344) -- 0:00:02
952000 -- (-292.677) (-292.919) (-292.630) [-292.076] * [-293.756] (-289.780) (-291.058) (-289.726) -- 0:00:02
952500 -- (-292.680) [-289.898] (-291.744) (-291.736) * (-291.419) (-291.157) (-290.859) [-291.268] -- 0:00:02
953000 -- [-291.372] (-288.873) (-292.128) (-291.919) * (-291.762) [-290.575] (-289.898) (-291.837) -- 0:00:02
953500 -- [-290.487] (-291.778) (-289.260) (-292.666) * [-290.059] (-291.307) (-291.208) (-289.565) -- 0:00:02
954000 -- [-292.159] (-291.203) (-290.944) (-290.166) * (-293.154) (-291.042) [-290.088] (-291.538) -- 0:00:02
954500 -- (-292.662) (-297.188) [-290.388] (-289.589) * (-294.139) [-292.146] (-288.911) (-290.409) -- 0:00:02
955000 -- [-291.663] (-294.740) (-292.589) (-291.867) * (-291.684) [-293.545] (-289.059) (-290.097) -- 0:00:02
Average standard deviation of split frequencies: 0.007366
955500 -- (-291.248) (-296.036) [-292.181] (-291.759) * (-295.381) (-293.646) [-290.587] (-293.057) -- 0:00:02
956000 -- (-291.189) [-292.057] (-291.483) (-298.882) * [-290.833] (-290.861) (-289.866) (-290.633) -- 0:00:02
956500 -- [-289.644] (-294.698) (-292.501) (-291.241) * (-294.562) (-291.610) [-289.756] (-289.509) -- 0:00:02
957000 -- (-291.436) (-292.369) [-291.711] (-289.944) * [-289.872] (-292.010) (-290.696) (-290.470) -- 0:00:02
957500 -- (-291.552) (-290.844) (-292.384) [-293.532] * [-293.199] (-292.229) (-290.990) (-289.712) -- 0:00:02
958000 -- (-293.111) (-290.653) [-290.681] (-290.444) * (-290.292) [-292.646] (-290.763) (-291.613) -- 0:00:02
958500 -- [-290.008] (-290.195) (-291.020) (-293.215) * [-290.430] (-288.967) (-292.114) (-290.864) -- 0:00:02
959000 -- (-293.466) [-290.976] (-289.718) (-293.462) * (-289.845) (-290.123) (-290.018) [-289.601] -- 0:00:02
959500 -- (-293.822) [-290.558] (-291.684) (-292.250) * (-291.384) (-289.976) (-290.806) [-293.665] -- 0:00:02
960000 -- (-297.748) (-292.851) (-290.927) [-289.721] * [-289.540] (-294.696) (-292.921) (-289.876) -- 0:00:02
Average standard deviation of split frequencies: 0.007575
960500 -- (-290.040) [-292.377] (-291.589) (-289.181) * [-290.771] (-291.972) (-294.559) (-294.338) -- 0:00:02
961000 -- (-290.071) (-292.450) [-290.384] (-291.000) * (-291.561) (-294.545) (-294.859) [-291.215] -- 0:00:02
961500 -- (-290.716) (-292.451) (-291.484) [-292.939] * (-289.869) [-295.905] (-290.881) (-291.885) -- 0:00:02
962000 -- (-290.549) (-294.871) [-291.123] (-289.343) * (-293.920) (-292.443) [-294.830] (-291.916) -- 0:00:02
962500 -- (-292.447) [-289.464] (-290.068) (-293.195) * (-290.629) (-294.012) (-291.397) [-294.231] -- 0:00:02
963000 -- [-289.550] (-292.699) (-291.317) (-290.881) * (-291.374) [-291.237] (-291.558) (-290.003) -- 0:00:02
963500 -- (-289.750) (-292.731) [-291.571] (-290.871) * (-292.412) (-292.541) [-291.391] (-291.265) -- 0:00:02
964000 -- (-290.703) (-291.729) (-290.306) [-289.452] * [-291.834] (-289.340) (-291.759) (-289.721) -- 0:00:02
964500 -- [-292.361] (-293.882) (-292.592) (-289.714) * (-291.977) (-292.327) [-289.545] (-291.909) -- 0:00:02
965000 -- (-293.067) (-290.958) (-289.197) [-291.174] * [-292.518] (-292.672) (-289.798) (-291.457) -- 0:00:02
Average standard deviation of split frequencies: 0.007594
965500 -- [-297.288] (-292.635) (-292.488) (-291.717) * (-290.410) (-289.731) (-290.154) [-291.310] -- 0:00:02
966000 -- (-290.248) (-290.508) [-293.302] (-294.500) * (-291.140) [-292.232] (-289.974) (-290.312) -- 0:00:01
966500 -- (-289.916) (-292.550) (-292.129) [-290.919] * (-292.319) [-290.531] (-292.913) (-290.721) -- 0:00:01
967000 -- (-290.976) (-292.139) [-291.484] (-289.518) * (-290.073) (-290.028) (-290.891) [-292.656] -- 0:00:01
967500 -- (-290.733) [-291.300] (-293.254) (-290.552) * (-289.219) (-290.930) (-290.673) [-291.540] -- 0:00:01
968000 -- (-291.559) (-292.122) [-293.454] (-290.935) * (-291.499) (-290.022) (-292.010) [-289.876] -- 0:00:01
968500 -- (-289.807) (-290.473) [-292.196] (-292.326) * [-290.987] (-293.260) (-291.426) (-289.702) -- 0:00:01
969000 -- (-293.252) (-293.516) [-291.347] (-289.652) * (-292.573) (-292.036) (-292.223) [-290.051] -- 0:00:01
969500 -- (-290.746) (-293.749) [-291.658] (-291.694) * (-293.443) [-289.966] (-289.252) (-292.667) -- 0:00:01
970000 -- (-289.808) (-289.718) [-290.281] (-289.732) * (-292.529) (-291.204) (-294.143) [-290.203] -- 0:00:01
Average standard deviation of split frequencies: 0.007315
970500 -- (-292.843) (-291.639) [-292.412] (-293.444) * [-290.129] (-297.544) (-291.526) (-292.577) -- 0:00:01
971000 -- (-289.617) (-289.860) (-289.522) [-292.149] * [-289.577] (-293.214) (-290.182) (-291.993) -- 0:00:01
971500 -- (-290.724) (-290.135) (-289.306) [-290.071] * (-296.174) (-289.810) [-294.306] (-292.797) -- 0:00:01
972000 -- (-297.448) (-294.279) [-291.117] (-289.907) * (-294.610) (-293.696) [-293.242] (-292.692) -- 0:00:01
972500 -- (-295.172) (-291.150) [-290.172] (-292.297) * (-294.234) (-289.141) (-290.270) [-290.681] -- 0:00:01
973000 -- (-289.688) [-289.711] (-291.082) (-290.373) * [-290.992] (-291.419) (-290.755) (-290.111) -- 0:00:01
973500 -- (-294.697) (-291.481) [-289.087] (-289.914) * (-289.649) [-293.056] (-293.632) (-292.519) -- 0:00:01
974000 -- (-293.313) (-292.711) (-290.626) [-294.356] * [-292.614] (-290.633) (-289.481) (-291.733) -- 0:00:01
974500 -- (-291.706) (-292.645) [-289.358] (-290.814) * (-292.060) (-291.268) (-291.900) [-289.940] -- 0:00:01
975000 -- (-291.175) [-295.077] (-291.418) (-289.098) * (-292.070) (-295.108) [-290.753] (-291.767) -- 0:00:01
Average standard deviation of split frequencies: 0.007366
975500 -- (-293.411) (-293.163) [-290.413] (-290.722) * (-291.792) (-295.505) [-290.272] (-290.719) -- 0:00:01
976000 -- (-290.576) (-297.377) [-292.443] (-289.246) * (-291.608) [-290.334] (-290.447) (-291.901) -- 0:00:01
976500 -- (-293.048) (-293.335) [-291.504] (-290.257) * (-289.783) [-291.391] (-290.023) (-293.018) -- 0:00:01
977000 -- (-290.130) (-292.157) (-291.511) [-296.187] * [-289.455] (-294.317) (-292.118) (-291.802) -- 0:00:01
977500 -- [-289.725] (-293.566) (-291.350) (-290.787) * [-290.965] (-291.648) (-295.183) (-290.031) -- 0:00:01
978000 -- (-291.592) (-295.193) [-293.100] (-291.319) * (-290.970) (-292.586) (-289.978) [-295.280] -- 0:00:01
978500 -- (-295.769) [-290.727] (-294.035) (-294.175) * (-289.419) (-295.225) [-291.054] (-292.804) -- 0:00:01
979000 -- (-293.196) [-290.814] (-297.620) (-292.546) * [-290.667] (-290.620) (-292.308) (-290.776) -- 0:00:01
979500 -- (-289.847) (-292.497) (-289.418) [-289.971] * (-289.713) (-291.630) [-289.963] (-292.648) -- 0:00:01
980000 -- [-291.439] (-289.186) (-289.655) (-289.162) * (-290.136) [-289.585] (-293.668) (-290.634) -- 0:00:01
Average standard deviation of split frequencies: 0.007210
980500 -- (-293.049) (-296.096) (-289.541) [-289.421] * (-293.908) (-291.427) [-291.158] (-292.158) -- 0:00:01
981000 -- [-295.538] (-297.088) (-293.160) (-289.538) * (-291.653) [-289.307] (-291.891) (-292.128) -- 0:00:01
981500 -- (-290.075) (-291.119) [-294.086] (-290.510) * (-289.994) [-289.189] (-291.793) (-294.063) -- 0:00:01
982000 -- (-291.071) (-291.888) [-290.850] (-290.829) * (-289.493) (-292.022) (-291.342) [-289.447] -- 0:00:01
982500 -- (-293.868) [-290.321] (-294.358) (-291.466) * (-289.778) (-291.627) [-291.037] (-293.713) -- 0:00:01
983000 -- (-290.368) [-291.213] (-291.573) (-291.404) * (-292.447) (-293.058) [-289.201] (-290.678) -- 0:00:00
983500 -- (-290.544) (-288.906) [-290.658] (-290.591) * [-293.259] (-290.494) (-291.249) (-289.993) -- 0:00:00
984000 -- (-289.375) [-289.716] (-289.375) (-289.677) * (-290.542) (-289.500) (-292.231) [-290.908] -- 0:00:00
984500 -- [-293.709] (-290.231) (-290.612) (-289.746) * (-292.757) [-289.583] (-290.672) (-289.887) -- 0:00:00
985000 -- (-291.903) [-289.851] (-293.226) (-291.439) * (-291.051) (-292.085) (-291.518) [-292.381] -- 0:00:00
Average standard deviation of split frequencies: 0.007231
985500 -- (-289.893) [-291.015] (-292.428) (-290.489) * (-291.998) (-292.134) [-293.017] (-293.370) -- 0:00:00
986000 -- [-295.344] (-289.710) (-290.388) (-293.161) * (-289.224) [-290.084] (-291.228) (-293.985) -- 0:00:00
986500 -- (-296.048) [-291.552] (-291.372) (-294.041) * (-289.137) (-291.011) (-292.300) [-294.987] -- 0:00:00
987000 -- (-294.243) [-289.953] (-291.314) (-290.548) * (-289.319) [-289.665] (-292.886) (-292.204) -- 0:00:00
987500 -- (-289.802) [-291.007] (-292.722) (-292.992) * (-292.367) (-290.876) [-288.926] (-290.795) -- 0:00:00
988000 -- (-289.168) (-290.319) (-293.744) [-292.978] * (-297.005) [-291.165] (-292.527) (-296.027) -- 0:00:00
988500 -- [-291.180] (-289.559) (-291.167) (-289.400) * (-296.092) [-293.293] (-290.338) (-292.716) -- 0:00:00
989000 -- [-291.845] (-291.559) (-289.044) (-293.046) * (-292.538) (-291.134) (-289.768) [-295.064] -- 0:00:00
989500 -- (-290.352) [-290.674] (-289.360) (-292.034) * (-291.120) [-291.349] (-292.319) (-293.486) -- 0:00:00
990000 -- [-289.186] (-291.661) (-289.101) (-292.441) * [-290.470] (-292.559) (-294.929) (-290.514) -- 0:00:00
Average standard deviation of split frequencies: 0.006811
990500 -- (-289.706) (-297.790) (-289.188) [-290.354] * (-295.254) [-290.461] (-293.136) (-289.805) -- 0:00:00
991000 -- (-290.186) (-291.494) [-290.792] (-290.998) * (-291.388) [-290.032] (-292.775) (-290.313) -- 0:00:00
991500 -- (-294.522) (-291.153) (-289.871) [-293.708] * (-291.245) [-292.207] (-292.179) (-296.956) -- 0:00:00
992000 -- (-290.506) (-292.294) [-291.036] (-295.878) * (-292.229) [-291.561] (-291.694) (-292.005) -- 0:00:00
992500 -- [-290.539] (-292.366) (-290.094) (-291.618) * (-291.805) (-291.714) (-291.303) [-291.219] -- 0:00:00
993000 -- (-290.938) (-296.920) [-289.373] (-289.774) * (-292.034) (-291.113) (-290.592) [-291.117] -- 0:00:00
993500 -- [-289.255] (-290.179) (-295.117) (-293.717) * (-293.728) (-290.820) (-290.863) [-289.974] -- 0:00:00
994000 -- (-291.437) [-290.008] (-298.518) (-290.484) * [-289.743] (-293.186) (-289.153) (-289.136) -- 0:00:00
994500 -- (-290.907) (-292.242) (-299.203) [-290.455] * (-290.168) (-290.940) [-292.898] (-296.709) -- 0:00:00
995000 -- (-290.432) (-292.428) (-293.535) [-292.200] * (-290.316) (-291.082) (-291.645) [-293.003] -- 0:00:00
Average standard deviation of split frequencies: 0.006437
995500 -- [-289.773] (-291.144) (-289.974) (-290.948) * (-290.225) [-290.863] (-290.101) (-299.869) -- 0:00:00
996000 -- (-290.254) (-290.982) [-289.373] (-290.824) * (-289.182) (-290.688) (-295.866) [-290.277] -- 0:00:00
996500 -- [-290.914] (-291.064) (-292.921) (-290.766) * (-289.189) [-291.027] (-292.461) (-290.294) -- 0:00:00
997000 -- (-289.758) (-292.519) [-289.332] (-291.420) * (-292.192) [-289.584] (-294.959) (-289.404) -- 0:00:00
997500 -- [-289.566] (-294.617) (-290.090) (-289.321) * [-290.665] (-289.349) (-292.005) (-291.409) -- 0:00:00
998000 -- [-295.354] (-292.260) (-289.605) (-290.214) * [-290.515] (-289.029) (-295.250) (-291.594) -- 0:00:00
998500 -- (-289.559) (-291.793) [-295.242] (-291.738) * (-292.953) (-291.618) (-290.492) [-291.578] -- 0:00:00
999000 -- (-289.490) (-290.306) [-292.974] (-292.221) * (-291.599) (-289.552) [-292.406] (-293.296) -- 0:00:00
999500 -- (-290.172) [-290.054] (-292.484) (-289.311) * (-289.688) (-290.993) (-293.612) [-290.124] -- 0:00:00
1000000 -- (-290.416) (-289.674) [-290.872] (-290.267) * (-294.749) [-289.241] (-291.653) (-291.070) -- 0:00:00
Average standard deviation of split frequencies: 0.006752
Analysis completed in 58 seconds
Analysis used 56.93 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -288.68
Likelihood of best state for "cold" chain of run 2 was -288.68
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
46.3 % ( 31 %) Dirichlet(Pi{all})
42.0 % ( 26 %) Slider(Pi{all})
78.8 % ( 55 %) Multiplier(Alpha{1,2})
77.8 % ( 48 %) Multiplier(Alpha{3})
26.9 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
45.6 % ( 32 %) Dirichlet(Pi{all})
42.9 % ( 17 %) Slider(Pi{all})
78.9 % ( 59 %) Multiplier(Alpha{1,2})
77.5 % ( 48 %) Multiplier(Alpha{3})
26.7 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167002 0.82 0.67
3 | 166821 166283 0.84
4 | 166559 167049 166286
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166781 0.82 0.66
3 | 166425 166828 0.84
4 | 166637 167317 166012
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -290.58
| 1 22 1 |
| 2 111 2 1 1122 22 1 11 |
| 2 1 1 * * 1 1 * 2 |
| 11 2 1 2222 2 2 1 2 |
| 1 1 2 1 1 2 1 2 1 1 21 *1 22 1 *|
|1 1 2 2 1 1 2 2 1 21 2 1 2 2 |
| 2 2 1 2 1 2 1 1 2 1* |
| 2 21 1 22 1 |
| 2 2 2 1 * 1 1 1 1 2 |
|2 2 11 1 |
| 2 2 2 2 |
| 2 |
| 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -292.41
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.41 -293.44
2 -290.44 -294.59
--------------------------------------
TOTAL -290.42 -294.17
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888275 0.091130 0.358555 1.485524 0.850055 1254.09 1377.55 1.001
r(A<->C){all} 0.178700 0.020543 0.000086 0.464850 0.141762 222.07 271.33 1.001
r(A<->G){all} 0.169585 0.019848 0.000010 0.450349 0.136194 113.59 215.07 1.000
r(A<->T){all} 0.156016 0.017085 0.000040 0.403471 0.123546 138.19 217.40 1.004
r(C<->G){all} 0.160352 0.019817 0.000045 0.454347 0.119823 247.67 315.41 1.002
r(C<->T){all} 0.169279 0.021497 0.000062 0.472792 0.129971 219.84 285.34 1.000
r(G<->T){all} 0.166068 0.020927 0.000049 0.452535 0.123543 175.28 183.27 1.000
pi(A){all} 0.136312 0.000541 0.093349 0.184774 0.135412 1175.32 1338.16 1.000
pi(C){all} 0.232607 0.000802 0.179851 0.292352 0.230992 1350.34 1361.31 1.000
pi(G){all} 0.326461 0.000982 0.264069 0.385344 0.325517 1274.41 1387.71 1.000
pi(T){all} 0.304620 0.000988 0.246475 0.368926 0.304562 1163.00 1315.46 1.000
alpha{1,2} 0.403519 0.224955 0.000134 1.349261 0.236161 1150.55 1283.07 1.000
alpha{3} 0.457428 0.251070 0.000149 1.496312 0.283319 1166.97 1295.62 1.000
pinvar{all} 0.991707 0.000105 0.973121 1.000000 0.994952 1112.08 1214.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...**.
9 -- ...*.*
10 -- .****.
11 -- .***.*
12 -- .*.***
13 -- ..*.*.
14 -- ..**..
15 -- ....**
16 -- .*.*..
17 -- .*..*.
18 -- ..*..*
19 -- ..****
20 -- .*...*
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 471 0.156895 0.004240 0.153897 0.159893 2
8 456 0.151899 0.016959 0.139907 0.163891 2
9 449 0.149567 0.000471 0.149234 0.149900 2
10 449 0.149567 0.003298 0.147235 0.151899 2
11 437 0.145570 0.006124 0.141239 0.149900 2
12 436 0.145237 0.009422 0.138574 0.151899 2
13 436 0.145237 0.003769 0.142572 0.147901 2
14 433 0.144237 0.008009 0.138574 0.149900 2
15 425 0.141572 0.007066 0.136576 0.146569 2
16 421 0.140240 0.011777 0.131912 0.148568 2
17 414 0.137908 0.008480 0.131912 0.143904 2
18 410 0.136576 0.000942 0.135909 0.137242 2
19 409 0.136243 0.006124 0.131912 0.140573 2
20 394 0.131246 0.004711 0.127915 0.134577 2
21 393 0.130913 0.009893 0.123917 0.137908 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099669 0.009687 0.000000 0.297784 0.071889 1.000 2
length{all}[2] 0.097929 0.009586 0.000028 0.296727 0.066562 1.000 2
length{all}[3] 0.096132 0.009251 0.000001 0.297420 0.065695 1.000 2
length{all}[4] 0.101626 0.010726 0.000035 0.303460 0.069274 1.000 2
length{all}[5] 0.097383 0.009924 0.000003 0.304069 0.067223 1.000 2
length{all}[6] 0.100025 0.010071 0.000075 0.306038 0.067155 1.000 2
length{all}[7] 0.090141 0.007052 0.000054 0.265321 0.064498 0.998 2
length{all}[8] 0.099503 0.010742 0.000051 0.301404 0.069513 0.998 2
length{all}[9] 0.102454 0.010863 0.000073 0.304745 0.071727 1.004 2
length{all}[10] 0.102236 0.009774 0.000253 0.302061 0.069766 0.998 2
length{all}[11] 0.094038 0.008019 0.000371 0.257310 0.064350 1.014 2
length{all}[12] 0.096502 0.009282 0.000229 0.306786 0.063439 0.998 2
length{all}[13] 0.097025 0.009634 0.000009 0.310361 0.069134 0.998 2
length{all}[14] 0.102719 0.009930 0.000059 0.296333 0.073483 1.004 2
length{all}[15] 0.095989 0.008814 0.000333 0.272729 0.065150 0.999 2
length{all}[16] 0.098931 0.011162 0.000117 0.317287 0.066010 1.000 2
length{all}[17] 0.098506 0.009179 0.000055 0.286056 0.068559 1.010 2
length{all}[18] 0.101067 0.009857 0.000365 0.281715 0.071781 0.998 2
length{all}[19] 0.100610 0.007658 0.000588 0.260608 0.080202 1.000 2
length{all}[20] 0.102781 0.011860 0.000138 0.287873 0.068263 0.998 2
length{all}[21] 0.105951 0.012147 0.000313 0.265066 0.079438 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006752
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.014
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 216
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 37 patterns at 72 / 72 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 37 patterns at 72 / 72 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
36112 bytes for conP
3256 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015615 0.029123 0.100314 0.103093 0.045091 0.014679 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -293.255639
Iterating by ming2
Initial: fx= 293.255639
x= 0.01561 0.02912 0.10031 0.10309 0.04509 0.01468 0.30000 1.30000
1 h-m-p 0.0000 0.0002 171.6278 +++ 287.132715 m 0.0002 14 | 1/8
2 h-m-p 0.0001 0.0003 45.5575 ++ 286.900230 m 0.0003 25 | 2/8
3 h-m-p 0.0000 0.0000 6266.1467 ++ 285.009268 m 0.0000 36 | 3/8
4 h-m-p 0.0001 0.0005 101.2502 ++ 283.583704 m 0.0005 47 | 4/8
5 h-m-p 0.0003 0.0211 146.8615 +++ 275.229323 m 0.0211 59 | 5/8
6 h-m-p 0.0003 0.0017 196.8185 ++ 271.614540 m 0.0017 70 | 6/8
7 h-m-p 1.6000 8.0000 0.0014 ++ 271.614539 m 8.0000 81 | 6/8
8 h-m-p 0.0085 0.9677 1.3417 ----------Y 271.614539 0 0.0000 104 | 6/8
9 h-m-p 0.0160 8.0000 0.0000 +++++ 271.614539 m 8.0000 118 | 6/8
10 h-m-p 0.0160 8.0000 0.1142 +++++ 271.614536 m 8.0000 134 | 6/8
11 h-m-p 1.6000 8.0000 0.1215 Y 271.614536 0 2.5624 147 | 6/8
12 h-m-p 1.6000 8.0000 0.0271 Y 271.614536 0 1.1733 160 | 6/8
13 h-m-p 1.6000 8.0000 0.0010 Y 271.614536 0 0.8299 173 | 6/8
14 h-m-p 1.6000 8.0000 0.0004 C 271.614536 0 0.4000 186 | 6/8
15 h-m-p 0.5178 8.0000 0.0003 +C 271.614536 0 3.1525 200 | 6/8
16 h-m-p 1.6000 8.0000 0.0003 ++ 271.614536 m 8.0000 213 | 6/8
17 h-m-p 1.6000 8.0000 0.0009 C 271.614536 0 1.6000 226 | 6/8
18 h-m-p 1.6000 8.0000 0.0006 +C 271.614536 0 6.4000 240 | 6/8
19 h-m-p 1.6000 8.0000 0.0002 ++ 271.614536 m 8.0000 253 | 6/8
20 h-m-p 0.0692 8.0000 0.0271 +++Y 271.614536 0 3.4372 269 | 6/8
21 h-m-p 1.6000 8.0000 0.0050 ++ 271.614536 m 8.0000 282 | 6/8
22 h-m-p 0.0020 0.1782 20.6179 +++C 271.614531 0 0.1281 298 | 6/8
23 h-m-p 0.0087 0.0437 23.6023 ++ 271.614530 m 0.0437 309 | 7/8
24 h-m-p 0.5491 8.0000 0.1873 ++ 271.614472 m 8.0000 320 | 7/8
25 h-m-p 1.6000 8.0000 0.2574 ++ 271.614456 m 8.0000 332 | 7/8
26 h-m-p 1.6000 8.0000 0.8513 ++ 271.614444 m 8.0000 344 | 7/8
27 h-m-p 1.6000 8.0000 1.2728 ++ 271.614441 m 8.0000 356 | 7/8
28 h-m-p 1.6000 8.0000 2.8767 ++ 271.614438 m 8.0000 367 | 7/8
29 h-m-p 1.6000 8.0000 1.3734 ++ 271.614438 m 8.0000 378 | 7/8
30 h-m-p 0.8666 8.0000 12.6786 ++ 271.614437 m 8.0000 389 | 7/8
31 h-m-p 0.4065 3.3773 249.4969 ++ 271.614437 m 3.3773 400 | 8/8
32 h-m-p 0.0160 8.0000 0.0000 Y 271.614437 0 0.0160 411 | 8/8
33 h-m-p 0.0160 8.0000 0.0000 Y 271.614437 0 0.0160 422
Out..
lnL = -271.614437
423 lfun, 423 eigenQcodon, 2538 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092405 0.043704 0.020729 0.038013 0.015991 0.103648 0.000100 0.877157 0.389159
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.734257
np = 9
lnL0 = -293.797208
Iterating by ming2
Initial: fx= 293.797208
x= 0.09241 0.04370 0.02073 0.03801 0.01599 0.10365 0.00011 0.87716 0.38916
1 h-m-p 0.0000 0.0000 170.5888 ++ 293.561872 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0018 70.1400 ++++ 286.950033 m 0.0018 28 | 2/9
3 h-m-p 0.0001 0.0003 73.4065 ++ 285.171485 m 0.0003 40 | 3/9
4 h-m-p 0.0002 0.0025 86.0232 ++ 280.177292 m 0.0025 52 | 4/9
5 h-m-p 0.0000 0.0000 762.8537 ++ 279.567925 m 0.0000 64 | 5/9
6 h-m-p 0.0001 0.0004 327.4461 ++ 275.593919 m 0.0004 76 | 6/9
7 h-m-p 0.0004 0.0020 27.8402 ++ 274.060866 m 0.0020 88 | 7/9
8 h-m-p 0.0083 0.1606 3.6940 -------------.. | 7/9
9 h-m-p 0.0000 0.0005 70.3009 +++ 271.614531 m 0.0005 124 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 271.614531 m 8.0000 136 | 7/9
11 h-m-p 0.0000 0.0000 0.0020
h-m-p: 4.12822769e-16 2.06411385e-15 2.03074712e-03 271.614531
.. | 7/9
12 h-m-p 0.0160 8.0000 0.0001 +++++ 271.614531 m 8.0000 163 | 7/9
13 h-m-p 0.0049 2.4430 0.2989 +++++ 271.614493 m 2.4430 180 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 Y 271.614493 0 1.6000 194 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 Y 271.614493 0 0.0160 207
Out..
lnL = -271.614493
208 lfun, 624 eigenQcodon, 2496 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.091272 0.105695 0.050759 0.016158 0.039046 0.054119 0.000100 1.207051 0.394921 0.441091 1193.411389
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.071358
np = 11
lnL0 = -282.256487
Iterating by ming2
Initial: fx= 282.256487
x= 0.09127 0.10569 0.05076 0.01616 0.03905 0.05412 0.00011 1.20705 0.39492 0.44109 951.42857
1 h-m-p 0.0000 0.0000 28.5379 ++ 282.252445 m 0.0000 16 | 1/11
2 h-m-p 0.0003 0.1730 7.7728 +++++ 274.451297 m 0.1730 33 | 2/11
3 h-m-p 0.0000 0.0000 437.0161 ++ 274.376679 m 0.0000 47 | 3/11
4 h-m-p 0.0000 0.0007 436.2285 +++ 273.671407 m 0.0007 62 | 4/11
5 h-m-p 0.0000 0.0000 1663.6725 ++ 273.564865 m 0.0000 76 | 5/11
6 h-m-p 0.0000 0.0001 2786.0578 ++ 273.244355 m 0.0001 90 | 6/11
7 h-m-p 0.0007 0.0394 443.3190 +CCCCC 272.554499 4 0.0043 113 | 6/11
8 h-m-p 0.1663 0.8316 0.6781 ++ 272.510235 m 0.8316 127 | 7/11
9 h-m-p 0.1874 0.9372 1.3949 ++ 271.614440 m 0.9372 146 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 271.614440 m 8.0000 160 | 8/11
11 h-m-p 0.0246 8.0000 0.0108 +++++ 271.614440 m 8.0000 180 | 8/11
12 h-m-p 0.0829 8.0000 1.0432 ++++ 271.614437 m 8.0000 199 | 8/11
13 h-m-p 1.6000 8.0000 0.0705 -------N 271.614437 0 0.0000 220 | 8/11
14 h-m-p 1.6000 8.0000 0.0000 ---N 271.614437 0 0.0063 240
Out..
lnL = -271.614437
241 lfun, 964 eigenQcodon, 4338 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -271.612801 S = -271.612793 -0.000003
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 37 patterns 0:03
did 20 / 37 patterns 0:03
did 30 / 37 patterns 0:03
did 37 / 37 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030728 0.103554 0.057974 0.051803 0.029219 0.015697 0.000100 0.811349 1.288180
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.737438
np = 9
lnL0 = -291.936571
Iterating by ming2
Initial: fx= 291.936571
x= 0.03073 0.10355 0.05797 0.05180 0.02922 0.01570 0.00011 0.81135 1.28818
1 h-m-p 0.0000 0.0000 168.5816 ++ 291.661085 m 0.0000 14 | 1/9
2 h-m-p 0.0005 0.2466 5.6810 -----------.. | 1/9
3 h-m-p 0.0000 0.0002 168.7026 +++ 285.511800 m 0.0002 48 | 2/9
4 h-m-p 0.0067 0.3090 4.8972 -------------.. | 2/9
5 h-m-p 0.0000 0.0002 155.9494 +++ 280.789386 m 0.0002 84 | 3/9
6 h-m-p 0.0065 0.3560 4.1138 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 140.8853 ++ 280.363947 m 0.0000 118 | 4/9
8 h-m-p 0.0008 0.4235 3.7149 -----------.. | 4/9
9 h-m-p 0.0000 0.0003 121.5158 +++ 275.864090 m 0.0003 152 | 5/9
10 h-m-p 0.0090 0.5293 3.3216 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 100.4079 ++ 274.972590 m 0.0001 187 | 6/9
12 h-m-p 0.0022 0.7122 2.8385 ------------.. | 6/9
13 h-m-p 0.0000 0.0007 70.4361 ++++ 271.614531 m 0.0007 223 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 271.614531 m 8.0000 235 | 7/9
15 h-m-p 0.0464 8.0000 0.0007 ++++ 271.614531 m 8.0000 251 | 7/9
16 h-m-p 0.0160 8.0000 0.7115 +++++ 271.614526 m 8.0000 268 | 7/9
17 h-m-p 1.6000 8.0000 0.2438 ++ 271.614526 m 8.0000 282 | 7/9
18 h-m-p 0.6290 8.0000 3.1000 ++ 271.614525 m 8.0000 296 | 7/9
19 h-m-p 1.5166 7.5828 12.2372 ++ 271.614525 m 7.5828 308 | 7/9
20 h-m-p 0.0000 0.0000 16.5814
h-m-p: 0.00000000e+00 0.00000000e+00 1.65814270e+01 271.614525
.. | 7/9
21 h-m-p 0.0160 8.0000 0.0000 Y 271.614525 0 0.0160 329 | 7/9
22 h-m-p 0.0160 8.0000 0.0000 Y 271.614525 0 0.0040 343
Out..
lnL = -271.614525
344 lfun, 3784 eigenQcodon, 20640 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039583 0.055666 0.025307 0.018995 0.088146 0.045904 0.000100 0.900000 0.396003 1.765188 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.122329
np = 11
lnL0 = -278.192689
Iterating by ming2
Initial: fx= 278.192689
x= 0.03958 0.05567 0.02531 0.01900 0.08815 0.04590 0.00011 0.90000 0.39600 1.76519 951.42857
1 h-m-p 0.0000 0.0000 51.7736 ++ 278.167997 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 525.5573 ++ 274.670661 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0000 1084.9393 ++ 273.435157 m 0.0000 44 | 3/11
4 h-m-p 0.0017 0.0085 6.1843 CYCYC 273.130508 4 0.0041 65 | 3/11
5 h-m-p 0.0072 0.0360 1.7361 ++ 272.933155 m 0.0360 79 | 4/11
6 h-m-p 0.0111 0.0553 1.3589 ++ 272.796158 m 0.0553 93 | 5/11
7 h-m-p 0.0044 0.0222 6.3529 ++ 272.446876 m 0.0222 107 | 6/11
8 h-m-p 0.0014 0.0068 25.8727 +CYCCC 272.293619 4 0.0057 129 | 6/11
9 h-m-p 0.0027 0.0133 2.2096 ++ 272.237708 m 0.0133 143 | 7/11
10 h-m-p 0.8082 8.0000 0.0128 ----------------.. | 7/11
11 h-m-p 0.0000 0.0007 325.5854 YYCYCCC 272.025766 6 0.0000 198 | 7/11
12 h-m-p 0.0002 0.0016 12.3581 ++ 271.614461 m 0.0016 212 | 8/11
13 h-m-p 1.6000 8.0000 0.0000 ++ 271.614460 m 8.0000 226 | 8/11
14 h-m-p 0.0424 8.0000 0.0014 ++++ 271.614441 m 8.0000 245 | 8/11
15 h-m-p 1.6000 8.0000 0.0005 ++ 271.614440 m 8.0000 262 | 8/11
16 h-m-p 0.6157 8.0000 0.0063 ++ 271.614438 m 8.0000 279 | 8/11
17 h-m-p 1.6000 8.0000 0.0038 ++ 271.614437 m 8.0000 296 | 8/11
18 h-m-p 1.0868 8.0000 0.0279 ++ 271.614437 m 8.0000 313 | 8/11
19 h-m-p 1.6000 8.0000 0.0232 ++ 271.614437 m 8.0000 330 | 8/11
20 h-m-p 0.8129 4.0646 0.1255 ++ 271.614437 m 4.0646 347 | 9/11
21 h-m-p 1.1112 8.0000 0.0844 ++ 271.614437 m 8.0000 364 | 9/11
22 h-m-p 0.3853 8.0000 1.7517 +++ 271.614437 m 8.0000 381 | 9/11
23 h-m-p 0.8979 8.0000 15.6068 ------Y 271.614437 0 0.0001 401 | 9/11
24 h-m-p 1.6000 8.0000 0.0005 N 271.614437 0 1.6000 415 | 9/11
25 h-m-p 1.6000 8.0000 0.0001 ----------Y 271.614437 0 0.0000 441
Out..
lnL = -271.614437
442 lfun, 5304 eigenQcodon, 29172 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -271.612797 S = -271.612792 -0.000002
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 37 patterns 0:15
did 20 / 37 patterns 0:15
did 30 / 37 patterns 0:15
did 37 / 37 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=72
NC_011896_1_WP_010907811_1_601_MLBR_RS02840 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
NC_002677_1_NP_301487_1_359_ML0575 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD
**************************************************
NC_011896_1_WP_010907811_1_601_MLBR_RS02840 MLISTVVVVCRIPVVAGRSVVA
NC_002677_1_NP_301487_1_359_ML0575 MLISTVVVVCRIPVVAGRSVVA
NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295 MLISTVVVVCRIPVVAGRSVVA
NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530 MLISTVVVVCRIPVVAGRSVVA
NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135 MLISTVVVVCRIPVVAGRSVVA
NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225 MLISTVVVVCRIPVVAGRSVVA
**********************
>NC_011896_1_WP_010907811_1_601_MLBR_RS02840 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG GAGATCGGTGGTTGCC >NC_002677_1_NP_301487_1_359_ML0575 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG GAGATCGGTGGTTGCC >NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG GAGATCGGTGGTTGCC >NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG GAGATCGGTGGTTGCC >NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG GAGATCGGTGGTTGCC >NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225 GTGGTCGCAACCGTGCTGGCGCTGAGTTTTGTCGTGCTATCGGTGCCGAA ACTGTATGGTTTCGGCGTTATTGTAATCACTTCCGCGGCGTTGTTGTCGC AATCGATCTGCCTTGCGTATCCGGTAGCGCCCGCGGTGTGCCTAGTAGAC ATGCTAATCAGCACTGTGGTGGTTGTGTGTCGTATACCTGTTGTGGCCGG GAGATCGGTGGTTGCC
>NC_011896_1_WP_010907811_1_601_MLBR_RS02840 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD MLISTVVVVCRIPVVAGRSVVA >NC_002677_1_NP_301487_1_359_ML0575 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD MLISTVVVVCRIPVVAGRSVVA >NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD MLISTVVVVCRIPVVAGRSVVA >NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD MLISTVVVVCRIPVVAGRSVVA >NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD MLISTVVVVCRIPVVAGRSVVA >NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225 VVATVLALSFVVLSVPKLYGFGVIVITSAALLSQSICLAYPVAPAVCLVD MLISTVVVVCRIPVVAGRSVVA
#NEXUS
[ID: 0859190610]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907811_1_601_MLBR_RS02840
NC_002677_1_NP_301487_1_359_ML0575
NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295
NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530
NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135
NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907811_1_601_MLBR_RS02840,
2 NC_002677_1_NP_301487_1_359_ML0575,
3 NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295,
4 NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530,
5 NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135,
6 NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07188939,2:0.06656194,3:0.06569458,4:0.06927429,5:0.06722304,6:0.06715536);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07188939,2:0.06656194,3:0.06569458,4:0.06927429,5:0.06722304,6:0.06715536);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.41 -293.44
2 -290.44 -294.59
--------------------------------------
TOTAL -290.42 -294.17
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888275 0.091130 0.358555 1.485524 0.850055 1254.09 1377.55 1.001
r(A<->C){all} 0.178700 0.020543 0.000086 0.464850 0.141762 222.07 271.33 1.001
r(A<->G){all} 0.169585 0.019848 0.000010 0.450349 0.136194 113.59 215.07 1.000
r(A<->T){all} 0.156016 0.017085 0.000040 0.403471 0.123546 138.19 217.40 1.004
r(C<->G){all} 0.160352 0.019817 0.000045 0.454347 0.119823 247.67 315.41 1.002
r(C<->T){all} 0.169279 0.021497 0.000062 0.472792 0.129971 219.84 285.34 1.000
r(G<->T){all} 0.166068 0.020927 0.000049 0.452535 0.123543 175.28 183.27 1.000
pi(A){all} 0.136312 0.000541 0.093349 0.184774 0.135412 1175.32 1338.16 1.000
pi(C){all} 0.232607 0.000802 0.179851 0.292352 0.230992 1350.34 1361.31 1.000
pi(G){all} 0.326461 0.000982 0.264069 0.385344 0.325517 1274.41 1387.71 1.000
pi(T){all} 0.304620 0.000988 0.246475 0.368926 0.304562 1163.00 1315.46 1.000
alpha{1,2} 0.403519 0.224955 0.000134 1.349261 0.236161 1150.55 1283.07 1.000
alpha{3} 0.457428 0.251070 0.000149 1.496312 0.283319 1166.97 1295.62 1.000
pinvar{all} 0.991707 0.000105 0.973121 1.000000 0.994952 1112.08 1214.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0575/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 72
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 2 2 2 2 2 2 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 1 1 1 1 1 1 | AAC 0 0 0 0 0 0 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 0 0 0 0 0 0 | Asp GAT 0 0 0 0 0 0 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 2 2 2 2 2 2 | GAC 1 1 1 1 1 1 | GGC 1 1 1 1 1 1
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 10 10 10 10 10 10 | GCG 6 6 6 6 6 6 | GAG 0 0 0 0 0 0 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907811_1_601_MLBR_RS02840
position 1: T:0.19444 C:0.18056 A:0.18056 G:0.44444
position 2: T:0.50000 C:0.29167 A:0.06944 G:0.13889
position 3: T:0.22222 C:0.22222 A:0.15278 G:0.40278
Average T:0.30556 C:0.23148 A:0.13426 G:0.32870
#2: NC_002677_1_NP_301487_1_359_ML0575
position 1: T:0.19444 C:0.18056 A:0.18056 G:0.44444
position 2: T:0.50000 C:0.29167 A:0.06944 G:0.13889
position 3: T:0.22222 C:0.22222 A:0.15278 G:0.40278
Average T:0.30556 C:0.23148 A:0.13426 G:0.32870
#3: NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295
position 1: T:0.19444 C:0.18056 A:0.18056 G:0.44444
position 2: T:0.50000 C:0.29167 A:0.06944 G:0.13889
position 3: T:0.22222 C:0.22222 A:0.15278 G:0.40278
Average T:0.30556 C:0.23148 A:0.13426 G:0.32870
#4: NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530
position 1: T:0.19444 C:0.18056 A:0.18056 G:0.44444
position 2: T:0.50000 C:0.29167 A:0.06944 G:0.13889
position 3: T:0.22222 C:0.22222 A:0.15278 G:0.40278
Average T:0.30556 C:0.23148 A:0.13426 G:0.32870
#5: NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135
position 1: T:0.19444 C:0.18056 A:0.18056 G:0.44444
position 2: T:0.50000 C:0.29167 A:0.06944 G:0.13889
position 3: T:0.22222 C:0.22222 A:0.15278 G:0.40278
Average T:0.30556 C:0.23148 A:0.13426 G:0.32870
#6: NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225
position 1: T:0.19444 C:0.18056 A:0.18056 G:0.44444
position 2: T:0.50000 C:0.29167 A:0.06944 G:0.13889
position 3: T:0.22222 C:0.22222 A:0.15278 G:0.40278
Average T:0.30556 C:0.23148 A:0.13426 G:0.32870
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 6
TTC 6 | TCC 6 | TAC 0 | TGC 12
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 0 | CCC 6 | CAC 0 | CGC 0
CTA 18 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 18 | CCG 12 | CAG 0 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 6
ATC 18 | ACC 6 | AAC 0 | AGC 6
ATA 6 | ACA 0 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 6 | ACG 0 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 0 | Asp D GAT 0 | Gly G GGT 6
GTC 12 | GCC 12 | GAC 6 | GGC 6
GTA 18 | GCA 6 | Glu E GAA 0 | GGA 0
GTG 60 | GCG 36 | GAG 0 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19444 C:0.18056 A:0.18056 G:0.44444
position 2: T:0.50000 C:0.29167 A:0.06944 G:0.13889
position 3: T:0.22222 C:0.22222 A:0.15278 G:0.40278
Average T:0.30556 C:0.23148 A:0.13426 G:0.32870
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -271.614437 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907811_1_601_MLBR_RS02840: 0.000004, NC_002677_1_NP_301487_1_359_ML0575: 0.000004, NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295: 0.000004, NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530: 0.000004, NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135: 0.000004, NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 140.7 75.3 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 140.7 75.3 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 140.7 75.3 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 140.7 75.3 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 140.7 75.3 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 140.7 75.3 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -271.614493 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.385755
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907811_1_601_MLBR_RS02840: 0.000004, NC_002677_1_NP_301487_1_359_ML0575: 0.000004, NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295: 0.000004, NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530: 0.000004, NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135: 0.000004, NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.38576 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 140.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 140.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 140.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 140.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 140.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 140.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -271.614437 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.007086 0.483880 0.000001 951.413387
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907811_1_601_MLBR_RS02840: 0.000004, NC_002677_1_NP_301487_1_359_ML0575: 0.000004, NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295: 0.000004, NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530: 0.000004, NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135: 0.000004, NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00709 0.48388 0.50903
w: 0.00000 1.00000 951.41339
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 140.7 75.3 484.7859 0.0000 0.0000 0.0 0.0
7..2 0.000 140.7 75.3 484.7859 0.0000 0.0000 0.0 0.0
7..3 0.000 140.7 75.3 484.7859 0.0000 0.0000 0.0 0.0
7..4 0.000 140.7 75.3 484.7859 0.0000 0.0000 0.0 0.0
7..5 0.000 140.7 75.3 484.7859 0.0000 0.0000 0.0 0.0
7..6 0.000 140.7 75.3 484.7859 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907811_1_601_MLBR_RS02840)
Pr(w>1) post mean +- SE for w
1 V 0.509 484.771
2 V 0.509 484.778
3 A 0.509 484.782
4 T 0.509 484.782
5 V 0.509 484.771
6 L 0.509 484.767
7 A 0.509 484.775
8 L 0.509 484.767
9 S 0.509 484.778
10 F 0.509 484.768
11 V 0.509 484.778
12 V 0.509 484.771
13 L 0.509 484.779
14 S 0.509 484.775
15 V 0.509 484.771
16 P 0.509 484.774
17 K 0.509 484.782
18 L 0.509 484.767
19 Y 0.509 484.780
20 G 0.509 484.774
21 F 0.509 484.768
22 G 0.509 484.774
23 V 0.509 484.778
24 I 0.509 484.775
25 V 0.509 484.780
26 I 0.509 484.775
27 T 0.509 484.782
28 S 0.509 484.779
29 A 0.509 484.775
30 A 0.509 484.775
31 L 0.509 484.762
32 L 0.509 484.762
33 S 0.509 484.775
34 Q 0.509 484.781
35 S 0.509 484.775
36 I 0.509 484.775
37 C 0.509 484.777
38 L 0.509 484.776
39 A 0.509 484.775
40 Y 0.509 484.780
41 P 0.509 484.774
42 V 0.509 484.780
43 A 0.509 484.775
44 P 0.509 484.779
45 A 0.509 484.775
46 V 0.509 484.771
47 C 0.509 484.777
48 L 0.509 484.779
49 V 0.509 484.780
50 D 0.509 484.773
51 M 0.509 484.769
52 L 0.509 484.779
53 I 0.509 484.775
54 S 0.509 484.778
55 T 0.509 484.782
56 V 0.509 484.771
57 V 0.509 484.771
58 V 0.509 484.778
59 V 0.509 484.771
60 C 0.509 484.777
61 R 0.509 484.779
62 I 0.509 484.781
63 P 0.509 484.779
64 V 0.509 484.778
65 V 0.509 484.771
66 A 0.509 484.780
67 G 0.509 484.764
68 R 0.509 484.782
69 S 0.509 484.775
70 V 0.509 484.771
71 V 0.509 484.778
72 A 0.509 484.780
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907811_1_601_MLBR_RS02840)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -271.614525 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 79.153676 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907811_1_601_MLBR_RS02840: 0.000004, NC_002677_1_NP_301487_1_359_ML0575: 0.000004, NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295: 0.000004, NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530: 0.000004, NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135: 0.000004, NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 79.15368 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.38357 0.40574 0.41906 0.42976 0.43941 0.44878 0.45848 0.46931 0.48289 0.50574
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 140.7 75.3 0.4443 0.0000 0.0000 0.0 0.0
7..2 0.000 140.7 75.3 0.4443 0.0000 0.0000 0.0 0.0
7..3 0.000 140.7 75.3 0.4443 0.0000 0.0000 0.0 0.0
7..4 0.000 140.7 75.3 0.4443 0.0000 0.0000 0.0 0.0
7..5 0.000 140.7 75.3 0.4443 0.0000 0.0000 0.0 0.0
7..6 0.000 140.7 75.3 0.4443 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -271.614437 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.649751 966.255060
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907811_1_601_MLBR_RS02840: 0.000004, NC_002677_1_NP_301487_1_359_ML0575: 0.000004, NZ_LVXE01000026_1_WP_010907811_1_1088_A3216_RS08295: 0.000004, NZ_LYPH01000029_1_WP_010907811_1_1152_A8144_RS05530: 0.000004, NZ_CP029543_1_WP_010907811_1_615_DIJ64_RS03135: 0.000004, NZ_AP014567_1_WP_010907811_1_633_JK2ML_RS03225: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 0.64975
(p1 = 0.99999) w = 966.25506
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00008 966.25506
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 140.7 75.3 966.2454 0.0000 0.0000 0.0 0.0
7..2 0.000 140.7 75.3 966.2454 0.0000 0.0000 0.0 0.0
7..3 0.000 140.7 75.3 966.2454 0.0000 0.0000 0.0 0.0
7..4 0.000 140.7 75.3 966.2454 0.0000 0.0000 0.0 0.0
7..5 0.000 140.7 75.3 966.2454 0.0000 0.0000 0.0 0.0
7..6 0.000 140.7 75.3 966.2454 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907811_1_601_MLBR_RS02840)
Pr(w>1) post mean +- SE for w
1 V 1.000** 966.245
2 V 1.000** 966.245
3 A 1.000** 966.245
4 T 1.000** 966.245
5 V 1.000** 966.245
6 L 1.000** 966.245
7 A 1.000** 966.245
8 L 1.000** 966.245
9 S 1.000** 966.245
10 F 1.000** 966.245
11 V 1.000** 966.245
12 V 1.000** 966.245
13 L 1.000** 966.245
14 S 1.000** 966.245
15 V 1.000** 966.245
16 P 1.000** 966.245
17 K 1.000** 966.245
18 L 1.000** 966.245
19 Y 1.000** 966.245
20 G 1.000** 966.245
21 F 1.000** 966.245
22 G 1.000** 966.245
23 V 1.000** 966.245
24 I 1.000** 966.245
25 V 1.000** 966.245
26 I 1.000** 966.245
27 T 1.000** 966.245
28 S 1.000** 966.245
29 A 1.000** 966.245
30 A 1.000** 966.245
31 L 1.000** 966.245
32 L 1.000** 966.245
33 S 1.000** 966.245
34 Q 1.000** 966.245
35 S 1.000** 966.245
36 I 1.000** 966.245
37 C 1.000** 966.245
38 L 1.000** 966.245
39 A 1.000** 966.245
40 Y 1.000** 966.245
41 P 1.000** 966.245
42 V 1.000** 966.245
43 A 1.000** 966.245
44 P 1.000** 966.245
45 A 1.000** 966.245
46 V 1.000** 966.245
47 C 1.000** 966.245
48 L 1.000** 966.245
49 V 1.000** 966.245
50 D 1.000** 966.245
51 M 1.000** 966.245
52 L 1.000** 966.245
53 I 1.000** 966.245
54 S 1.000** 966.245
55 T 1.000** 966.245
56 V 1.000** 966.245
57 V 1.000** 966.245
58 V 1.000** 966.245
59 V 1.000** 966.245
60 C 1.000** 966.245
61 R 1.000** 966.245
62 I 1.000** 966.245
63 P 1.000** 966.245
64 V 1.000** 966.245
65 V 1.000** 966.245
66 A 1.000** 966.245
67 G 1.000** 966.245
68 R 1.000** 966.245
69 S 1.000** 966.245
70 V 1.000** 966.245
71 V 1.000** 966.245
72 A 1.000** 966.245
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907811_1_601_MLBR_RS02840)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -271.614493 Model 2: PositiveSelection -271.614437 Model 0: one-ratio -271.614437 Model 7: beta -271.614525 Model 8: beta&w>1 -271.614437 Model 0 vs 1 1.1199999994460086E-4 Model 2 vs 1 1.1199999994460086E-4 Model 8 vs 7 1.7600000001039007E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
