--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:23:58 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0614/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -387.71 -391.63
2 -387.69 -392.24
--------------------------------------
TOTAL -387.70 -391.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897175 0.091663 0.372903 1.502472 0.868736 1501.00 1501.00 1.000
r(A<->C){all} 0.167906 0.019682 0.000073 0.444801 0.130318 192.05 200.01 1.000
r(A<->G){all} 0.160030 0.018948 0.000044 0.436589 0.119519 275.93 282.80 1.000
r(A<->T){all} 0.171803 0.019318 0.000158 0.447288 0.137214 145.10 240.23 1.001
r(C<->G){all} 0.166722 0.019344 0.000025 0.436544 0.131707 155.84 185.01 1.000
r(C<->T){all} 0.177043 0.021983 0.000013 0.469817 0.139047 203.41 237.31 1.000
r(G<->T){all} 0.156497 0.018200 0.000049 0.428593 0.119738 303.56 315.49 1.000
pi(A){all} 0.173206 0.000481 0.132519 0.217964 0.172361 1459.71 1472.55 1.000
pi(C){all} 0.224016 0.000604 0.176397 0.271345 0.222725 1168.89 1298.64 1.000
pi(G){all} 0.346164 0.000795 0.293084 0.405108 0.344840 1299.01 1400.00 1.000
pi(T){all} 0.256614 0.000672 0.204248 0.306472 0.256159 1236.88 1252.09 1.000
alpha{1,2} 0.407062 0.217839 0.000103 1.300354 0.238773 878.39 1078.46 1.000
alpha{3} 0.476651 0.243236 0.000163 1.468328 0.318347 1421.38 1461.19 1.000
pinvar{all} 0.994416 0.000048 0.981453 0.999992 0.996679 1142.06 1264.19 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -375.34017
Model 2: PositiveSelection -375.34017
Model 0: one-ratio -375.34043
Model 7: beta -375.34017
Model 8: beta&w>1 -375.34017
Model 0 vs 1 5.200000000513683E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C2
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C3
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C4
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C5
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C6
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=95
C1 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C2 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C3 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C4 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C5 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C6 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
**************************************************
C1 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C2 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C3 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C4 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C5 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C6 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
*********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2850]--->[2850]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 30.619 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C2 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C3 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C4 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C5 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
C6 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
**************************************************
C1 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C2 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C3 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C4 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C5 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
C6 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
*********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
C2 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
C3 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
C4 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
C5 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
C6 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
**************************************************
C1 TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
C2 TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
C3 TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
C4 TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
C5 TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
C6 TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
**************************************************
C1 GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
C2 GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
C3 GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
C4 GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
C5 GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
C6 GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
**************************************************
C1 TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
C2 TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
C3 TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
C4 TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
C5 TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
C6 TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
**************************************************
C1 CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
C2 CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
C3 CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
C4 CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
C5 CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
C6 CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
**************************************************
C1 TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
C2 TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
C3 TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
C4 TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
C5 TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
C6 TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
***********************************
>C1
ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
>C2
ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
>C3
ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
>C4
ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
>C5
ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
>C6
ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA
TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG
GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC
TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA
CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA
TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
>C1
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C2
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C3
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C4
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C5
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
>C6
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 285 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579796565
Setting output file names to "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 690747139
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0849640853
Seed = 1536065776
Swapseed = 1579796565
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -637.843660 -- -24.965149
Chain 2 -- -637.843563 -- -24.965149
Chain 3 -- -637.843563 -- -24.965149
Chain 4 -- -637.843660 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -637.843660 -- -24.965149
Chain 2 -- -637.843622 -- -24.965149
Chain 3 -- -637.843622 -- -24.965149
Chain 4 -- -637.843660 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-637.844] (-637.844) (-637.844) (-637.844) * [-637.844] (-637.844) (-637.844) (-637.844)
500 -- [-403.866] (-398.277) (-397.129) (-398.856) * (-398.282) (-397.668) [-397.979] (-396.637) -- 0:00:00
1000 -- (-398.520) (-399.772) (-394.940) [-395.124] * (-404.301) (-399.457) (-398.371) [-395.806] -- 0:00:00
1500 -- (-393.813) (-395.738) (-393.893) [-396.543] * [-395.272] (-403.441) (-413.986) (-400.730) -- 0:00:00
2000 -- (-398.790) (-396.037) [-398.689] (-399.754) * (-391.162) [-398.055] (-399.116) (-394.347) -- 0:00:00
2500 -- (-399.680) (-398.809) [-397.176] (-393.876) * (-401.337) [-399.067] (-394.944) (-398.898) -- 0:00:00
3000 -- (-398.997) (-396.321) [-398.947] (-401.980) * (-398.758) (-395.150) (-409.185) [-395.509] -- 0:00:00
3500 -- (-404.648) (-406.210) [-393.453] (-400.026) * [-398.390] (-401.837) (-395.500) (-406.403) -- 0:00:00
4000 -- [-400.034] (-401.574) (-397.349) (-400.576) * (-404.543) (-393.632) [-397.166] (-398.119) -- 0:00:00
4500 -- (-406.882) (-399.581) [-394.900] (-397.303) * (-404.518) [-398.637] (-394.879) (-404.383) -- 0:00:00
5000 -- (-400.941) (-404.283) (-395.252) [-393.886] * (-395.319) [-393.092] (-397.380) (-408.726) -- 0:00:00
Average standard deviation of split frequencies: 0.068319
5500 -- (-408.345) [-399.187] (-396.140) (-398.449) * (-399.097) (-399.592) (-391.861) [-394.904] -- 0:00:00
6000 -- [-398.150] (-397.582) (-406.219) (-396.936) * (-396.543) [-397.134] (-401.795) (-400.651) -- 0:00:00
6500 -- [-394.230] (-398.020) (-408.037) (-396.075) * (-396.542) (-393.892) [-400.900] (-398.643) -- 0:00:00
7000 -- [-393.308] (-393.077) (-398.588) (-394.188) * (-396.318) (-407.368) [-393.512] (-399.693) -- 0:00:00
7500 -- (-400.718) [-397.084] (-397.631) (-398.083) * (-412.284) (-399.031) (-397.043) [-399.060] -- 0:00:00
8000 -- [-393.955] (-397.141) (-399.244) (-396.001) * (-400.879) (-392.656) [-393.760] (-395.751) -- 0:00:00
8500 -- (-398.408) (-397.419) (-401.344) [-394.662] * (-395.626) (-400.175) (-405.875) [-397.304] -- 0:00:00
9000 -- [-399.455] (-398.118) (-395.051) (-400.386) * (-389.856) (-396.693) (-400.951) [-397.228] -- 0:00:00
9500 -- (-411.849) (-397.629) (-395.903) [-397.653] * [-386.397] (-399.346) (-399.771) (-391.777) -- 0:00:00
10000 -- (-401.065) (-397.960) [-399.695] (-394.775) * (-389.307) [-402.198] (-402.478) (-394.442) -- 0:00:00
Average standard deviation of split frequencies: 0.044194
10500 -- (-398.382) (-404.756) [-395.601] (-404.236) * (-390.174) (-402.123) [-394.930] (-395.879) -- 0:00:00
11000 -- [-391.386] (-401.267) (-391.510) (-395.466) * (-386.433) [-392.178] (-398.502) (-401.045) -- 0:00:00
11500 -- (-401.624) (-403.953) [-402.482] (-404.398) * [-386.983] (-407.417) (-390.051) (-397.823) -- 0:00:00
12000 -- (-395.592) (-396.954) [-396.655] (-404.709) * [-389.219] (-395.745) (-403.605) (-391.822) -- 0:00:00
12500 -- (-409.051) (-391.681) [-396.902] (-398.579) * [-387.651] (-395.413) (-399.932) (-396.065) -- 0:01:19
13000 -- (-400.210) [-392.174] (-400.193) (-399.575) * [-388.611] (-396.564) (-397.453) (-395.207) -- 0:01:15
13500 -- (-396.522) (-398.081) [-398.911] (-400.687) * [-386.454] (-399.069) (-395.362) (-394.246) -- 0:01:13
14000 -- (-400.446) (-398.158) (-402.966) [-394.078] * (-386.255) (-402.591) [-396.534] (-395.758) -- 0:01:10
14500 -- (-403.899) [-396.413] (-392.190) (-401.737) * (-386.724) [-399.723] (-408.942) (-392.672) -- 0:01:07
15000 -- (-410.922) [-397.792] (-398.166) (-392.671) * (-386.719) (-393.667) (-394.607) [-393.250] -- 0:01:05
Average standard deviation of split frequencies: 0.047702
15500 -- (-413.261) [-392.975] (-392.923) (-393.239) * (-387.628) (-397.744) (-404.823) [-396.449] -- 0:01:03
16000 -- (-411.722) (-400.530) (-398.080) [-397.248] * (-389.280) [-402.521] (-398.506) (-401.632) -- 0:01:01
16500 -- (-397.366) [-396.535] (-400.684) (-404.682) * (-387.219) (-395.760) [-397.355] (-397.160) -- 0:00:59
17000 -- (-391.786) [-397.458] (-392.666) (-403.226) * [-387.079] (-395.246) (-396.842) (-394.517) -- 0:00:57
17500 -- (-388.873) (-405.128) (-407.013) [-397.155] * (-391.758) [-398.495] (-399.904) (-401.204) -- 0:00:56
18000 -- [-390.043] (-400.385) (-395.188) (-408.497) * (-387.230) [-393.844] (-404.510) (-407.946) -- 0:00:54
18500 -- (-387.576) [-408.428] (-396.401) (-393.633) * (-387.322) (-401.298) [-396.807] (-398.221) -- 0:00:53
19000 -- [-388.820] (-411.883) (-409.163) (-393.516) * [-387.318] (-396.795) (-399.991) (-398.407) -- 0:00:51
19500 -- (-392.436) (-396.034) [-397.343] (-397.046) * [-388.176] (-396.090) (-398.422) (-394.530) -- 0:00:50
20000 -- (-389.971) (-390.655) [-392.491] (-395.353) * [-387.789] (-393.551) (-401.897) (-392.946) -- 0:00:49
Average standard deviation of split frequencies: 0.041818
20500 -- (-387.578) (-386.840) [-394.744] (-397.011) * (-387.774) [-395.309] (-396.453) (-407.075) -- 0:00:47
21000 -- (-390.080) (-386.363) [-398.083] (-397.505) * (-389.296) (-402.303) (-397.537) [-398.711] -- 0:00:46
21500 -- (-387.652) [-389.055] (-394.615) (-403.148) * [-388.018] (-396.979) (-399.273) (-399.717) -- 0:00:45
22000 -- (-386.139) (-392.162) (-397.345) [-395.594] * (-391.134) (-407.125) [-396.568] (-387.391) -- 0:00:44
22500 -- (-389.908) (-388.293) [-397.360] (-412.997) * (-391.993) (-401.349) (-398.152) [-387.503] -- 0:00:43
23000 -- (-388.597) (-389.547) [-391.732] (-400.739) * (-393.654) (-390.414) [-395.729] (-387.253) -- 0:00:42
23500 -- (-389.174) (-390.644) [-392.750] (-395.388) * (-389.686) (-402.570) (-399.150) [-389.514] -- 0:00:41
24000 -- (-388.864) (-389.510) (-399.841) [-393.947] * (-389.446) (-411.085) (-396.364) [-388.323] -- 0:00:40
24500 -- (-391.686) [-389.087] (-403.656) (-402.530) * (-387.154) (-397.596) (-396.448) [-389.273] -- 0:00:39
25000 -- [-386.240] (-391.203) (-401.286) (-404.291) * (-386.731) [-386.360] (-395.143) (-392.288) -- 0:00:39
Average standard deviation of split frequencies: 0.039125
25500 -- (-387.746) [-387.276] (-394.516) (-396.111) * (-389.306) (-387.783) [-393.525] (-390.232) -- 0:00:38
26000 -- (-389.372) (-389.772) [-403.365] (-398.583) * (-387.973) (-388.433) [-397.681] (-389.894) -- 0:00:37
26500 -- (-386.376) (-388.434) [-399.602] (-396.245) * (-386.986) (-388.185) [-394.852] (-391.548) -- 0:00:36
27000 -- (-386.605) (-387.275) (-399.980) [-401.206] * (-387.566) (-388.691) (-402.892) [-389.710] -- 0:00:36
27500 -- (-389.931) (-386.846) (-401.817) [-396.369] * [-391.325] (-389.808) (-400.623) (-389.720) -- 0:00:35
28000 -- (-387.260) (-389.325) [-393.568] (-399.918) * (-390.523) (-390.867) (-402.754) [-388.765] -- 0:00:34
28500 -- (-388.877) [-387.543] (-398.517) (-405.519) * [-388.751] (-390.151) (-400.407) (-390.682) -- 0:00:34
29000 -- (-388.484) (-386.934) (-394.430) [-400.470] * [-387.898] (-389.227) (-404.866) (-393.618) -- 0:01:06
29500 -- [-388.957] (-387.246) (-406.470) (-398.087) * (-387.763) (-386.721) (-405.278) [-388.120] -- 0:01:05
30000 -- (-390.030) (-388.405) (-394.354) [-399.249] * [-389.687] (-388.512) (-391.985) (-388.288) -- 0:01:04
Average standard deviation of split frequencies: 0.035355
30500 -- (-389.155) (-388.238) (-396.471) [-392.399] * (-388.476) [-389.572] (-386.842) (-387.122) -- 0:01:03
31000 -- (-389.318) (-388.883) (-397.890) [-397.823] * (-387.812) [-389.249] (-387.932) (-389.798) -- 0:01:02
31500 -- [-387.921] (-387.304) (-395.318) (-409.376) * (-387.387) (-387.258) (-388.643) [-390.905] -- 0:01:01
32000 -- (-386.784) [-386.948] (-401.317) (-402.304) * (-386.723) (-387.939) (-390.939) [-389.591] -- 0:01:00
32500 -- [-388.381] (-386.787) (-403.397) (-402.099) * [-392.629] (-387.057) (-392.889) (-387.127) -- 0:00:59
33000 -- [-389.244] (-387.175) (-399.111) (-396.739) * (-391.454) [-388.725] (-387.682) (-386.482) -- 0:00:58
33500 -- (-387.757) (-388.443) [-396.228] (-405.443) * (-390.210) (-387.496) (-388.606) [-386.978] -- 0:00:57
34000 -- (-392.647) [-387.981] (-395.447) (-398.182) * (-390.928) [-386.587] (-389.849) (-389.307) -- 0:00:56
34500 -- (-391.399) (-389.763) (-394.435) [-390.564] * (-387.283) [-388.307] (-389.908) (-388.822) -- 0:00:55
35000 -- (-389.101) (-388.873) (-407.151) [-387.954] * (-393.300) [-389.873] (-388.187) (-391.559) -- 0:00:55
Average standard deviation of split frequencies: 0.038556
35500 -- [-388.028] (-390.518) (-399.812) (-387.627) * (-387.683) (-387.311) [-388.661] (-386.594) -- 0:00:54
36000 -- (-386.735) (-387.734) (-400.229) [-388.282] * (-392.722) [-386.597] (-388.834) (-393.368) -- 0:00:53
36500 -- (-387.618) (-387.368) (-404.756) [-386.525] * (-391.345) (-390.292) (-389.102) [-390.087] -- 0:00:52
37000 -- [-387.335] (-390.754) (-405.039) (-387.732) * (-388.722) (-386.174) [-386.843] (-391.224) -- 0:00:52
37500 -- (-387.769) [-387.947] (-399.517) (-390.161) * [-390.678] (-387.042) (-386.685) (-387.067) -- 0:00:51
38000 -- (-388.660) (-388.475) (-402.768) [-388.921] * (-391.200) [-386.869] (-389.314) (-391.429) -- 0:00:50
38500 -- [-387.768] (-388.873) (-412.958) (-390.583) * (-386.871) (-387.412) (-387.666) [-387.621] -- 0:00:49
39000 -- (-392.068) (-386.743) (-396.825) [-388.675] * (-387.205) (-389.508) (-388.378) [-387.077] -- 0:00:49
39500 -- [-387.314] (-388.278) (-390.383) (-390.561) * [-388.869] (-388.707) (-387.965) (-391.516) -- 0:00:48
40000 -- (-387.295) (-391.706) [-389.471] (-390.482) * (-388.234) (-389.565) [-386.717] (-389.076) -- 0:00:48
Average standard deviation of split frequencies: 0.041216
40500 -- [-388.773] (-390.097) (-389.736) (-389.337) * (-389.774) (-387.357) (-388.274) [-389.950] -- 0:00:47
41000 -- (-387.851) [-388.150] (-387.137) (-393.428) * [-388.337] (-387.810) (-388.989) (-387.390) -- 0:00:46
41500 -- (-390.063) (-391.530) [-387.026] (-387.598) * (-388.811) [-386.389] (-388.906) (-387.287) -- 0:00:46
42000 -- (-388.174) (-386.723) (-386.304) [-387.522] * (-388.800) (-388.145) (-387.716) [-387.779] -- 0:00:45
42500 -- (-387.388) (-387.069) [-391.485] (-390.253) * [-387.502] (-386.609) (-391.115) (-389.334) -- 0:00:45
43000 -- [-388.755] (-390.002) (-388.895) (-389.413) * [-390.168] (-389.054) (-387.304) (-386.693) -- 0:00:44
43500 -- [-388.092] (-394.814) (-387.843) (-389.977) * (-391.120) [-388.271] (-391.245) (-386.236) -- 0:00:43
44000 -- (-388.409) (-393.785) [-389.809] (-387.065) * (-388.256) (-389.944) [-388.388] (-387.803) -- 0:00:43
44500 -- (-391.331) (-386.503) (-388.185) [-387.984] * (-389.145) [-387.228] (-386.214) (-390.202) -- 0:00:42
45000 -- (-390.280) [-386.901] (-386.829) (-390.253) * (-387.948) (-387.372) [-388.211] (-392.573) -- 0:00:42
Average standard deviation of split frequencies: 0.038552
45500 -- (-386.947) (-387.132) (-388.404) [-388.833] * [-386.994] (-388.640) (-386.627) (-388.345) -- 0:00:41
46000 -- (-389.791) [-387.486] (-388.894) (-387.762) * (-388.881) (-390.715) [-388.189] (-388.040) -- 0:01:02
46500 -- (-389.161) (-386.891) [-389.291] (-389.600) * (-388.179) (-391.319) [-389.089] (-388.386) -- 0:01:01
47000 -- (-389.822) [-387.531] (-388.145) (-386.905) * (-386.753) (-392.619) [-389.964] (-388.649) -- 0:01:00
47500 -- [-390.046] (-388.326) (-387.601) (-388.101) * [-387.327] (-388.801) (-386.219) (-390.694) -- 0:01:00
48000 -- (-390.990) (-388.246) (-388.592) [-387.063] * [-388.473] (-391.942) (-392.251) (-387.747) -- 0:00:59
48500 -- [-388.690] (-389.836) (-391.335) (-386.778) * (-390.942) (-386.606) [-387.259] (-389.782) -- 0:00:58
49000 -- [-389.672] (-392.520) (-391.042) (-390.342) * (-389.742) (-387.153) [-387.050] (-390.028) -- 0:00:58
49500 -- (-387.517) (-390.997) [-388.317] (-392.403) * [-390.196] (-391.242) (-389.184) (-388.168) -- 0:00:57
50000 -- (-389.704) [-387.780] (-388.318) (-388.123) * (-387.051) (-387.171) (-389.491) [-387.301] -- 0:00:57
Average standard deviation of split frequencies: 0.040473
50500 -- (-391.342) (-387.423) (-389.666) [-388.948] * (-386.407) (-387.656) (-387.649) [-387.450] -- 0:00:56
51000 -- [-389.867] (-387.601) (-387.396) (-388.558) * (-389.631) [-390.173] (-387.745) (-388.506) -- 0:00:55
51500 -- (-388.612) (-388.882) (-388.451) [-388.038] * (-387.819) (-394.499) (-388.998) [-386.805] -- 0:00:55
52000 -- (-390.209) [-387.160] (-387.232) (-389.857) * (-389.246) [-388.857] (-388.519) (-387.259) -- 0:00:54
52500 -- [-391.706] (-386.253) (-388.453) (-387.478) * (-389.803) (-388.231) [-387.215] (-389.265) -- 0:00:54
53000 -- (-389.172) [-386.687] (-387.682) (-387.921) * (-391.666) (-389.884) [-388.696] (-389.156) -- 0:00:53
53500 -- (-387.969) [-388.090] (-388.606) (-388.037) * (-386.928) [-388.575] (-393.251) (-391.882) -- 0:00:53
54000 -- (-388.531) (-386.513) (-388.079) [-387.439] * [-387.238] (-387.630) (-391.362) (-389.561) -- 0:00:52
54500 -- (-388.672) [-386.969] (-391.325) (-390.173) * (-388.261) (-388.142) [-388.221] (-386.997) -- 0:00:52
55000 -- (-388.592) (-389.335) [-387.760] (-389.223) * (-387.538) [-388.555] (-389.523) (-388.709) -- 0:00:51
Average standard deviation of split frequencies: 0.035776
55500 -- (-390.623) [-389.034] (-388.168) (-388.224) * (-387.089) [-388.323] (-390.699) (-389.739) -- 0:00:51
56000 -- (-389.459) [-387.703] (-391.000) (-386.746) * (-393.430) (-387.938) (-387.657) [-392.655] -- 0:00:50
56500 -- (-391.216) (-391.398) (-388.234) [-387.542] * (-392.705) (-388.168) [-387.567] (-390.135) -- 0:00:50
57000 -- (-387.695) (-390.183) [-391.991] (-387.718) * (-388.828) (-391.139) (-387.276) [-387.021] -- 0:00:49
57500 -- (-387.677) [-387.528] (-391.848) (-386.928) * (-388.552) (-388.988) [-387.860] (-387.798) -- 0:00:49
58000 -- (-388.496) [-391.905] (-390.436) (-390.269) * (-390.500) (-387.130) (-388.531) [-387.386] -- 0:00:48
58500 -- [-388.291] (-390.075) (-386.839) (-389.387) * (-389.981) [-387.239] (-387.479) (-391.122) -- 0:00:48
59000 -- (-386.796) [-386.770] (-389.416) (-390.945) * (-387.948) (-388.220) [-387.417] (-389.259) -- 0:00:47
59500 -- (-387.114) (-387.408) [-388.525] (-386.845) * (-388.785) (-387.242) (-389.096) [-388.988] -- 0:00:47
60000 -- (-390.736) (-387.223) [-392.000] (-387.390) * (-388.911) (-386.871) [-387.082] (-394.002) -- 0:00:47
Average standard deviation of split frequencies: 0.032377
60500 -- (-387.809) (-386.891) [-387.081] (-387.220) * (-391.230) [-388.564] (-387.057) (-387.241) -- 0:00:46
61000 -- [-387.544] (-388.140) (-389.318) (-387.671) * (-389.001) (-389.809) (-386.516) [-387.600] -- 0:00:46
61500 -- (-387.028) (-396.624) (-390.839) [-390.388] * (-386.836) (-391.391) (-388.061) [-386.377] -- 0:00:45
62000 -- [-388.379] (-387.570) (-390.480) (-387.250) * (-386.514) (-388.568) [-387.604] (-387.022) -- 0:00:45
62500 -- [-386.374] (-389.455) (-389.879) (-386.750) * (-387.638) (-388.888) [-387.688] (-387.250) -- 0:00:45
63000 -- (-386.618) (-390.821) (-392.890) [-387.144] * (-388.313) (-387.365) [-388.653] (-387.807) -- 0:00:59
63500 -- (-386.549) (-387.618) [-388.999] (-391.760) * (-395.694) [-386.107] (-389.181) (-389.216) -- 0:00:58
64000 -- (-392.105) (-389.752) [-389.165] (-389.584) * (-389.253) (-388.261) [-389.938] (-390.727) -- 0:00:58
64500 -- (-388.924) (-386.981) (-389.887) [-388.800] * (-387.077) [-389.286] (-387.953) (-389.786) -- 0:00:58
65000 -- (-390.832) [-387.265] (-387.392) (-389.589) * [-386.895] (-392.012) (-389.039) (-391.832) -- 0:00:57
Average standard deviation of split frequencies: 0.030271
65500 -- (-388.348) (-389.258) (-388.557) [-389.320] * (-386.399) (-393.163) [-386.766] (-388.631) -- 0:00:57
66000 -- (-388.922) [-388.521] (-390.927) (-396.998) * (-386.926) (-387.377) (-386.376) [-387.685] -- 0:00:56
66500 -- (-388.173) (-388.765) (-386.552) [-386.182] * [-387.580] (-387.337) (-386.519) (-387.672) -- 0:00:56
67000 -- (-388.065) (-390.690) (-388.188) [-388.473] * (-387.681) (-390.592) (-386.363) [-389.072] -- 0:00:55
67500 -- [-388.934] (-386.469) (-387.526) (-391.671) * [-387.269] (-388.269) (-387.272) (-387.362) -- 0:00:55
68000 -- (-388.678) (-391.720) (-391.462) [-388.505] * [-387.463] (-387.111) (-387.977) (-391.476) -- 0:00:54
68500 -- (-387.443) (-388.930) (-387.278) [-388.236] * [-387.483] (-394.010) (-388.814) (-390.006) -- 0:00:54
69000 -- (-387.760) (-394.278) [-388.272] (-389.514) * (-390.087) (-392.453) [-386.599] (-388.685) -- 0:00:53
69500 -- (-388.702) (-386.951) [-392.030] (-388.040) * (-388.611) (-387.473) [-387.084] (-389.929) -- 0:00:53
70000 -- (-387.696) (-388.819) (-388.934) [-390.632] * (-388.021) (-387.783) (-388.920) [-389.058] -- 0:00:53
Average standard deviation of split frequencies: 0.030495
70500 -- (-386.872) (-389.436) [-386.518] (-386.717) * (-389.270) (-388.060) [-390.985] (-389.173) -- 0:00:52
71000 -- (-388.472) (-386.935) [-386.915] (-389.770) * (-389.731) [-393.236] (-388.299) (-388.723) -- 0:00:52
71500 -- [-388.511] (-390.595) (-388.048) (-387.431) * (-392.903) (-390.764) [-386.918] (-386.812) -- 0:00:51
72000 -- (-389.896) (-391.155) [-389.563] (-387.336) * [-388.315] (-393.081) (-389.470) (-386.778) -- 0:00:51
72500 -- [-390.882] (-389.540) (-390.990) (-389.658) * (-386.614) [-387.621] (-386.379) (-389.304) -- 0:00:51
73000 -- (-391.236) (-390.336) [-390.444] (-389.025) * (-386.793) (-387.531) [-387.948] (-388.044) -- 0:00:50
73500 -- (-387.779) (-388.574) (-388.697) [-386.542] * (-389.536) [-387.353] (-387.769) (-390.015) -- 0:00:50
74000 -- (-389.059) (-389.447) (-388.625) [-386.311] * (-387.258) [-386.942] (-388.172) (-394.699) -- 0:00:50
74500 -- (-390.944) [-388.282] (-387.383) (-387.961) * (-387.387) (-386.505) [-390.662] (-387.429) -- 0:00:49
75000 -- (-391.655) (-388.613) [-387.390] (-388.634) * (-389.209) [-387.108] (-392.294) (-388.373) -- 0:00:49
Average standard deviation of split frequencies: 0.030393
75500 -- (-387.536) [-390.302] (-387.471) (-391.818) * (-389.810) (-387.361) (-388.530) [-388.994] -- 0:00:48
76000 -- (-388.847) [-388.166] (-390.613) (-392.610) * (-387.444) (-391.982) (-389.303) [-387.171] -- 0:00:48
76500 -- [-388.618] (-386.866) (-387.705) (-387.660) * (-388.551) (-387.612) (-390.311) [-390.646] -- 0:00:48
77000 -- (-386.274) [-388.934] (-389.815) (-387.797) * (-387.521) [-387.774] (-391.069) (-387.733) -- 0:00:47
77500 -- (-392.155) (-388.074) [-387.465] (-387.258) * (-386.697) (-387.270) (-389.550) [-389.258] -- 0:00:47
78000 -- (-395.349) [-389.524] (-386.545) (-387.567) * (-387.888) (-388.604) [-389.253] (-394.900) -- 0:00:47
78500 -- (-392.582) [-386.332] (-389.543) (-387.645) * (-386.934) (-389.977) [-388.690] (-389.715) -- 0:00:46
79000 -- (-388.227) (-390.165) [-389.081] (-388.014) * (-387.772) [-388.102] (-389.540) (-387.422) -- 0:00:46
79500 -- (-387.153) (-387.688) (-390.919) [-387.666] * [-387.312] (-387.836) (-387.370) (-387.921) -- 0:00:46
80000 -- [-388.005] (-387.529) (-390.821) (-388.169) * (-388.205) (-391.378) [-390.760] (-390.373) -- 0:00:57
Average standard deviation of split frequencies: 0.029511
80500 -- [-387.558] (-388.513) (-391.511) (-387.763) * [-387.705] (-389.098) (-394.778) (-389.062) -- 0:00:57
81000 -- (-389.981) (-389.277) (-388.843) [-391.499] * [-392.165] (-387.055) (-387.382) (-387.701) -- 0:00:56
81500 -- (-389.213) (-390.447) (-389.440) [-390.019] * (-390.560) (-390.629) (-388.091) [-388.191] -- 0:00:56
82000 -- (-389.707) (-389.359) (-386.763) [-389.839] * [-390.864] (-387.044) (-386.457) (-388.924) -- 0:00:55
82500 -- (-388.199) (-389.116) (-388.447) [-387.607] * (-389.547) (-390.941) (-388.120) [-388.736] -- 0:00:55
83000 -- (-387.653) (-386.916) [-388.508] (-389.324) * (-392.969) (-388.098) [-387.374] (-388.796) -- 0:00:55
83500 -- (-391.653) (-387.741) [-388.728] (-392.046) * (-390.284) (-386.511) [-388.957] (-386.699) -- 0:00:54
84000 -- (-386.797) [-388.898] (-390.029) (-387.034) * (-386.742) [-388.181] (-387.352) (-388.519) -- 0:00:54
84500 -- (-387.607) [-389.182] (-387.840) (-389.315) * (-390.153) (-386.926) (-386.195) [-387.556] -- 0:00:54
85000 -- [-387.327] (-388.706) (-388.291) (-387.797) * (-387.478) (-390.255) (-388.327) [-388.083] -- 0:00:53
Average standard deviation of split frequencies: 0.029874
85500 -- (-391.185) (-388.309) [-388.848] (-387.003) * (-386.443) [-390.176] (-389.714) (-389.453) -- 0:00:53
86000 -- (-386.510) (-388.093) (-388.612) [-386.232] * [-386.765] (-389.417) (-391.664) (-392.169) -- 0:00:53
86500 -- [-387.260] (-389.916) (-386.498) (-386.993) * [-386.047] (-391.055) (-386.349) (-388.648) -- 0:00:52
87000 -- [-387.701] (-389.017) (-395.639) (-388.996) * (-387.422) (-389.566) (-387.232) [-388.198] -- 0:00:52
87500 -- (-393.352) (-390.779) [-387.804] (-387.441) * [-388.506] (-390.634) (-388.258) (-394.370) -- 0:00:52
88000 -- (-390.862) [-393.592] (-389.414) (-390.573) * (-390.752) (-387.482) (-390.748) [-387.978] -- 0:00:51
88500 -- (-387.719) (-394.869) [-389.251] (-386.318) * (-389.859) [-390.255] (-393.389) (-386.272) -- 0:00:51
89000 -- [-386.924] (-387.145) (-387.403) (-390.155) * (-387.668) [-387.744] (-388.970) (-389.349) -- 0:00:51
89500 -- (-386.419) [-386.907] (-387.510) (-389.138) * (-393.452) (-387.178) [-389.226] (-391.444) -- 0:00:50
90000 -- (-388.590) (-386.554) (-387.170) [-391.987] * (-388.830) (-387.810) [-387.110] (-388.091) -- 0:00:50
Average standard deviation of split frequencies: 0.029376
90500 -- [-388.422] (-386.658) (-386.413) (-387.470) * (-386.328) (-393.515) (-388.841) [-388.758] -- 0:00:50
91000 -- [-387.038] (-388.890) (-389.056) (-388.083) * (-386.529) [-389.648] (-390.378) (-387.182) -- 0:00:49
91500 -- [-386.919] (-390.469) (-388.665) (-387.208) * [-387.439] (-388.277) (-388.313) (-386.936) -- 0:00:49
92000 -- [-386.843] (-389.519) (-387.603) (-388.566) * [-389.228] (-387.546) (-390.144) (-388.408) -- 0:00:49
92500 -- [-387.568] (-394.094) (-387.098) (-391.935) * (-386.834) [-386.380] (-391.448) (-387.703) -- 0:00:49
93000 -- (-387.439) (-389.160) (-387.806) [-388.198] * (-387.920) (-389.796) (-389.345) [-388.700] -- 0:00:48
93500 -- [-389.398] (-388.899) (-387.441) (-387.527) * (-389.732) (-387.209) (-389.862) [-387.953] -- 0:00:48
94000 -- (-392.206) (-389.161) [-388.770] (-388.080) * [-391.614] (-386.624) (-389.586) (-388.886) -- 0:00:48
94500 -- (-389.874) (-387.638) [-387.782] (-388.143) * (-389.565) (-392.539) (-386.333) [-390.045] -- 0:00:47
95000 -- (-390.186) (-391.808) [-386.962] (-387.686) * (-389.831) (-389.156) [-386.604] (-389.558) -- 0:00:47
Average standard deviation of split frequencies: 0.029190
95500 -- [-387.662] (-391.071) (-388.085) (-386.787) * (-390.093) [-390.708] (-388.414) (-388.944) -- 0:00:47
96000 -- [-386.654] (-387.987) (-387.332) (-389.889) * [-389.116] (-391.576) (-387.197) (-388.941) -- 0:00:47
96500 -- (-389.924) (-389.180) [-388.180] (-386.232) * [-386.297] (-386.506) (-389.229) (-386.876) -- 0:00:46
97000 -- (-386.470) (-391.335) (-396.674) [-388.093] * (-392.841) [-387.535] (-389.022) (-387.477) -- 0:00:55
97500 -- (-389.864) (-387.349) [-388.422] (-387.943) * (-388.750) [-391.853] (-391.021) (-386.963) -- 0:00:55
98000 -- (-388.970) (-389.047) [-387.919] (-386.954) * (-390.489) (-389.939) [-389.141] (-387.751) -- 0:00:55
98500 -- (-390.016) [-389.340] (-389.270) (-389.487) * (-387.690) (-388.069) [-388.509] (-388.483) -- 0:00:54
99000 -- (-388.828) (-387.547) [-389.445] (-388.036) * (-389.870) [-387.763] (-388.966) (-389.014) -- 0:00:54
99500 -- [-388.730] (-391.718) (-391.994) (-387.714) * (-389.719) (-388.816) (-388.545) [-387.486] -- 0:00:54
100000 -- (-387.433) [-389.852] (-393.245) (-391.205) * (-387.818) [-391.841] (-393.339) (-388.082) -- 0:00:54
Average standard deviation of split frequencies: 0.028343
100500 -- (-387.624) (-387.263) [-388.575] (-390.922) * [-390.225] (-387.681) (-389.720) (-387.269) -- 0:00:53
101000 -- (-389.189) [-387.638] (-393.523) (-390.133) * (-389.583) (-390.725) [-388.735] (-386.799) -- 0:00:53
101500 -- (-389.006) (-391.927) [-387.454] (-391.159) * [-388.828] (-390.187) (-388.852) (-386.877) -- 0:00:53
102000 -- (-388.351) (-392.454) [-386.976] (-390.257) * (-389.369) (-388.775) [-387.052] (-390.974) -- 0:00:52
102500 -- (-392.431) [-390.747] (-387.296) (-388.015) * (-386.887) (-392.030) (-389.870) [-388.449] -- 0:00:52
103000 -- (-392.174) (-388.416) [-389.169] (-386.929) * (-387.686) (-388.074) (-388.426) [-391.464] -- 0:00:52
103500 -- (-389.571) (-386.455) (-388.102) [-386.598] * [-387.969] (-389.347) (-388.140) (-388.452) -- 0:00:51
104000 -- (-386.810) (-387.798) [-387.600] (-391.702) * [-388.765] (-387.276) (-386.391) (-390.942) -- 0:00:51
104500 -- (-386.910) (-390.358) [-386.408] (-406.595) * [-388.863] (-387.154) (-389.101) (-389.134) -- 0:00:51
105000 -- (-388.171) (-391.042) [-388.090] (-392.148) * (-388.831) [-389.231] (-387.206) (-386.973) -- 0:00:51
Average standard deviation of split frequencies: 0.026239
105500 -- (-388.719) (-389.358) [-391.472] (-387.047) * [-389.238] (-386.954) (-392.081) (-388.239) -- 0:00:50
106000 -- (-387.724) (-390.679) (-389.383) [-388.825] * [-388.048] (-387.759) (-388.460) (-389.305) -- 0:00:50
106500 -- (-388.485) (-393.522) [-391.412] (-393.254) * [-386.923] (-393.758) (-387.437) (-392.993) -- 0:00:50
107000 -- (-387.653) (-390.592) [-387.768] (-386.810) * (-387.792) (-391.746) [-386.981] (-387.198) -- 0:00:50
107500 -- (-388.574) [-386.592] (-392.852) (-387.294) * (-387.350) (-390.655) [-387.607] (-388.233) -- 0:00:49
108000 -- (-386.713) (-388.696) (-392.395) [-387.233] * (-393.728) (-391.144) (-388.946) [-388.779] -- 0:00:49
108500 -- (-391.981) (-390.770) [-389.934] (-387.404) * (-393.935) (-389.014) [-387.465] (-390.836) -- 0:00:49
109000 -- (-387.606) (-392.486) (-390.397) [-390.803] * (-388.133) [-387.012] (-388.752) (-386.845) -- 0:00:49
109500 -- (-389.764) [-388.181] (-391.732) (-386.763) * (-386.765) [-387.789] (-387.341) (-390.320) -- 0:00:48
110000 -- [-387.099] (-388.334) (-389.691) (-388.389) * (-386.191) [-387.962] (-391.461) (-389.205) -- 0:00:48
Average standard deviation of split frequencies: 0.023316
110500 -- (-387.600) (-389.112) [-387.345] (-389.521) * (-387.536) (-388.775) (-387.294) [-388.406] -- 0:00:48
111000 -- (-387.372) (-389.565) [-387.481] (-388.952) * (-386.781) (-387.398) (-388.481) [-386.667] -- 0:00:48
111500 -- (-388.204) (-389.020) (-390.508) [-388.606] * (-387.745) (-388.440) [-388.646] (-388.369) -- 0:00:47
112000 -- [-389.210] (-389.327) (-388.194) (-386.738) * (-386.537) [-386.298] (-389.000) (-388.160) -- 0:00:47
112500 -- (-388.427) (-390.012) [-390.142] (-387.163) * [-389.837] (-387.515) (-391.390) (-390.594) -- 0:00:47
113000 -- [-391.206] (-387.673) (-388.741) (-387.098) * (-393.083) [-388.624] (-392.208) (-389.278) -- 0:00:47
113500 -- (-394.493) [-388.957] (-388.131) (-389.571) * [-388.013] (-389.510) (-387.958) (-386.997) -- 0:00:54
114000 -- (-386.875) (-387.481) [-388.003] (-386.898) * (-388.759) (-391.972) (-387.808) [-386.944] -- 0:00:54
114500 -- [-387.677] (-387.050) (-386.884) (-387.360) * (-389.799) (-390.485) [-390.251] (-388.117) -- 0:00:54
115000 -- (-389.559) (-388.316) (-386.832) [-392.189] * (-391.396) [-389.173] (-391.278) (-388.023) -- 0:00:53
Average standard deviation of split frequencies: 0.020533
115500 -- (-388.489) (-386.106) (-387.420) [-389.972] * (-389.406) [-387.076] (-387.339) (-393.505) -- 0:00:53
116000 -- (-389.471) [-386.444] (-387.372) (-387.797) * (-394.286) [-387.384] (-387.619) (-389.229) -- 0:00:53
116500 -- [-388.688] (-387.802) (-388.860) (-389.755) * [-390.892] (-386.308) (-387.593) (-388.104) -- 0:00:53
117000 -- [-387.069] (-389.407) (-388.963) (-388.887) * (-388.667) (-387.799) (-387.239) [-387.359] -- 0:00:52
117500 -- (-389.514) (-387.552) (-387.585) [-387.344] * [-387.808] (-386.409) (-387.701) (-388.739) -- 0:00:52
118000 -- (-390.850) [-386.550] (-387.713) (-390.113) * (-389.432) (-390.434) [-388.652] (-389.158) -- 0:00:52
118500 -- (-386.579) (-386.817) [-388.160] (-393.404) * [-387.151] (-386.949) (-390.856) (-386.568) -- 0:00:52
119000 -- (-387.460) (-388.370) [-387.360] (-386.711) * (-388.803) [-387.727] (-391.907) (-386.747) -- 0:00:51
119500 -- (-389.551) (-386.430) (-388.831) [-386.154] * (-389.030) (-389.583) [-386.225] (-387.494) -- 0:00:51
120000 -- (-390.281) (-387.991) (-388.780) [-386.208] * (-390.491) (-386.901) (-389.063) [-387.904] -- 0:00:51
Average standard deviation of split frequencies: 0.023223
120500 -- (-389.465) [-390.596] (-387.493) (-388.432) * (-386.892) (-391.560) [-388.746] (-389.062) -- 0:00:51
121000 -- [-390.646] (-388.371) (-387.896) (-388.334) * (-391.186) [-390.082] (-390.053) (-387.975) -- 0:00:50
121500 -- (-389.291) (-388.724) (-391.476) [-387.699] * (-390.041) (-392.511) [-389.714] (-388.531) -- 0:00:50
122000 -- [-389.675] (-389.842) (-391.413) (-386.884) * (-390.454) [-390.229] (-386.727) (-389.825) -- 0:00:50
122500 -- [-386.905] (-394.574) (-386.186) (-387.034) * (-388.797) (-388.493) (-387.696) [-387.669] -- 0:00:50
123000 -- (-386.695) [-393.492] (-388.592) (-389.453) * (-391.310) (-389.030) (-390.608) [-388.590] -- 0:00:49
123500 -- [-387.128] (-387.167) (-389.066) (-395.751) * [-386.782] (-388.371) (-389.180) (-390.057) -- 0:00:49
124000 -- (-387.892) (-389.492) [-387.875] (-388.235) * (-386.779) [-387.659] (-392.673) (-389.847) -- 0:00:49
124500 -- (-386.683) [-387.708] (-386.678) (-388.625) * (-392.252) (-386.592) [-387.121] (-389.650) -- 0:00:49
125000 -- (-386.996) [-390.464] (-388.796) (-387.812) * (-390.321) [-386.069] (-391.561) (-389.274) -- 0:00:49
Average standard deviation of split frequencies: 0.021513
125500 -- [-388.969] (-392.582) (-387.793) (-388.735) * (-387.488) (-393.518) (-388.784) [-389.418] -- 0:00:48
126000 -- (-389.164) (-390.942) (-389.657) [-388.219] * (-389.640) [-387.990] (-387.657) (-388.154) -- 0:00:48
126500 -- (-391.578) (-387.857) (-389.896) [-390.246] * (-389.202) (-392.480) [-389.765] (-390.673) -- 0:00:48
127000 -- (-389.403) [-389.243] (-388.206) (-388.111) * (-391.547) (-392.094) [-386.459] (-390.269) -- 0:00:48
127500 -- [-390.241] (-387.857) (-390.997) (-388.001) * [-387.056] (-392.299) (-387.063) (-389.152) -- 0:00:47
128000 -- (-390.105) (-390.383) (-388.123) [-387.094] * (-389.508) (-392.922) [-387.783] (-389.813) -- 0:00:47
128500 -- (-387.684) [-387.750] (-387.407) (-392.346) * [-387.703] (-391.272) (-388.527) (-390.602) -- 0:00:47
129000 -- (-392.354) (-387.703) [-387.158] (-391.190) * (-389.811) (-388.582) (-390.501) [-388.503] -- 0:00:47
129500 -- [-391.263] (-387.771) (-388.347) (-389.168) * (-392.112) (-390.219) [-387.262] (-388.357) -- 0:00:47
130000 -- (-392.074) (-390.108) (-388.467) [-390.647] * (-394.448) (-387.008) [-387.004] (-387.008) -- 0:00:46
Average standard deviation of split frequencies: 0.019041
130500 -- (-390.230) [-389.857] (-387.469) (-386.660) * [-396.609] (-391.965) (-387.218) (-390.165) -- 0:00:53
131000 -- [-386.886] (-388.067) (-389.103) (-387.604) * (-394.071) (-388.025) [-388.860] (-387.151) -- 0:00:53
131500 -- (-386.634) [-389.635] (-389.210) (-390.318) * (-388.789) (-387.369) (-388.468) [-387.140] -- 0:00:52
132000 -- (-387.145) [-391.042] (-387.591) (-387.911) * (-387.014) [-386.365] (-388.149) (-388.254) -- 0:00:52
132500 -- (-386.912) (-391.384) (-386.508) [-388.351] * (-391.806) (-391.288) (-387.823) [-387.230] -- 0:00:52
133000 -- (-388.691) (-387.093) (-390.757) [-388.059] * (-389.918) (-386.506) (-388.376) [-387.624] -- 0:00:52
133500 -- [-389.819] (-390.819) (-389.286) (-388.211) * (-389.241) [-389.516] (-387.998) (-387.064) -- 0:00:51
134000 -- (-390.010) [-388.509] (-386.625) (-387.475) * [-388.124] (-387.449) (-390.345) (-387.995) -- 0:00:51
134500 -- (-390.312) (-388.640) (-387.407) [-388.051] * (-388.848) [-390.341] (-390.104) (-386.343) -- 0:00:51
135000 -- (-391.083) (-389.266) (-388.053) [-389.996] * [-389.175] (-389.002) (-390.952) (-390.642) -- 0:00:51
Average standard deviation of split frequencies: 0.018101
135500 -- (-390.323) (-391.961) [-388.657] (-388.047) * [-388.922] (-387.328) (-386.721) (-392.989) -- 0:00:51
136000 -- (-391.330) [-391.170] (-389.278) (-388.676) * (-388.294) [-387.000] (-389.194) (-388.806) -- 0:00:50
136500 -- (-389.729) (-387.726) (-389.429) [-389.629] * [-390.929] (-387.689) (-389.021) (-391.044) -- 0:00:50
137000 -- (-386.669) (-388.293) [-391.405] (-387.686) * [-386.634] (-389.533) (-388.640) (-386.233) -- 0:00:50
137500 -- (-387.032) (-393.863) (-389.741) [-388.545] * [-389.577] (-386.806) (-390.935) (-387.933) -- 0:00:50
138000 -- (-387.598) [-390.881] (-387.254) (-389.266) * [-389.902] (-389.253) (-389.952) (-389.088) -- 0:00:49
138500 -- (-389.021) (-392.287) [-389.650] (-389.012) * (-389.393) (-388.128) (-387.681) [-389.004] -- 0:00:49
139000 -- [-387.915] (-387.918) (-392.500) (-388.438) * (-389.169) [-386.469] (-389.743) (-388.450) -- 0:00:49
139500 -- (-387.929) (-388.323) [-388.178] (-387.988) * [-388.697] (-387.085) (-387.319) (-387.494) -- 0:00:49
140000 -- (-387.436) [-389.658] (-387.497) (-388.457) * (-397.042) [-388.078] (-386.605) (-387.817) -- 0:00:49
Average standard deviation of split frequencies: 0.020293
140500 -- (-389.033) (-390.445) [-390.374] (-389.819) * (-392.218) (-388.776) (-387.834) [-393.860] -- 0:00:48
141000 -- (-387.577) [-388.345] (-390.515) (-389.158) * (-387.298) (-387.610) [-390.311] (-388.392) -- 0:00:48
141500 -- (-388.527) (-393.789) (-396.155) [-388.512] * (-388.853) (-389.324) [-386.700] (-387.508) -- 0:00:48
142000 -- (-388.920) (-392.213) [-390.862] (-390.072) * (-390.059) [-387.302] (-388.791) (-391.248) -- 0:00:48
142500 -- (-389.166) [-388.306] (-387.245) (-387.507) * (-388.460) (-387.440) (-388.939) [-392.987] -- 0:00:48
143000 -- (-387.912) [-387.266] (-391.229) (-387.654) * (-386.967) [-387.516] (-388.704) (-389.821) -- 0:00:47
143500 -- (-387.778) (-387.371) (-391.514) [-388.638] * [-391.007] (-388.572) (-387.851) (-386.795) -- 0:00:47
144000 -- [-391.024] (-388.714) (-392.357) (-389.867) * (-388.567) (-387.819) [-389.090] (-389.627) -- 0:00:47
144500 -- (-394.147) (-389.099) (-391.379) [-389.777] * [-386.641] (-390.478) (-389.802) (-388.092) -- 0:00:47
145000 -- (-388.400) [-388.592] (-388.551) (-390.049) * (-386.941) (-393.331) (-387.448) [-387.486] -- 0:00:47
Average standard deviation of split frequencies: 0.022279
145500 -- (-389.277) (-387.974) (-392.100) [-386.818] * (-388.543) (-387.627) [-391.571] (-391.251) -- 0:00:46
146000 -- [-389.046] (-391.693) (-392.127) (-387.292) * (-391.574) (-387.365) [-387.356] (-391.324) -- 0:00:46
146500 -- (-390.660) [-387.464] (-388.225) (-391.445) * (-387.092) (-387.847) (-392.053) [-389.392] -- 0:00:46
147000 -- (-387.097) (-389.975) [-388.696] (-389.066) * [-386.759] (-387.893) (-388.685) (-388.120) -- 0:00:46
147500 -- (-389.289) (-387.426) [-389.675] (-390.072) * (-387.289) (-388.323) [-390.813] (-389.191) -- 0:00:52
148000 -- (-388.926) (-388.415) (-389.093) [-393.929] * [-387.683] (-388.248) (-388.812) (-390.447) -- 0:00:51
148500 -- (-387.344) (-387.782) [-388.063] (-386.442) * (-386.713) (-389.339) (-387.494) [-386.720] -- 0:00:51
149000 -- (-388.063) [-388.268] (-391.687) (-388.824) * (-389.637) [-388.117] (-389.112) (-387.980) -- 0:00:51
149500 -- [-387.067] (-393.601) (-390.128) (-388.876) * (-387.848) (-391.560) [-388.956] (-389.390) -- 0:00:51
150000 -- (-387.892) (-390.711) [-387.174] (-390.528) * (-388.988) (-387.120) [-387.588] (-389.946) -- 0:00:51
Average standard deviation of split frequencies: 0.020749
150500 -- (-389.443) (-389.632) (-390.620) [-389.480] * (-388.243) [-386.524] (-390.848) (-387.054) -- 0:00:50
151000 -- [-387.729] (-390.408) (-389.179) (-388.396) * (-388.977) [-387.183] (-388.627) (-393.536) -- 0:00:50
151500 -- (-388.410) (-387.508) (-389.771) [-387.866] * (-389.437) [-386.826] (-387.856) (-388.833) -- 0:00:50
152000 -- (-389.280) (-389.628) [-387.755] (-392.386) * (-389.162) [-387.384] (-387.262) (-387.140) -- 0:00:50
152500 -- (-386.748) (-387.410) (-388.601) [-388.295] * (-388.226) (-387.310) [-387.360] (-388.688) -- 0:00:50
153000 -- (-389.011) (-387.874) (-391.979) [-386.697] * [-387.508] (-393.362) (-389.859) (-388.231) -- 0:00:49
153500 -- (-386.400) (-389.020) [-389.211] (-388.729) * (-398.698) (-387.657) [-397.547] (-390.404) -- 0:00:49
154000 -- (-387.178) (-393.944) [-388.204] (-387.300) * (-388.726) [-387.641] (-389.097) (-388.171) -- 0:00:49
154500 -- [-387.338] (-390.726) (-391.512) (-388.176) * (-386.425) [-386.702] (-387.995) (-386.934) -- 0:00:49
155000 -- (-388.734) [-386.535] (-388.556) (-388.573) * (-386.797) [-388.635] (-393.527) (-388.587) -- 0:00:49
Average standard deviation of split frequencies: 0.020775
155500 -- (-386.595) (-388.981) [-388.239] (-387.387) * (-388.188) [-390.918] (-387.797) (-386.836) -- 0:00:48
156000 -- (-388.817) (-387.872) [-389.317] (-389.419) * (-388.368) (-393.529) [-387.843] (-387.551) -- 0:00:48
156500 -- (-388.032) [-387.686] (-386.995) (-392.470) * (-389.264) (-386.795) (-390.003) [-389.514] -- 0:00:48
157000 -- (-390.301) [-386.433] (-391.089) (-388.933) * [-388.146] (-389.490) (-388.823) (-387.884) -- 0:00:48
157500 -- [-388.982] (-388.667) (-388.935) (-387.302) * [-387.672] (-389.788) (-386.896) (-391.080) -- 0:00:48
158000 -- [-386.459] (-387.065) (-386.968) (-387.654) * (-388.909) (-388.450) [-386.933] (-388.580) -- 0:00:47
158500 -- (-389.400) (-387.443) (-388.047) [-387.039] * (-388.882) (-389.971) [-387.439] (-387.443) -- 0:00:47
159000 -- (-389.127) (-387.474) (-387.681) [-387.475] * (-389.241) [-389.163] (-388.629) (-387.863) -- 0:00:47
159500 -- (-389.860) [-389.186] (-387.602) (-387.025) * [-388.323] (-387.422) (-388.496) (-386.939) -- 0:00:47
160000 -- [-387.016] (-386.794) (-388.631) (-388.434) * [-387.018] (-388.982) (-390.184) (-387.947) -- 0:00:47
Average standard deviation of split frequencies: 0.019675
160500 -- (-387.595) [-388.959] (-389.878) (-389.165) * (-388.540) (-390.505) (-390.068) [-388.772] -- 0:00:47
161000 -- [-390.051] (-386.744) (-387.641) (-390.256) * (-389.625) (-387.473) [-387.670] (-388.948) -- 0:00:46
161500 -- (-391.559) [-387.214] (-386.551) (-387.827) * [-392.734] (-388.999) (-388.695) (-388.318) -- 0:00:46
162000 -- (-387.917) (-389.274) [-389.866] (-387.596) * [-388.696] (-388.548) (-386.634) (-390.527) -- 0:00:46
162500 -- (-392.032) (-389.793) [-388.603] (-390.126) * (-388.175) (-389.294) (-391.537) [-387.705] -- 0:00:46
163000 -- (-387.670) (-386.985) (-387.773) [-390.842] * (-388.417) (-391.705) (-388.528) [-389.809] -- 0:00:46
163500 -- (-389.098) (-390.822) [-388.695] (-388.745) * [-390.138] (-389.080) (-388.176) (-387.338) -- 0:00:46
164000 -- (-389.258) [-387.213] (-389.855) (-392.488) * (-388.981) [-387.110] (-387.065) (-389.396) -- 0:00:45
164500 -- (-387.895) [-387.196] (-390.326) (-397.772) * [-387.263] (-387.187) (-390.514) (-387.528) -- 0:00:50
165000 -- (-388.773) [-388.268] (-393.292) (-393.262) * (-388.572) (-391.040) [-389.313] (-387.354) -- 0:00:50
Average standard deviation of split frequencies: 0.020352
165500 -- (-388.767) (-388.002) (-390.613) [-394.329] * (-387.598) (-388.391) [-387.064] (-391.074) -- 0:00:50
166000 -- (-388.358) [-390.197] (-388.125) (-389.792) * (-388.485) (-388.488) [-388.848] (-389.541) -- 0:00:50
166500 -- (-388.003) [-390.673] (-388.160) (-391.542) * (-386.853) (-387.539) [-386.236] (-388.344) -- 0:00:50
167000 -- (-389.943) (-387.727) (-386.809) [-386.967] * (-387.971) (-387.668) [-386.546] (-388.541) -- 0:00:49
167500 -- (-390.101) (-387.309) [-389.333] (-388.958) * (-388.550) (-387.429) (-388.688) [-387.825] -- 0:00:49
168000 -- (-391.304) (-387.739) (-391.568) [-387.674] * (-388.222) [-392.038] (-387.429) (-388.582) -- 0:00:49
168500 -- (-391.060) (-389.098) [-386.694] (-386.794) * (-386.748) (-391.810) (-387.155) [-387.362] -- 0:00:49
169000 -- (-387.938) (-394.889) (-388.395) [-387.805] * (-388.192) (-388.303) (-389.871) [-387.756] -- 0:00:49
169500 -- (-388.278) (-388.711) [-389.445] (-388.238) * (-386.916) (-387.739) (-390.023) [-386.483] -- 0:00:48
170000 -- (-395.712) (-389.666) (-387.217) [-387.912] * (-388.197) [-387.162] (-387.388) (-388.648) -- 0:00:48
Average standard deviation of split frequencies: 0.019335
170500 -- [-388.101] (-390.710) (-388.321) (-388.169) * (-396.511) (-390.650) [-389.987] (-389.547) -- 0:00:48
171000 -- (-392.215) (-398.060) [-387.643] (-387.769) * [-387.506] (-388.511) (-390.815) (-388.011) -- 0:00:48
171500 -- (-387.930) (-386.615) (-387.240) [-388.295] * (-387.685) (-386.683) (-389.954) [-388.281] -- 0:00:48
172000 -- [-391.541] (-388.322) (-390.307) (-387.986) * (-390.200) [-386.338] (-389.686) (-387.503) -- 0:00:48
172500 -- (-388.720) (-392.900) [-389.483] (-391.624) * (-389.226) (-389.803) (-387.749) [-387.012] -- 0:00:47
173000 -- (-388.642) (-389.095) (-387.517) [-389.157] * [-388.941] (-389.548) (-387.413) (-389.008) -- 0:00:47
173500 -- (-388.173) (-389.278) (-388.702) [-390.548] * (-393.650) (-393.150) [-388.722] (-388.371) -- 0:00:47
174000 -- (-395.017) [-387.188] (-395.028) (-388.074) * [-388.190] (-388.662) (-387.903) (-387.516) -- 0:00:47
174500 -- (-389.874) (-387.128) (-390.784) [-390.227] * (-390.090) (-389.806) (-388.413) [-389.612] -- 0:00:47
175000 -- (-390.520) [-386.368] (-390.293) (-390.155) * [-391.300] (-387.725) (-389.341) (-391.626) -- 0:00:47
Average standard deviation of split frequencies: 0.016386
175500 -- (-392.641) (-388.047) (-390.757) [-388.037] * (-393.480) [-387.501] (-389.112) (-394.464) -- 0:00:46
176000 -- (-386.758) [-387.036] (-389.736) (-388.793) * [-390.162] (-387.160) (-388.226) (-389.234) -- 0:00:46
176500 -- (-387.863) (-387.567) [-391.626] (-388.891) * (-391.795) [-390.067] (-387.900) (-387.825) -- 0:00:46
177000 -- (-387.321) [-388.353] (-386.610) (-388.833) * (-389.235) [-387.764] (-390.593) (-393.441) -- 0:00:46
177500 -- [-391.859] (-390.159) (-387.050) (-386.628) * (-387.626) [-389.382] (-387.131) (-387.677) -- 0:00:46
178000 -- [-388.426] (-389.020) (-390.472) (-388.336) * (-387.640) [-387.112] (-387.155) (-388.325) -- 0:00:46
178500 -- (-389.669) [-390.872] (-389.826) (-386.552) * (-389.594) [-389.551] (-389.508) (-387.552) -- 0:00:46
179000 -- [-387.963] (-393.734) (-387.555) (-386.748) * (-392.522) (-387.254) (-387.011) [-387.250] -- 0:00:45
179500 -- (-388.987) [-386.834] (-386.490) (-387.878) * [-386.540] (-387.547) (-387.161) (-391.471) -- 0:00:45
180000 -- (-391.060) (-388.461) [-387.996] (-390.268) * [-390.079] (-387.299) (-387.606) (-389.551) -- 0:00:45
Average standard deviation of split frequencies: 0.014581
180500 -- (-388.177) [-390.825] (-387.632) (-388.582) * [-386.857] (-386.405) (-388.061) (-387.040) -- 0:00:45
181000 -- (-388.981) (-389.675) [-387.213] (-388.885) * (-389.927) (-390.662) [-386.758] (-389.748) -- 0:00:45
181500 -- (-388.241) (-388.520) [-386.296] (-387.960) * (-392.017) (-389.561) [-387.030] (-387.865) -- 0:00:49
182000 -- (-389.612) (-388.924) [-388.478] (-390.204) * [-386.877] (-389.271) (-389.564) (-389.740) -- 0:00:49
182500 -- [-386.725] (-390.362) (-387.781) (-387.682) * (-386.176) (-387.983) [-386.844] (-386.783) -- 0:00:49
183000 -- (-387.138) (-387.265) (-386.741) [-387.633] * [-386.258] (-386.713) (-387.421) (-387.761) -- 0:00:49
183500 -- (-389.394) (-386.429) (-389.179) [-388.620] * (-391.712) (-388.678) (-387.961) [-387.630] -- 0:00:48
184000 -- (-388.830) [-387.996] (-388.977) (-386.818) * (-386.460) [-388.666] (-388.646) (-388.166) -- 0:00:48
184500 -- (-386.579) (-387.498) (-389.163) [-387.194] * (-390.608) (-390.278) [-388.478] (-387.425) -- 0:00:48
185000 -- [-388.606] (-387.576) (-386.542) (-387.041) * [-389.146] (-391.031) (-386.969) (-389.119) -- 0:00:48
Average standard deviation of split frequencies: 0.014759
185500 -- [-386.678] (-388.789) (-390.402) (-387.893) * [-388.602] (-387.459) (-390.975) (-389.574) -- 0:00:48
186000 -- (-386.820) (-390.159) (-388.734) [-387.789] * (-390.046) (-389.029) [-387.667] (-388.023) -- 0:00:48
186500 -- [-387.693] (-386.403) (-391.604) (-392.506) * [-388.963] (-389.322) (-387.544) (-387.261) -- 0:00:47
187000 -- (-386.194) (-391.258) (-387.472) [-387.143] * (-388.294) [-387.942] (-387.443) (-389.677) -- 0:00:47
187500 -- (-387.256) [-390.056] (-388.056) (-386.476) * [-387.423] (-387.588) (-389.479) (-387.832) -- 0:00:47
188000 -- (-387.627) [-389.777] (-387.137) (-387.444) * (-396.466) (-388.346) (-387.352) [-387.145] -- 0:00:47
188500 -- (-390.945) (-389.154) (-389.055) [-389.010] * (-389.673) (-388.672) (-387.073) [-386.555] -- 0:00:47
189000 -- (-389.034) [-387.649] (-389.334) (-388.074) * [-390.978] (-390.761) (-388.306) (-387.134) -- 0:00:47
189500 -- (-389.513) (-386.662) (-393.429) [-386.843] * (-388.807) [-388.468] (-389.600) (-387.464) -- 0:00:47
190000 -- (-391.313) (-386.930) [-386.564] (-389.521) * (-389.307) (-388.555) (-388.405) [-388.907] -- 0:00:46
Average standard deviation of split frequencies: 0.014980
190500 -- (-388.079) (-388.005) (-389.648) [-387.181] * (-387.230) (-393.810) [-389.723] (-389.501) -- 0:00:46
191000 -- [-387.455] (-389.766) (-387.145) (-388.793) * [-388.931] (-390.186) (-389.532) (-388.071) -- 0:00:46
191500 -- [-388.237] (-394.069) (-393.454) (-391.426) * [-387.172] (-387.331) (-391.722) (-389.636) -- 0:00:46
192000 -- (-388.087) (-387.020) (-389.361) [-388.968] * (-387.178) [-386.511] (-391.798) (-388.369) -- 0:00:46
192500 -- (-390.615) (-392.460) [-387.050] (-386.750) * (-392.832) [-388.917] (-387.730) (-387.811) -- 0:00:46
193000 -- (-391.369) (-390.670) [-396.052] (-388.036) * (-388.525) (-388.439) [-387.979] (-388.949) -- 0:00:45
193500 -- (-389.408) (-389.540) (-390.260) [-388.204] * (-388.364) (-388.111) [-388.167] (-386.840) -- 0:00:45
194000 -- [-387.510] (-388.474) (-387.531) (-390.393) * [-390.953] (-387.350) (-387.407) (-389.248) -- 0:00:45
194500 -- (-391.307) (-390.453) (-391.810) [-387.429] * (-389.854) (-387.665) [-388.341] (-387.817) -- 0:00:45
195000 -- (-387.420) (-389.482) (-390.852) [-388.903] * (-388.011) (-389.316) [-388.628] (-387.986) -- 0:00:45
Average standard deviation of split frequencies: 0.013723
195500 -- (-387.954) [-388.124] (-388.264) (-391.540) * [-388.275] (-398.146) (-387.469) (-386.931) -- 0:00:45
196000 -- (-388.282) [-389.352] (-386.782) (-387.950) * (-387.268) (-390.311) (-388.689) [-391.710] -- 0:00:45
196500 -- [-386.274] (-386.765) (-393.709) (-387.677) * [-386.360] (-386.893) (-389.454) (-390.282) -- 0:00:44
197000 -- [-388.994] (-392.273) (-389.390) (-389.894) * [-392.099] (-387.091) (-392.118) (-390.010) -- 0:00:44
197500 -- [-388.699] (-392.235) (-388.964) (-388.880) * [-388.116] (-388.301) (-387.872) (-389.686) -- 0:00:44
198000 -- (-389.832) [-388.457] (-389.090) (-386.539) * (-387.922) [-388.261] (-387.521) (-387.986) -- 0:00:44
198500 -- (-389.959) (-388.566) [-387.738] (-388.621) * (-388.532) (-389.195) [-386.756] (-387.496) -- 0:00:48
199000 -- (-388.853) (-390.596) (-388.583) [-388.067] * (-388.883) (-388.306) [-388.041] (-390.703) -- 0:00:48
199500 -- (-388.813) (-391.094) (-392.333) [-386.493] * (-388.981) (-389.319) [-391.700] (-388.005) -- 0:00:48
200000 -- (-388.222) (-390.052) [-388.298] (-387.456) * (-388.911) (-387.130) (-387.887) [-386.312] -- 0:00:48
Average standard deviation of split frequencies: 0.016444
200500 -- (-389.156) (-391.084) [-386.677] (-387.329) * [-389.528] (-386.680) (-387.191) (-387.732) -- 0:00:47
201000 -- [-389.655] (-388.753) (-390.827) (-386.394) * [-389.501] (-388.041) (-387.290) (-394.300) -- 0:00:47
201500 -- (-390.801) (-389.060) [-394.566] (-388.159) * (-390.260) (-386.233) [-388.118] (-388.928) -- 0:00:47
202000 -- (-393.736) (-391.177) (-389.843) [-392.663] * [-387.044] (-389.473) (-389.499) (-389.685) -- 0:00:47
202500 -- (-386.564) (-391.308) (-388.818) [-386.860] * (-387.011) (-389.321) [-387.546] (-387.030) -- 0:00:47
203000 -- [-386.825] (-391.364) (-387.409) (-387.970) * (-388.855) [-388.068] (-386.778) (-386.831) -- 0:00:47
203500 -- (-386.853) [-389.978] (-389.966) (-389.083) * (-389.946) [-388.494] (-387.592) (-386.745) -- 0:00:46
204000 -- [-388.915] (-388.405) (-387.629) (-386.230) * (-390.737) (-392.539) (-386.977) [-388.231] -- 0:00:46
204500 -- [-390.058] (-387.269) (-388.707) (-388.762) * (-390.287) [-390.387] (-387.767) (-386.626) -- 0:00:46
205000 -- (-390.080) (-389.419) [-387.962] (-388.327) * (-386.297) [-387.822] (-387.555) (-387.877) -- 0:00:46
Average standard deviation of split frequencies: 0.015346
205500 -- (-388.272) [-390.288] (-389.163) (-388.398) * (-388.945) (-388.419) (-387.843) [-387.257] -- 0:00:46
206000 -- (-391.525) (-386.628) [-388.608] (-388.108) * [-387.742] (-389.520) (-387.365) (-391.472) -- 0:00:46
206500 -- (-386.845) (-387.346) [-386.805] (-388.392) * (-387.269) (-399.510) [-387.519] (-389.219) -- 0:00:46
207000 -- (-387.407) (-388.206) (-386.699) [-388.894] * (-390.259) (-389.762) (-388.643) [-390.356] -- 0:00:45
207500 -- (-389.028) (-389.656) (-387.162) [-386.558] * [-388.215] (-387.114) (-389.707) (-392.616) -- 0:00:45
208000 -- [-389.011] (-389.790) (-387.175) (-388.379) * [-388.376] (-387.187) (-387.467) (-388.142) -- 0:00:45
208500 -- (-387.766) (-387.578) (-387.507) [-388.471] * (-386.952) [-388.361] (-394.470) (-388.697) -- 0:00:45
209000 -- (-386.779) (-388.419) [-386.721] (-387.528) * (-388.512) (-391.042) (-391.317) [-390.203] -- 0:00:45
209500 -- (-387.532) (-390.315) [-387.668] (-386.272) * (-388.480) (-389.559) [-388.103] (-392.981) -- 0:00:45
210000 -- [-388.422] (-387.917) (-386.815) (-391.831) * (-389.925) [-388.388] (-388.603) (-389.786) -- 0:00:45
Average standard deviation of split frequencies: 0.015244
210500 -- (-387.983) (-386.953) [-387.327] (-388.069) * [-391.308] (-387.598) (-387.327) (-389.271) -- 0:00:45
211000 -- (-387.486) [-388.474] (-388.894) (-388.862) * (-390.749) [-388.351] (-388.044) (-386.857) -- 0:00:44
211500 -- (-387.424) (-387.569) (-390.116) [-387.471] * [-394.655] (-386.993) (-387.888) (-389.216) -- 0:00:44
212000 -- (-387.804) (-392.579) (-388.567) [-387.028] * (-388.766) [-388.403] (-387.639) (-387.854) -- 0:00:44
212500 -- (-388.026) [-389.080] (-394.878) (-386.444) * [-388.347] (-386.392) (-388.775) (-387.822) -- 0:00:44
213000 -- (-387.330) (-388.423) (-388.036) [-387.770] * (-390.789) (-388.835) [-386.987] (-388.525) -- 0:00:44
213500 -- (-389.010) (-387.997) [-390.377] (-387.249) * [-386.868] (-386.482) (-387.680) (-387.443) -- 0:00:44
214000 -- (-388.445) (-390.358) (-390.251) [-388.270] * (-386.072) (-386.823) [-387.929] (-388.235) -- 0:00:44
214500 -- (-392.871) (-390.592) [-387.488] (-388.162) * (-388.209) (-387.664) [-388.855] (-389.553) -- 0:00:43
215000 -- (-392.868) (-387.117) (-390.457) [-387.083] * (-388.311) (-387.883) (-388.341) [-387.066] -- 0:00:43
Average standard deviation of split frequencies: 0.015405
215500 -- (-389.035) (-388.070) [-389.044] (-390.673) * (-386.728) [-388.311] (-391.799) (-390.336) -- 0:00:43
216000 -- [-387.732] (-389.720) (-386.936) (-387.173) * (-386.584) (-387.065) (-386.449) [-387.597] -- 0:00:47
216500 -- (-391.951) [-388.403] (-391.035) (-390.167) * (-390.190) (-387.885) (-389.145) [-388.638] -- 0:00:47
217000 -- (-388.651) [-386.631] (-389.803) (-388.799) * (-390.680) [-388.589] (-388.088) (-390.367) -- 0:00:46
217500 -- (-387.661) [-387.533] (-389.868) (-389.186) * (-388.184) (-387.189) (-387.354) [-386.692] -- 0:00:46
218000 -- (-388.025) [-387.620] (-391.097) (-391.747) * (-388.772) (-387.735) [-390.346] (-387.162) -- 0:00:46
218500 -- (-389.970) [-388.191] (-389.762) (-386.800) * (-386.575) (-389.773) (-393.018) [-388.117] -- 0:00:46
219000 -- [-390.239] (-388.792) (-387.828) (-388.161) * (-390.065) (-390.039) (-394.721) [-392.575] -- 0:00:46
219500 -- (-387.642) [-387.404] (-386.732) (-387.699) * (-388.276) (-392.286) [-388.444] (-387.353) -- 0:00:46
220000 -- (-387.454) (-390.322) (-388.406) [-387.906] * [-386.233] (-386.828) (-387.370) (-386.815) -- 0:00:46
Average standard deviation of split frequencies: 0.016211
220500 -- (-388.932) (-393.796) [-392.698] (-387.915) * (-386.439) (-388.028) [-387.649] (-388.897) -- 0:00:45
221000 -- (-392.822) (-389.623) (-393.639) [-388.879] * [-392.332] (-386.959) (-394.384) (-388.905) -- 0:00:45
221500 -- (-389.964) (-386.604) [-387.029] (-387.446) * (-389.025) (-387.553) [-386.071] (-390.433) -- 0:00:45
222000 -- (-387.043) (-386.681) (-388.320) [-387.258] * [-387.858] (-391.501) (-389.186) (-392.882) -- 0:00:45
222500 -- (-387.687) (-387.909) (-387.266) [-387.176] * (-389.721) (-388.555) [-388.858] (-389.465) -- 0:00:45
223000 -- (-387.074) [-387.225] (-390.135) (-387.197) * (-390.102) (-393.248) [-389.322] (-389.449) -- 0:00:45
223500 -- (-387.052) [-387.054] (-389.694) (-387.247) * (-389.448) (-389.097) [-387.849] (-387.145) -- 0:00:45
224000 -- (-393.320) [-388.098] (-388.589) (-387.472) * [-391.796] (-393.012) (-388.842) (-387.820) -- 0:00:45
224500 -- (-387.009) (-388.368) (-390.066) [-387.275] * (-388.470) [-387.128] (-389.456) (-386.555) -- 0:00:44
225000 -- (-390.579) [-388.161] (-388.640) (-387.577) * (-388.448) [-386.378] (-388.792) (-386.521) -- 0:00:44
Average standard deviation of split frequencies: 0.017675
225500 -- (-387.123) (-386.376) (-390.930) [-388.452] * [-388.273] (-386.680) (-390.007) (-387.728) -- 0:00:44
226000 -- (-386.860) [-390.293] (-392.887) (-386.754) * [-395.140] (-387.744) (-387.280) (-388.034) -- 0:00:44
226500 -- [-388.804] (-387.223) (-386.982) (-386.376) * [-390.642] (-386.361) (-390.139) (-391.776) -- 0:00:44
227000 -- (-389.171) [-388.260] (-388.910) (-387.646) * (-388.118) (-387.796) (-389.268) [-388.660] -- 0:00:44
227500 -- [-387.844] (-386.670) (-388.136) (-388.235) * (-389.442) (-386.970) [-387.603] (-388.955) -- 0:00:44
228000 -- (-387.547) [-389.935] (-389.518) (-387.036) * (-387.979) (-388.632) [-387.690] (-387.758) -- 0:00:44
228500 -- (-386.484) (-390.256) (-389.356) [-386.957] * [-386.662] (-388.096) (-390.134) (-387.079) -- 0:00:43
229000 -- (-392.716) (-387.692) [-386.964] (-389.492) * (-389.610) [-390.272] (-394.380) (-386.393) -- 0:00:43
229500 -- (-386.669) (-387.765) [-391.559] (-387.289) * (-387.093) (-387.081) [-386.463] (-387.653) -- 0:00:43
230000 -- (-387.312) (-387.176) (-390.472) [-386.429] * (-387.777) (-388.505) [-387.391] (-387.328) -- 0:00:43
Average standard deviation of split frequencies: 0.015748
230500 -- (-387.823) (-391.056) (-387.707) [-387.369] * (-390.867) (-389.864) (-388.868) [-386.116] -- 0:00:43
231000 -- (-389.440) (-389.281) (-388.502) [-388.196] * [-387.707] (-392.600) (-388.385) (-386.527) -- 0:00:43
231500 -- [-388.802] (-388.045) (-389.892) (-388.551) * (-386.859) [-391.623] (-386.577) (-386.659) -- 0:00:43
232000 -- (-389.635) [-390.149] (-388.325) (-387.019) * (-387.687) (-393.118) [-386.696] (-388.646) -- 0:00:43
232500 -- (-388.163) (-392.490) (-387.020) [-391.704] * (-388.301) (-389.019) [-387.592] (-386.813) -- 0:00:42
233000 -- (-389.981) (-388.916) (-386.829) [-387.940] * (-390.280) (-389.045) (-392.035) [-388.186] -- 0:00:46
233500 -- (-388.785) (-388.327) [-395.117] (-388.277) * (-387.321) [-388.515] (-387.814) (-391.826) -- 0:00:45
234000 -- (-392.760) (-388.726) (-387.558) [-387.262] * (-390.353) (-388.829) [-387.000] (-391.092) -- 0:00:45
234500 -- (-389.452) [-386.327] (-387.456) (-388.457) * [-389.998] (-389.367) (-388.527) (-390.231) -- 0:00:45
235000 -- (-387.103) (-391.668) [-386.404] (-387.927) * (-389.481) [-387.459] (-389.971) (-388.996) -- 0:00:45
Average standard deviation of split frequencies: 0.015627
235500 -- [-389.140] (-386.911) (-386.559) (-388.226) * (-389.003) (-387.372) (-387.819) [-387.589] -- 0:00:45
236000 -- (-390.951) (-390.087) (-390.977) [-387.180] * (-391.778) [-386.528] (-387.612) (-388.735) -- 0:00:45
236500 -- (-389.956) (-387.444) (-386.524) [-389.780] * (-389.215) (-388.104) [-389.142] (-387.892) -- 0:00:45
237000 -- (-388.152) (-387.646) [-390.961] (-390.695) * (-388.779) (-394.516) [-388.425] (-391.537) -- 0:00:45
237500 -- (-386.765) [-388.545] (-388.829) (-387.938) * (-390.881) (-394.105) (-389.010) [-390.838] -- 0:00:44
238000 -- [-391.039] (-388.430) (-391.039) (-386.883) * [-392.055] (-387.401) (-387.381) (-389.575) -- 0:00:44
238500 -- (-387.176) [-388.973] (-388.196) (-388.544) * [-394.018] (-389.065) (-387.380) (-387.811) -- 0:00:44
239000 -- (-386.399) (-390.715) (-389.820) [-389.099] * (-387.270) (-388.641) (-391.313) [-389.322] -- 0:00:44
239500 -- [-386.298] (-391.828) (-386.319) (-387.456) * (-386.343) [-386.576] (-386.931) (-389.696) -- 0:00:44
240000 -- (-388.284) [-387.762] (-389.387) (-389.850) * [-387.514] (-387.159) (-386.843) (-387.225) -- 0:00:44
Average standard deviation of split frequencies: 0.016131
240500 -- (-396.311) [-392.592] (-387.611) (-387.899) * (-387.968) (-388.932) (-386.328) [-387.123] -- 0:00:44
241000 -- (-390.631) [-389.476] (-393.637) (-387.428) * (-390.727) (-386.531) [-386.073] (-389.400) -- 0:00:44
241500 -- (-388.306) (-393.742) [-387.333] (-386.753) * (-386.328) (-392.550) (-386.911) [-386.609] -- 0:00:43
242000 -- (-387.589) (-387.538) [-386.555] (-390.675) * (-387.251) [-388.818] (-386.297) (-386.578) -- 0:00:43
242500 -- [-389.302] (-392.446) (-388.834) (-388.898) * [-386.756] (-394.645) (-391.858) (-387.242) -- 0:00:43
243000 -- [-389.222] (-389.374) (-392.934) (-387.579) * [-386.725] (-390.914) (-387.656) (-387.841) -- 0:00:43
243500 -- [-390.200] (-389.360) (-387.518) (-389.592) * (-388.682) [-390.195] (-389.663) (-387.553) -- 0:00:43
244000 -- (-389.704) [-388.471] (-388.909) (-387.960) * (-386.834) (-390.530) [-386.412] (-387.403) -- 0:00:43
244500 -- (-386.989) [-390.828] (-388.861) (-389.334) * (-392.266) (-389.596) (-387.650) [-387.495] -- 0:00:43
245000 -- [-388.237] (-389.519) (-388.221) (-387.670) * (-390.392) [-387.810] (-387.719) (-388.605) -- 0:00:43
Average standard deviation of split frequencies: 0.017021
245500 -- (-388.660) (-387.336) (-392.353) [-389.416] * [-390.253] (-387.175) (-389.901) (-387.627) -- 0:00:43
246000 -- (-389.149) [-388.403] (-390.432) (-387.882) * (-388.406) [-387.087] (-387.979) (-389.645) -- 0:00:42
246500 -- [-388.973] (-387.954) (-386.703) (-388.229) * [-388.502] (-387.925) (-389.975) (-388.769) -- 0:00:42
247000 -- (-387.193) (-390.085) (-387.539) [-389.129] * (-387.367) (-387.014) (-390.081) [-389.157] -- 0:00:42
247500 -- (-388.403) (-389.508) (-387.542) [-388.174] * (-386.666) (-387.301) (-388.031) [-391.629] -- 0:00:42
248000 -- (-387.553) (-388.166) (-390.840) [-388.184] * (-388.059) (-388.662) [-387.774] (-391.132) -- 0:00:42
248500 -- (-388.317) [-387.600] (-388.467) (-389.518) * (-386.414) (-387.647) [-386.820] (-389.489) -- 0:00:42
249000 -- [-386.967] (-388.784) (-389.285) (-387.878) * (-386.584) (-387.421) [-390.509] (-389.691) -- 0:00:42
249500 -- (-388.021) (-387.239) [-387.576] (-388.940) * (-386.897) [-390.708] (-388.234) (-389.038) -- 0:00:42
250000 -- (-388.772) (-387.319) [-388.675] (-387.002) * (-392.792) (-389.165) [-388.769] (-393.130) -- 0:00:45
Average standard deviation of split frequencies: 0.017257
250500 -- [-387.400] (-387.977) (-389.305) (-387.498) * [-387.744] (-388.937) (-387.517) (-387.322) -- 0:00:44
251000 -- (-387.092) (-390.001) [-388.868] (-386.296) * (-386.886) [-391.267] (-386.444) (-386.785) -- 0:00:44
251500 -- (-387.395) [-387.162] (-389.110) (-388.431) * (-388.071) [-390.320] (-387.424) (-390.276) -- 0:00:44
252000 -- [-387.411] (-386.311) (-388.143) (-387.209) * [-387.162] (-393.114) (-392.824) (-388.607) -- 0:00:44
252500 -- (-390.275) (-388.691) (-388.794) [-391.858] * (-390.461) (-390.838) (-392.649) [-389.730] -- 0:00:44
253000 -- (-388.310) (-387.944) [-387.718] (-387.463) * (-391.117) (-389.035) [-391.253] (-388.640) -- 0:00:44
253500 -- (-387.500) (-388.467) [-388.473] (-389.024) * (-389.263) (-391.240) [-388.655] (-388.491) -- 0:00:44
254000 -- [-388.593] (-392.441) (-387.483) (-390.553) * (-387.308) (-389.947) [-388.786] (-391.983) -- 0:00:44
254500 -- (-389.044) (-388.530) [-388.132] (-391.335) * [-387.711] (-392.406) (-388.312) (-393.319) -- 0:00:43
255000 -- [-387.370] (-388.184) (-393.223) (-390.737) * (-389.404) (-388.292) [-389.047] (-390.484) -- 0:00:43
Average standard deviation of split frequencies: 0.018848
255500 -- [-388.643] (-390.245) (-392.994) (-387.322) * [-388.370] (-387.664) (-390.796) (-394.857) -- 0:00:43
256000 -- [-386.198] (-389.996) (-391.723) (-387.752) * [-386.919] (-388.501) (-388.165) (-391.763) -- 0:00:43
256500 -- (-389.244) (-387.332) (-389.711) [-386.493] * (-387.898) [-389.426] (-389.419) (-389.476) -- 0:00:43
257000 -- (-388.273) (-387.746) (-390.291) [-386.474] * (-391.490) (-389.391) (-387.128) [-387.522] -- 0:00:43
257500 -- [-386.877] (-392.746) (-389.145) (-389.800) * (-388.934) [-389.558] (-389.358) (-387.532) -- 0:00:43
258000 -- (-387.808) (-387.456) (-393.121) [-388.939] * (-389.685) [-389.907] (-389.172) (-389.704) -- 0:00:43
258500 -- [-389.457] (-391.767) (-388.892) (-388.764) * (-392.048) (-388.691) [-393.403] (-388.025) -- 0:00:43
259000 -- [-386.392] (-390.678) (-392.815) (-387.850) * [-387.892] (-388.272) (-389.630) (-389.197) -- 0:00:42
259500 -- (-387.957) (-387.653) [-393.019] (-387.227) * (-386.777) [-387.930] (-387.200) (-387.917) -- 0:00:42
260000 -- (-386.447) (-395.122) (-393.789) [-388.520] * (-386.297) [-388.964] (-390.217) (-389.550) -- 0:00:42
Average standard deviation of split frequencies: 0.018687
260500 -- (-387.074) (-387.516) (-389.275) [-391.787] * (-388.568) (-387.140) (-387.516) [-388.511] -- 0:00:42
261000 -- [-387.487] (-390.644) (-398.948) (-389.009) * (-389.173) (-386.609) (-388.389) [-388.327] -- 0:00:42
261500 -- [-387.321] (-386.399) (-387.765) (-389.007) * (-387.587) [-390.057] (-389.431) (-389.857) -- 0:00:42
262000 -- [-388.695] (-386.716) (-390.247) (-390.313) * (-387.867) [-386.525] (-386.341) (-387.364) -- 0:00:42
262500 -- [-387.015] (-388.130) (-389.556) (-387.508) * (-389.055) (-387.909) [-390.512] (-389.211) -- 0:00:42
263000 -- (-389.082) [-388.185] (-387.168) (-389.178) * [-387.938] (-391.991) (-395.103) (-390.796) -- 0:00:42
263500 -- (-391.906) (-387.143) (-392.175) [-388.405] * (-390.159) (-387.212) [-388.584] (-387.360) -- 0:00:41
264000 -- (-389.913) (-386.627) (-386.961) [-391.390] * (-387.874) (-389.603) [-388.873] (-390.771) -- 0:00:41
264500 -- [-386.857] (-388.206) (-389.367) (-390.162) * (-388.697) [-390.356] (-387.454) (-388.710) -- 0:00:41
265000 -- (-387.201) [-386.683] (-390.066) (-386.476) * (-388.683) (-387.348) (-387.540) [-387.462] -- 0:00:41
Average standard deviation of split frequencies: 0.016836
265500 -- [-388.639] (-387.001) (-391.108) (-389.021) * (-386.476) (-387.640) (-387.073) [-389.329] -- 0:00:41
266000 -- (-387.793) [-388.229] (-391.808) (-389.588) * (-387.359) (-387.906) (-387.054) [-389.756] -- 0:00:41
266500 -- (-387.524) (-386.608) (-390.036) [-387.030] * (-386.206) (-388.264) (-387.897) [-389.277] -- 0:00:41
267000 -- (-388.297) (-387.533) [-389.534] (-389.221) * (-386.643) (-390.634) [-387.326] (-389.396) -- 0:00:43
267500 -- (-386.915) [-388.486] (-389.412) (-387.352) * (-388.755) (-388.753) (-387.070) [-388.533] -- 0:00:43
268000 -- (-387.750) (-388.189) (-390.088) [-387.059] * [-387.922] (-388.992) (-386.635) (-388.742) -- 0:00:43
268500 -- (-386.894) (-392.352) (-386.604) [-387.654] * (-387.839) (-387.630) (-389.947) [-387.439] -- 0:00:43
269000 -- (-387.304) (-389.075) (-387.626) [-387.803] * (-387.204) (-387.048) [-388.055] (-388.731) -- 0:00:43
269500 -- (-389.685) (-386.493) (-388.026) [-388.666] * (-387.325) (-386.805) (-391.606) [-388.453] -- 0:00:43
270000 -- (-390.505) [-386.180] (-391.925) (-388.678) * [-388.728] (-390.000) (-389.880) (-388.459) -- 0:00:43
Average standard deviation of split frequencies: 0.016255
270500 -- (-392.863) [-387.238] (-391.199) (-387.209) * [-388.137] (-388.518) (-386.943) (-389.692) -- 0:00:43
271000 -- (-389.418) (-389.078) (-391.596) [-387.294] * (-388.080) (-390.592) (-390.190) [-390.488] -- 0:00:43
271500 -- (-388.852) [-389.017] (-388.684) (-387.205) * (-388.048) (-389.859) (-387.098) [-388.078] -- 0:00:42
272000 -- (-389.573) (-391.467) [-387.383] (-386.311) * (-390.096) (-388.346) (-386.211) [-391.741] -- 0:00:42
272500 -- [-387.632] (-389.769) (-387.763) (-388.658) * (-388.822) [-387.921] (-387.043) (-388.146) -- 0:00:42
273000 -- [-387.364] (-388.512) (-387.921) (-386.148) * [-390.746] (-389.959) (-386.268) (-390.031) -- 0:00:42
273500 -- [-390.379] (-390.021) (-387.680) (-390.355) * (-389.458) [-390.317] (-387.147) (-387.167) -- 0:00:42
274000 -- (-389.671) (-388.977) (-387.596) [-389.453] * (-387.675) (-391.712) (-387.025) [-387.135] -- 0:00:42
274500 -- [-388.997] (-391.537) (-387.907) (-387.371) * (-387.012) (-391.545) (-387.124) [-391.750] -- 0:00:42
275000 -- [-388.730] (-388.837) (-392.154) (-389.455) * (-389.695) [-388.515] (-387.684) (-389.212) -- 0:00:42
Average standard deviation of split frequencies: 0.016036
275500 -- (-388.158) (-387.546) [-387.355] (-388.786) * (-391.038) [-389.182] (-389.624) (-387.202) -- 0:00:42
276000 -- (-389.081) [-387.916] (-387.611) (-388.939) * (-387.155) (-390.814) [-387.405] (-388.660) -- 0:00:41
276500 -- (-386.602) (-390.016) [-389.176] (-387.273) * [-388.945] (-387.294) (-391.195) (-390.602) -- 0:00:41
277000 -- (-386.946) [-387.288] (-386.992) (-389.038) * (-387.269) (-387.850) [-388.131] (-387.766) -- 0:00:41
277500 -- [-389.206] (-388.026) (-387.053) (-387.273) * (-389.583) (-388.150) (-389.295) [-389.927] -- 0:00:41
278000 -- [-388.624] (-390.049) (-386.309) (-392.768) * (-389.044) (-391.620) (-387.792) [-387.248] -- 0:00:41
278500 -- (-388.556) (-389.922) (-390.092) [-389.612] * (-389.411) (-391.474) [-388.279] (-389.228) -- 0:00:41
279000 -- (-388.459) (-389.434) (-391.622) [-387.896] * [-390.057] (-387.304) (-386.073) (-388.265) -- 0:00:41
279500 -- (-387.757) [-388.656] (-389.573) (-387.163) * (-387.284) [-388.602] (-389.062) (-388.316) -- 0:00:41
280000 -- (-388.472) (-395.445) [-387.207] (-387.316) * [-389.635] (-390.300) (-387.887) (-387.046) -- 0:00:41
Average standard deviation of split frequencies: 0.016089
280500 -- [-388.759] (-389.315) (-388.813) (-388.185) * (-394.251) [-388.001] (-388.576) (-386.333) -- 0:00:41
281000 -- (-393.018) (-387.688) (-387.094) [-387.964] * (-389.155) [-387.270] (-388.570) (-386.810) -- 0:00:40
281500 -- (-387.228) (-386.658) (-390.701) [-390.159] * (-387.192) (-389.405) [-387.754] (-386.842) -- 0:00:40
282000 -- (-386.757) [-388.420] (-394.359) (-386.903) * (-388.591) [-389.392] (-390.083) (-389.959) -- 0:00:40
282500 -- (-387.232) [-390.039] (-390.793) (-387.351) * (-387.408) [-391.284] (-389.308) (-390.169) -- 0:00:40
283000 -- (-387.354) (-386.893) [-388.692] (-387.363) * [-388.514] (-394.618) (-393.325) (-390.248) -- 0:00:40
283500 -- (-389.122) (-390.736) (-387.283) [-388.809] * (-389.323) (-386.581) [-386.853] (-390.725) -- 0:00:40
284000 -- (-386.380) [-390.745] (-386.817) (-389.198) * [-388.828] (-387.039) (-387.861) (-393.260) -- 0:00:42
284500 -- (-387.020) [-388.656] (-386.950) (-388.111) * (-389.704) (-386.775) (-389.982) [-391.315] -- 0:00:42
285000 -- (-389.852) [-390.446] (-388.543) (-389.414) * (-387.655) (-390.057) [-387.566] (-391.169) -- 0:00:42
Average standard deviation of split frequencies: 0.015823
285500 -- (-386.442) (-392.748) [-387.595] (-388.673) * [-387.219] (-389.551) (-389.767) (-386.547) -- 0:00:42
286000 -- [-389.124] (-386.489) (-392.378) (-388.656) * [-388.591] (-388.251) (-388.198) (-391.773) -- 0:00:42
286500 -- (-387.154) (-388.144) [-387.740] (-388.420) * (-391.295) [-386.709] (-390.493) (-393.399) -- 0:00:42
287000 -- [-389.022] (-392.991) (-388.027) (-386.258) * (-387.123) (-387.072) [-387.397] (-389.060) -- 0:00:42
287500 -- [-389.101] (-394.121) (-390.429) (-386.898) * (-388.847) (-387.606) [-391.769] (-388.513) -- 0:00:42
288000 -- (-387.186) (-394.013) (-394.305) [-387.910] * (-388.335) [-389.338] (-390.350) (-387.440) -- 0:00:42
288500 -- (-391.359) (-393.848) (-388.769) [-389.093] * (-387.167) (-390.940) [-386.271] (-391.659) -- 0:00:41
289000 -- (-389.732) (-391.251) [-389.370] (-390.787) * (-387.346) [-388.687] (-388.135) (-388.666) -- 0:00:41
289500 -- (-390.064) (-389.161) (-391.525) [-387.786] * [-387.502] (-387.227) (-388.086) (-387.796) -- 0:00:41
290000 -- (-387.345) (-387.912) (-390.135) [-387.597] * [-389.420] (-390.538) (-389.109) (-387.659) -- 0:00:41
Average standard deviation of split frequencies: 0.015364
290500 -- [-386.854] (-386.535) (-387.627) (-392.861) * (-388.919) (-388.362) (-389.302) [-391.460] -- 0:00:41
291000 -- (-388.560) [-388.301] (-387.797) (-389.821) * [-389.786] (-388.976) (-389.610) (-393.766) -- 0:00:41
291500 -- (-391.485) (-387.709) (-391.722) [-388.616] * (-386.273) (-388.962) [-387.230] (-388.917) -- 0:00:41
292000 -- (-391.529) (-386.810) [-392.007] (-388.260) * (-390.031) (-393.945) (-389.258) [-387.121] -- 0:00:41
292500 -- (-390.157) (-386.845) [-388.855] (-388.541) * (-390.289) (-390.666) (-388.690) [-388.759] -- 0:00:41
293000 -- (-388.294) (-389.455) (-389.665) [-389.408] * (-387.488) (-389.097) (-387.081) [-387.182] -- 0:00:41
293500 -- [-387.532] (-389.564) (-387.318) (-389.353) * (-390.136) [-386.250] (-389.137) (-386.269) -- 0:00:40
294000 -- [-387.044] (-391.018) (-388.593) (-388.427) * (-387.863) [-389.223] (-389.344) (-386.260) -- 0:00:40
294500 -- (-387.633) (-388.804) [-389.190] (-388.229) * (-388.574) (-389.689) (-389.556) [-388.001] -- 0:00:40
295000 -- [-391.232] (-391.347) (-385.993) (-388.515) * (-388.665) (-389.723) (-386.938) [-386.489] -- 0:00:40
Average standard deviation of split frequencies: 0.015130
295500 -- (-390.866) [-389.792] (-387.632) (-388.402) * [-390.121] (-389.317) (-389.587) (-392.096) -- 0:00:40
296000 -- (-387.629) [-388.200] (-387.351) (-390.887) * (-388.316) (-390.889) (-387.668) [-388.434] -- 0:00:40
296500 -- [-389.109] (-391.638) (-388.087) (-387.055) * (-388.144) (-392.887) (-391.924) [-387.911] -- 0:00:40
297000 -- (-390.418) (-391.021) [-388.414] (-393.647) * (-392.441) (-389.228) (-389.236) [-389.878] -- 0:00:40
297500 -- (-386.727) (-388.843) (-387.310) [-388.830] * (-390.818) [-386.742] (-389.973) (-390.512) -- 0:00:40
298000 -- (-389.347) [-387.009] (-388.901) (-389.262) * (-387.780) (-387.019) (-390.128) [-387.976] -- 0:00:40
298500 -- (-388.352) [-386.706] (-388.696) (-390.714) * (-389.606) (-389.385) (-388.588) [-390.096] -- 0:00:39
299000 -- (-389.762) (-388.680) [-388.856] (-390.086) * (-386.896) (-389.112) [-386.812] (-388.193) -- 0:00:39
299500 -- (-387.595) [-391.065] (-389.701) (-388.864) * [-388.289] (-390.007) (-387.495) (-386.104) -- 0:00:39
300000 -- (-386.842) (-391.236) (-389.213) [-389.084] * (-389.198) (-387.943) (-388.896) [-387.618] -- 0:00:39
Average standard deviation of split frequencies: 0.015349
300500 -- (-390.078) (-387.115) [-387.411] (-391.008) * (-386.830) [-389.723] (-392.374) (-386.893) -- 0:00:39
301000 -- (-387.667) (-390.667) (-389.128) [-388.615] * (-390.387) [-388.767] (-388.444) (-389.344) -- 0:00:41
301500 -- (-388.594) (-389.376) [-387.038] (-386.794) * [-390.820] (-389.491) (-387.774) (-387.920) -- 0:00:41
302000 -- (-387.538) (-388.939) (-386.980) [-386.625] * (-386.487) [-391.437] (-389.935) (-388.662) -- 0:00:41
302500 -- (-393.519) (-387.693) [-389.160] (-387.852) * (-388.233) [-389.056] (-388.417) (-389.987) -- 0:00:41
303000 -- (-387.623) (-387.678) [-387.677] (-387.156) * [-386.143] (-391.393) (-387.948) (-391.694) -- 0:00:41
303500 -- (-387.440) (-390.159) [-387.306] (-388.135) * (-388.674) (-386.975) (-389.784) [-389.844] -- 0:00:41
304000 -- (-390.545) (-387.601) (-390.663) [-388.050] * [-388.225] (-388.703) (-386.349) (-388.929) -- 0:00:41
304500 -- (-388.621) (-387.816) [-388.860] (-389.309) * (-388.139) [-386.776] (-386.992) (-388.439) -- 0:00:41
305000 -- (-389.785) [-391.239] (-387.750) (-391.504) * (-389.004) [-387.387] (-388.508) (-389.183) -- 0:00:41
Average standard deviation of split frequencies: 0.015973
305500 -- [-387.934] (-388.954) (-387.701) (-388.712) * (-386.874) [-389.264] (-387.603) (-389.174) -- 0:00:40
306000 -- (-387.663) (-388.038) (-388.698) [-386.935] * (-390.177) (-392.439) [-391.748] (-387.510) -- 0:00:40
306500 -- (-388.847) [-388.180] (-386.757) (-387.335) * (-390.274) (-388.078) [-387.498] (-389.889) -- 0:00:40
307000 -- (-390.001) [-392.485] (-392.205) (-387.307) * [-386.600] (-388.603) (-393.696) (-393.186) -- 0:00:40
307500 -- [-389.367] (-390.305) (-387.883) (-387.199) * [-389.367] (-389.492) (-390.924) (-387.925) -- 0:00:40
308000 -- (-390.450) [-391.642] (-388.643) (-390.589) * (-388.940) (-388.142) (-386.624) [-387.217] -- 0:00:40
308500 -- (-392.099) (-387.592) (-390.110) [-393.286] * (-387.224) [-386.289] (-387.612) (-388.866) -- 0:00:40
309000 -- (-390.236) (-387.515) (-388.653) [-387.618] * [-391.334] (-387.075) (-386.456) (-387.605) -- 0:00:40
309500 -- (-389.409) [-389.214] (-387.156) (-392.544) * (-387.008) [-390.265] (-391.560) (-390.251) -- 0:00:40
310000 -- (-388.100) [-390.535] (-387.673) (-391.605) * (-386.361) [-388.395] (-394.825) (-389.886) -- 0:00:40
Average standard deviation of split frequencies: 0.015573
310500 -- (-387.695) [-394.987] (-386.785) (-390.509) * (-391.519) [-387.978] (-386.603) (-388.784) -- 0:00:39
311000 -- (-386.471) [-390.897] (-393.813) (-388.232) * (-391.789) (-388.415) [-386.889] (-386.626) -- 0:00:39
311500 -- (-389.191) [-387.305] (-393.523) (-388.625) * (-387.968) (-389.635) (-386.831) [-387.054] -- 0:00:39
312000 -- (-390.773) (-387.572) (-389.410) [-386.790] * (-389.429) (-389.428) [-387.643] (-388.133) -- 0:00:39
312500 -- [-386.328] (-389.881) (-388.416) (-389.792) * (-388.770) (-386.904) [-387.397] (-390.088) -- 0:00:39
313000 -- (-397.117) [-391.110] (-387.815) (-387.695) * [-387.905] (-387.623) (-387.375) (-394.714) -- 0:00:39
313500 -- (-387.493) [-387.828] (-386.933) (-387.794) * [-387.187] (-390.052) (-386.436) (-387.165) -- 0:00:39
314000 -- (-391.257) (-389.647) (-387.619) [-387.558] * (-387.767) (-389.146) [-389.716] (-388.001) -- 0:00:39
314500 -- (-390.468) [-391.170] (-388.999) (-387.221) * [-389.240] (-386.947) (-391.373) (-387.232) -- 0:00:39
315000 -- (-387.009) [-388.815] (-389.849) (-387.462) * [-388.660] (-388.037) (-393.155) (-386.661) -- 0:00:39
Average standard deviation of split frequencies: 0.015664
315500 -- (-387.983) [-388.840] (-388.353) (-386.197) * (-386.153) (-386.993) [-388.895] (-389.839) -- 0:00:39
316000 -- [-388.501] (-389.192) (-392.591) (-387.724) * [-387.667] (-391.427) (-389.308) (-388.509) -- 0:00:38
316500 -- (-392.246) (-390.417) [-391.899] (-387.332) * (-388.625) (-392.643) (-387.431) [-386.864] -- 0:00:38
317000 -- (-393.944) (-386.996) (-387.198) [-388.282] * (-388.882) [-388.466] (-388.173) (-388.918) -- 0:00:38
317500 -- (-390.004) [-387.273] (-386.984) (-386.996) * [-393.580] (-393.971) (-388.441) (-388.865) -- 0:00:38
318000 -- (-387.703) (-386.439) (-390.770) [-386.783] * [-391.418] (-386.281) (-392.171) (-387.366) -- 0:00:38
318500 -- (-387.269) (-387.860) (-391.439) [-391.615] * (-387.093) (-389.252) (-391.040) [-389.316] -- 0:00:40
319000 -- (-386.752) (-389.004) [-388.338] (-388.229) * (-387.309) [-387.514] (-386.857) (-388.793) -- 0:00:40
319500 -- (-387.749) [-388.050] (-390.091) (-391.148) * (-388.129) (-390.049) [-388.518] (-390.349) -- 0:00:40
320000 -- (-391.726) [-389.218] (-390.838) (-387.503) * (-392.352) (-388.379) [-387.996] (-387.213) -- 0:00:40
Average standard deviation of split frequencies: 0.014864
320500 -- [-388.645] (-388.796) (-394.069) (-387.022) * (-389.526) (-388.575) [-387.413] (-386.394) -- 0:00:40
321000 -- (-390.418) (-392.196) [-386.979] (-387.407) * (-392.459) (-390.237) (-387.668) [-387.011] -- 0:00:40
321500 -- (-386.581) (-397.119) (-387.989) [-387.935] * (-387.561) (-387.061) [-390.576] (-386.922) -- 0:00:40
322000 -- (-388.367) (-389.202) [-389.203] (-388.492) * (-390.109) (-387.775) (-389.794) [-389.074] -- 0:00:40
322500 -- (-387.644) (-391.069) [-387.462] (-389.128) * [-389.988] (-388.147) (-389.385) (-389.164) -- 0:00:39
323000 -- (-390.116) (-391.441) (-386.672) [-387.464] * (-390.516) (-389.563) [-386.818] (-390.597) -- 0:00:39
323500 -- [-390.528] (-390.518) (-386.609) (-391.637) * (-391.618) [-386.422] (-386.759) (-389.135) -- 0:00:39
324000 -- (-387.569) (-387.367) [-387.181] (-386.844) * [-387.197] (-386.414) (-387.480) (-389.423) -- 0:00:39
324500 -- [-389.046] (-386.939) (-388.142) (-386.248) * (-388.472) (-389.256) (-388.015) [-390.877] -- 0:00:39
325000 -- (-390.718) (-389.618) [-387.157] (-389.817) * (-390.881) (-388.078) [-388.553] (-388.948) -- 0:00:39
Average standard deviation of split frequencies: 0.015424
325500 -- (-389.065) (-389.523) [-387.360] (-388.699) * (-386.910) (-386.899) (-386.196) [-388.846] -- 0:00:39
326000 -- [-388.174] (-387.240) (-387.325) (-392.312) * (-389.943) [-390.363] (-390.564) (-388.656) -- 0:00:39
326500 -- (-389.282) [-388.204] (-386.971) (-392.011) * (-388.382) [-391.058] (-389.086) (-388.487) -- 0:00:39
327000 -- (-393.569) (-386.716) (-388.460) [-388.036] * (-387.814) (-389.666) (-388.668) [-386.196] -- 0:00:39
327500 -- [-389.786] (-387.106) (-388.610) (-392.906) * [-386.768] (-391.545) (-390.042) (-387.648) -- 0:00:39
328000 -- (-389.510) (-386.900) [-389.786] (-390.315) * (-387.761) (-392.458) (-389.688) [-392.367] -- 0:00:38
328500 -- [-389.153] (-391.205) (-387.078) (-388.141) * (-393.243) (-387.596) [-386.817] (-387.125) -- 0:00:38
329000 -- (-387.995) (-390.981) [-388.405] (-393.246) * (-390.626) (-391.183) (-386.654) [-387.777] -- 0:00:38
329500 -- (-388.082) [-389.511] (-391.698) (-388.470) * (-391.303) [-390.745] (-386.922) (-388.339) -- 0:00:38
330000 -- (-397.527) (-393.022) [-390.203] (-389.462) * [-386.878] (-392.693) (-392.165) (-388.320) -- 0:00:38
Average standard deviation of split frequencies: 0.014969
330500 -- [-387.503] (-388.159) (-390.307) (-391.018) * (-387.430) [-389.577] (-388.869) (-388.052) -- 0:00:38
331000 -- (-386.530) (-386.695) [-390.200] (-387.955) * (-390.550) (-390.509) (-392.754) [-388.595] -- 0:00:38
331500 -- (-390.950) (-386.230) [-388.692] (-390.793) * (-390.351) (-389.809) [-389.785] (-387.106) -- 0:00:38
332000 -- (-387.358) (-389.945) [-387.231] (-386.615) * (-387.353) (-387.708) [-386.728] (-390.273) -- 0:00:38
332500 -- (-389.113) (-387.889) [-387.890] (-386.601) * [-386.823] (-389.335) (-386.887) (-387.408) -- 0:00:38
333000 -- [-389.067] (-389.097) (-391.144) (-386.251) * (-387.562) [-387.221] (-388.835) (-391.625) -- 0:00:38
333500 -- [-388.960] (-386.926) (-388.398) (-387.448) * (-389.386) [-388.226] (-389.759) (-388.553) -- 0:00:37
334000 -- (-387.998) (-387.812) (-388.603) [-390.406] * (-386.557) (-390.250) [-388.037] (-388.124) -- 0:00:37
334500 -- (-388.868) (-388.689) (-389.340) [-389.051] * (-388.321) [-387.204] (-389.662) (-387.106) -- 0:00:37
335000 -- (-388.654) [-390.483] (-389.669) (-387.687) * (-390.438) (-387.029) [-387.446] (-389.724) -- 0:00:39
Average standard deviation of split frequencies: 0.014731
335500 -- [-386.482] (-388.995) (-387.508) (-390.167) * (-388.384) [-390.124] (-388.678) (-391.053) -- 0:00:39
336000 -- (-387.947) (-392.378) [-390.157] (-388.459) * (-389.919) (-387.245) [-391.000] (-390.131) -- 0:00:39
336500 -- (-387.299) (-391.815) [-386.210] (-389.714) * (-388.008) (-390.430) (-387.455) [-387.662] -- 0:00:39
337000 -- [-388.219] (-390.525) (-386.988) (-387.170) * [-388.200] (-386.638) (-387.865) (-387.711) -- 0:00:39
337500 -- (-389.279) [-388.337] (-387.159) (-391.686) * (-389.016) [-386.993] (-386.770) (-387.410) -- 0:00:39
338000 -- (-388.272) (-386.845) [-387.007] (-388.059) * (-388.220) (-386.282) (-389.247) [-387.772] -- 0:00:39
338500 -- [-388.375] (-388.080) (-387.176) (-387.194) * (-388.310) [-388.567] (-389.784) (-389.642) -- 0:00:39
339000 -- (-388.455) (-390.610) (-388.762) [-388.481] * (-390.729) (-388.116) [-387.863] (-387.039) -- 0:00:38
339500 -- (-388.984) (-387.592) [-386.574] (-389.409) * (-387.711) (-396.329) [-388.561] (-387.603) -- 0:00:38
340000 -- [-392.316] (-386.587) (-390.826) (-390.086) * (-386.499) (-389.114) (-387.891) [-386.966] -- 0:00:38
Average standard deviation of split frequencies: 0.015529
340500 -- (-387.258) (-386.613) (-389.378) [-389.178] * [-387.123] (-389.981) (-386.944) (-388.828) -- 0:00:38
341000 -- (-387.359) (-386.571) [-387.348] (-399.202) * (-390.858) [-389.543] (-388.678) (-389.423) -- 0:00:38
341500 -- [-390.687] (-388.550) (-388.983) (-387.325) * (-386.688) [-390.051] (-388.191) (-391.484) -- 0:00:38
342000 -- (-391.852) (-386.899) (-389.902) [-388.157] * (-394.195) [-387.891] (-390.660) (-387.165) -- 0:00:38
342500 -- (-391.184) (-387.907) [-387.358] (-387.437) * (-388.621) [-388.669] (-387.734) (-387.642) -- 0:00:38
343000 -- (-389.238) [-387.059] (-388.861) (-391.985) * (-387.615) [-388.980] (-388.091) (-388.805) -- 0:00:38
343500 -- (-386.845) (-390.382) [-386.481] (-388.740) * (-390.878) [-387.490] (-387.995) (-391.776) -- 0:00:38
344000 -- (-392.466) (-387.892) [-386.475] (-388.021) * (-387.676) (-391.255) (-388.547) [-387.619] -- 0:00:38
344500 -- (-390.598) (-388.281) [-388.469] (-388.348) * [-387.207] (-390.686) (-387.385) (-391.391) -- 0:00:38
345000 -- (-391.521) (-389.113) (-388.292) [-388.160] * [-386.407] (-387.842) (-390.023) (-388.368) -- 0:00:37
Average standard deviation of split frequencies: 0.014987
345500 -- (-393.469) [-387.040] (-391.032) (-389.676) * (-386.444) (-386.709) [-388.994] (-391.263) -- 0:00:37
346000 -- (-388.397) (-387.640) (-387.202) [-388.275] * (-392.160) [-388.565] (-386.723) (-388.586) -- 0:00:37
346500 -- (-388.038) [-386.168] (-390.107) (-395.465) * (-387.059) (-387.655) (-387.142) [-390.612] -- 0:00:37
347000 -- (-386.871) (-386.216) [-388.090] (-388.251) * (-389.221) (-390.846) (-390.728) [-388.305] -- 0:00:37
347500 -- (-388.587) (-386.508) (-388.846) [-386.747] * (-387.867) (-389.637) (-391.362) [-387.919] -- 0:00:37
348000 -- (-387.821) [-386.963] (-388.499) (-391.351) * (-387.719) [-386.639] (-391.155) (-396.942) -- 0:00:37
348500 -- (-387.860) [-388.616] (-387.085) (-388.813) * (-388.296) (-387.801) (-387.249) [-390.498] -- 0:00:37
349000 -- (-387.121) [-388.800] (-389.291) (-389.967) * [-390.147] (-387.005) (-387.904) (-387.545) -- 0:00:37
349500 -- (-388.294) (-386.988) [-388.052] (-387.895) * [-387.510] (-389.803) (-387.759) (-387.107) -- 0:00:37
350000 -- [-387.607] (-388.229) (-391.396) (-387.681) * (-388.604) (-389.502) (-391.334) [-387.297] -- 0:00:37
Average standard deviation of split frequencies: 0.015534
350500 -- (-388.686) (-388.301) (-388.501) [-387.219] * (-389.026) (-392.138) [-389.996] (-387.456) -- 0:00:37
351000 -- (-387.102) (-388.262) (-391.010) [-387.359] * (-389.299) (-390.155) [-386.788] (-386.832) -- 0:00:36
351500 -- (-388.360) [-391.110] (-387.632) (-388.571) * (-387.664) (-386.483) [-389.720] (-388.170) -- 0:00:36
352000 -- (-387.851) (-389.903) (-387.669) [-391.754] * (-386.510) (-386.683) (-391.104) [-386.843] -- 0:00:36
352500 -- (-390.061) (-386.940) [-389.023] (-387.674) * (-387.335) [-389.514] (-386.166) (-387.115) -- 0:00:38
353000 -- [-386.497] (-386.610) (-390.146) (-390.069) * (-387.491) [-387.965] (-391.207) (-387.485) -- 0:00:38
353500 -- (-390.379) [-389.797] (-389.972) (-389.075) * (-387.897) (-387.359) [-388.933] (-388.959) -- 0:00:38
354000 -- (-386.597) (-391.612) (-388.113) [-387.744] * [-391.688] (-388.066) (-389.923) (-387.167) -- 0:00:38
354500 -- (-389.458) (-389.185) [-387.743] (-387.466) * (-391.399) (-388.034) [-388.267] (-387.324) -- 0:00:38
355000 -- (-387.059) (-391.405) [-390.848] (-386.614) * (-386.547) (-389.358) (-388.462) [-387.423] -- 0:00:38
Average standard deviation of split frequencies: 0.015081
355500 -- (-387.986) (-386.912) (-390.446) [-393.747] * [-389.308] (-390.824) (-389.739) (-387.177) -- 0:00:38
356000 -- (-391.169) [-387.038] (-388.671) (-392.848) * (-387.346) (-390.805) (-388.044) [-386.942] -- 0:00:37
356500 -- (-390.543) (-387.470) (-388.897) [-392.138] * (-386.283) (-391.648) (-387.953) [-386.779] -- 0:00:37
357000 -- (-390.935) (-389.708) (-390.356) [-386.919] * (-389.994) (-389.947) [-387.799] (-387.146) -- 0:00:37
357500 -- [-388.171] (-387.222) (-387.842) (-388.055) * (-387.473) [-388.659] (-391.058) (-393.036) -- 0:00:37
358000 -- (-387.786) (-387.786) [-387.839] (-388.857) * [-387.083] (-388.073) (-386.588) (-387.947) -- 0:00:37
358500 -- (-388.890) (-391.268) (-387.808) [-387.368] * (-387.901) (-389.067) [-388.805] (-392.560) -- 0:00:37
359000 -- (-387.131) (-393.477) [-387.098] (-387.771) * (-388.948) (-387.950) [-388.624] (-387.485) -- 0:00:37
359500 -- (-389.402) (-390.708) (-389.245) [-388.299] * [-390.106] (-388.673) (-390.609) (-388.544) -- 0:00:37
360000 -- [-387.793] (-388.359) (-387.009) (-389.077) * (-391.219) (-389.978) [-390.469] (-389.355) -- 0:00:37
Average standard deviation of split frequencies: 0.013916
360500 -- (-387.405) (-390.520) (-387.303) [-387.991] * (-389.878) (-388.745) (-389.863) [-388.515] -- 0:00:37
361000 -- (-389.201) [-387.154] (-388.923) (-388.889) * (-388.789) [-386.977] (-390.405) (-387.834) -- 0:00:37
361500 -- (-387.634) (-388.254) (-387.546) [-389.503] * (-390.466) (-386.851) [-389.306] (-387.685) -- 0:00:37
362000 -- (-390.458) (-388.086) [-386.862] (-386.772) * (-390.815) [-386.428] (-388.306) (-386.749) -- 0:00:37
362500 -- (-387.763) (-388.061) (-388.673) [-389.599] * [-391.428] (-391.081) (-388.672) (-390.657) -- 0:00:36
363000 -- (-387.851) (-387.437) [-388.787] (-393.582) * (-388.564) [-386.645] (-390.566) (-389.381) -- 0:00:36
363500 -- (-388.011) (-387.855) [-393.952] (-393.436) * [-387.537] (-386.035) (-390.743) (-389.655) -- 0:00:36
364000 -- (-387.348) (-388.018) [-391.283] (-388.722) * [-387.415] (-388.128) (-387.648) (-386.870) -- 0:00:36
364500 -- (-387.099) (-390.405) (-391.340) [-387.727] * (-388.885) [-386.689] (-388.902) (-388.295) -- 0:00:36
365000 -- [-387.081] (-390.394) (-388.778) (-388.767) * (-391.527) (-387.394) [-389.925] (-389.910) -- 0:00:36
Average standard deviation of split frequencies: 0.013865
365500 -- (-389.341) (-386.999) [-388.180] (-389.727) * (-389.794) [-391.074] (-389.508) (-387.818) -- 0:00:36
366000 -- (-389.021) [-388.749] (-389.136) (-387.024) * (-388.926) (-393.485) [-390.174] (-388.618) -- 0:00:36
366500 -- (-389.274) [-386.571] (-394.105) (-386.779) * (-387.907) [-390.481] (-390.503) (-388.504) -- 0:00:36
367000 -- (-390.805) (-394.252) [-389.794] (-387.372) * (-390.517) (-386.476) (-386.798) [-388.542] -- 0:00:36
367500 -- (-387.137) (-386.930) (-387.878) [-387.371] * (-388.238) (-386.428) [-388.123] (-390.948) -- 0:00:36
368000 -- (-386.047) (-387.719) [-386.809] (-389.655) * [-387.950] (-391.540) (-391.404) (-388.575) -- 0:00:37
368500 -- (-386.134) (-388.897) (-388.838) [-389.338] * (-387.504) (-386.968) (-388.193) [-386.970] -- 0:00:37
369000 -- (-388.763) (-388.343) (-389.963) [-389.347] * [-386.919] (-386.772) (-391.789) (-388.354) -- 0:00:37
369500 -- (-387.515) (-386.159) (-388.782) [-386.991] * (-393.876) (-390.795) (-389.469) [-386.368] -- 0:00:37
370000 -- (-394.013) [-388.126] (-388.861) (-387.015) * [-390.621] (-388.981) (-386.707) (-393.149) -- 0:00:37
Average standard deviation of split frequencies: 0.014064
370500 -- [-392.167] (-387.542) (-391.154) (-387.795) * (-387.494) [-388.304] (-388.270) (-393.021) -- 0:00:37
371000 -- [-390.178] (-387.272) (-387.623) (-388.366) * (-391.621) (-391.063) [-387.302] (-392.818) -- 0:00:37
371500 -- (-387.590) (-387.946) (-388.144) [-389.781] * (-390.600) (-389.417) (-390.848) [-389.127] -- 0:00:37
372000 -- (-389.293) (-387.552) (-387.811) [-389.045] * (-386.267) (-388.449) (-387.851) [-386.927] -- 0:00:37
372500 -- [-389.108] (-386.657) (-389.457) (-389.308) * (-395.710) [-387.684] (-387.075) (-390.716) -- 0:00:37
373000 -- (-388.628) (-388.564) (-395.257) [-387.595] * (-388.469) [-389.347] (-387.071) (-389.001) -- 0:00:36
373500 -- (-389.735) (-388.500) (-391.060) [-388.589] * (-386.668) (-389.946) [-390.907] (-386.979) -- 0:00:36
374000 -- (-387.767) (-388.242) (-387.934) [-391.108] * (-393.486) (-394.741) (-389.996) [-390.098] -- 0:00:36
374500 -- (-386.957) [-390.099] (-390.198) (-387.062) * [-388.691] (-390.212) (-387.815) (-387.261) -- 0:00:36
375000 -- [-386.116] (-387.306) (-389.585) (-388.241) * (-389.898) (-387.486) [-389.622] (-389.159) -- 0:00:36
Average standard deviation of split frequencies: 0.014340
375500 -- (-388.416) (-391.372) (-387.479) [-387.656] * (-388.739) (-390.764) [-386.927] (-390.228) -- 0:00:36
376000 -- (-387.998) (-393.609) (-386.759) [-389.632] * (-387.358) (-386.887) (-389.635) [-387.374] -- 0:00:36
376500 -- (-388.521) (-400.372) [-387.661] (-388.064) * [-387.522] (-388.505) (-388.765) (-388.612) -- 0:00:36
377000 -- (-390.058) (-388.098) [-389.095] (-386.376) * (-387.420) [-387.703] (-386.536) (-397.432) -- 0:00:36
377500 -- (-388.552) (-391.420) [-386.200] (-389.244) * [-388.728] (-389.892) (-386.362) (-392.839) -- 0:00:36
378000 -- (-387.499) [-390.129] (-390.606) (-388.534) * (-386.560) (-389.328) [-387.033] (-392.988) -- 0:00:36
378500 -- (-387.188) (-386.751) (-386.591) [-387.715] * (-388.330) (-387.583) (-387.909) [-387.570] -- 0:00:36
379000 -- (-387.755) [-389.177] (-389.037) (-387.537) * [-388.135] (-389.522) (-388.852) (-388.256) -- 0:00:36
379500 -- [-386.326] (-390.114) (-389.298) (-392.920) * (-388.029) [-387.952] (-388.669) (-388.562) -- 0:00:35
380000 -- (-386.231) (-390.487) [-387.857] (-389.390) * (-387.035) (-387.881) (-389.023) [-390.120] -- 0:00:35
Average standard deviation of split frequencies: 0.015634
380500 -- (-386.339) (-389.863) (-388.752) [-386.904] * (-388.425) [-391.361] (-388.698) (-389.429) -- 0:00:35
381000 -- (-386.620) (-388.701) [-387.260] (-386.879) * [-386.813] (-387.954) (-388.531) (-389.750) -- 0:00:35
381500 -- (-387.326) [-388.478] (-387.545) (-388.333) * (-389.595) (-389.269) [-387.068] (-389.211) -- 0:00:35
382000 -- [-391.817] (-388.475) (-386.353) (-387.741) * (-387.020) (-387.407) [-386.700] (-387.968) -- 0:00:35
382500 -- (-391.274) (-395.952) (-386.765) [-386.956] * (-386.261) (-386.482) (-386.884) [-386.655] -- 0:00:35
383000 -- (-387.878) (-387.831) [-386.435] (-388.375) * (-386.581) (-386.277) [-386.854] (-387.129) -- 0:00:35
383500 -- (-389.648) (-391.633) [-386.602] (-389.194) * (-388.133) (-386.740) (-388.271) [-386.541] -- 0:00:35
384000 -- (-389.954) (-392.476) [-389.834] (-390.343) * [-388.409] (-386.093) (-387.026) (-391.240) -- 0:00:36
384500 -- (-388.828) (-388.426) [-387.856] (-390.818) * (-389.017) (-389.060) [-387.641] (-389.641) -- 0:00:36
385000 -- (-388.273) (-387.378) (-386.673) [-388.924] * (-388.085) (-387.070) [-394.310] (-387.865) -- 0:00:36
Average standard deviation of split frequencies: 0.014502
385500 -- (-388.130) [-387.616] (-389.747) (-388.633) * (-388.558) (-388.939) [-386.892] (-391.617) -- 0:00:36
386000 -- [-386.428] (-390.038) (-390.279) (-389.865) * [-388.427] (-389.481) (-391.249) (-387.423) -- 0:00:36
386500 -- [-386.891] (-389.586) (-388.086) (-391.827) * (-389.726) (-387.348) [-387.301] (-391.495) -- 0:00:36
387000 -- (-386.893) (-391.740) (-388.000) [-389.278] * (-394.251) [-389.765] (-388.347) (-387.902) -- 0:00:36
387500 -- [-386.959] (-393.767) (-386.782) (-386.739) * (-390.402) (-391.206) [-387.164] (-390.308) -- 0:00:36
388000 -- (-388.968) (-390.162) [-388.603] (-388.953) * (-390.808) (-392.628) (-388.240) [-388.214] -- 0:00:36
388500 -- (-388.892) (-388.891) [-387.619] (-387.041) * [-388.148] (-387.231) (-386.904) (-387.815) -- 0:00:36
389000 -- (-390.723) (-386.960) (-389.032) [-389.980] * (-386.903) [-386.674] (-386.880) (-388.432) -- 0:00:36
389500 -- [-386.729] (-388.210) (-388.354) (-389.325) * (-390.564) [-386.976] (-388.229) (-393.689) -- 0:00:36
390000 -- (-389.124) (-387.385) (-388.411) [-388.882] * (-390.347) (-388.603) (-389.428) [-387.564] -- 0:00:35
Average standard deviation of split frequencies: 0.013877
390500 -- (-388.453) (-387.604) (-388.626) [-386.291] * (-390.162) (-386.915) (-391.416) [-387.458] -- 0:00:35
391000 -- (-387.728) (-388.536) [-387.880] (-387.321) * (-389.675) [-386.468] (-395.679) (-391.471) -- 0:00:35
391500 -- (-387.537) (-392.657) (-388.637) [-387.411] * [-388.164] (-388.172) (-390.488) (-392.845) -- 0:00:35
392000 -- (-387.122) (-390.573) [-387.310] (-389.116) * (-390.827) (-390.650) (-389.851) [-389.756] -- 0:00:35
392500 -- (-392.359) [-389.818] (-388.832) (-387.396) * [-389.451] (-390.850) (-394.037) (-392.748) -- 0:00:35
393000 -- [-390.028] (-391.417) (-386.301) (-387.064) * (-390.302) (-390.723) (-391.310) [-391.649] -- 0:00:35
393500 -- (-388.422) (-391.363) (-395.824) [-387.902] * (-386.956) (-391.272) [-388.124] (-389.321) -- 0:00:35
394000 -- (-388.885) [-387.170] (-389.992) (-388.273) * (-388.352) (-388.136) (-389.984) [-387.122] -- 0:00:35
394500 -- (-387.455) (-388.938) [-387.587] (-388.100) * (-387.164) [-391.531] (-390.937) (-388.422) -- 0:00:35
395000 -- [-388.514] (-387.896) (-389.724) (-390.287) * (-388.035) [-387.223] (-392.448) (-388.479) -- 0:00:35
Average standard deviation of split frequencies: 0.013243
395500 -- (-388.126) (-389.941) (-390.498) [-391.958] * (-388.161) [-388.129] (-386.578) (-390.763) -- 0:00:35
396000 -- (-387.381) [-388.422] (-386.953) (-390.226) * (-386.953) [-386.560] (-387.240) (-390.233) -- 0:00:35
396500 -- (-392.513) [-387.707] (-386.049) (-391.209) * (-387.315) (-389.069) [-387.062] (-388.031) -- 0:00:35
397000 -- (-388.753) (-387.407) [-387.572] (-387.797) * (-388.613) [-389.994] (-387.300) (-387.851) -- 0:00:34
397500 -- [-388.321] (-388.332) (-386.166) (-396.730) * (-388.647) (-390.824) [-387.543] (-388.122) -- 0:00:34
398000 -- (-388.017) (-388.730) (-390.189) [-387.137] * (-387.727) [-388.506] (-387.026) (-386.237) -- 0:00:34
398500 -- (-387.299) (-389.045) [-390.349] (-392.272) * [-389.843] (-387.954) (-391.159) (-390.050) -- 0:00:34
399000 -- (-391.575) [-388.184] (-394.490) (-387.258) * (-390.528) (-389.429) (-388.224) [-387.511] -- 0:00:34
399500 -- (-390.946) [-388.199] (-389.533) (-386.932) * (-387.924) (-388.334) [-387.374] (-388.757) -- 0:00:34
400000 -- (-387.857) [-389.585] (-387.048) (-392.172) * (-387.107) (-390.067) [-387.115] (-388.093) -- 0:00:34
Average standard deviation of split frequencies: 0.012721
400500 -- [-389.376] (-388.652) (-386.546) (-388.207) * (-388.072) [-387.611] (-388.446) (-387.718) -- 0:00:34
401000 -- [-386.249] (-387.593) (-387.495) (-386.822) * (-389.748) [-387.279] (-388.396) (-390.938) -- 0:00:35
401500 -- [-388.522] (-388.278) (-386.698) (-390.562) * (-388.063) (-387.195) [-388.226] (-387.971) -- 0:00:35
402000 -- (-387.948) [-388.895] (-387.574) (-388.188) * (-391.109) [-387.377] (-387.996) (-390.370) -- 0:00:35
402500 -- [-388.834] (-388.564) (-393.089) (-388.496) * (-387.918) (-390.333) [-386.892] (-389.144) -- 0:00:35
403000 -- (-387.722) (-389.065) (-387.467) [-387.772] * (-388.929) (-390.442) [-386.761] (-387.236) -- 0:00:35
403500 -- (-389.212) (-390.920) [-388.072] (-386.678) * (-388.559) (-390.002) (-388.397) [-388.325] -- 0:00:35
404000 -- [-388.478] (-387.565) (-392.312) (-390.844) * [-386.874] (-386.970) (-387.341) (-387.722) -- 0:00:35
404500 -- (-391.279) (-390.650) [-390.589] (-393.994) * [-386.931] (-389.235) (-387.090) (-388.063) -- 0:00:35
405000 -- (-388.697) (-386.720) (-392.275) [-387.198] * [-389.468] (-386.997) (-388.154) (-391.159) -- 0:00:35
Average standard deviation of split frequencies: 0.012917
405500 -- (-390.371) (-390.818) (-392.418) [-388.790] * (-387.246) [-386.768] (-389.462) (-387.024) -- 0:00:35
406000 -- (-389.216) (-386.511) (-392.695) [-386.305] * (-388.337) (-388.682) [-386.697] (-389.835) -- 0:00:35
406500 -- (-387.699) [-388.458] (-389.983) (-388.034) * (-388.102) (-389.739) (-391.354) [-388.009] -- 0:00:35
407000 -- (-389.673) (-390.191) (-393.363) [-388.399] * [-387.339] (-389.089) (-388.597) (-387.024) -- 0:00:34
407500 -- [-386.839] (-387.831) (-386.450) (-388.833) * (-388.568) (-387.656) (-387.409) [-387.609] -- 0:00:34
408000 -- (-387.068) [-388.059] (-393.153) (-388.017) * (-389.541) [-386.983] (-389.088) (-387.478) -- 0:00:34
408500 -- (-387.563) (-390.449) (-387.650) [-387.736] * (-386.600) (-388.883) (-386.565) [-388.850] -- 0:00:34
409000 -- (-389.728) (-391.596) [-388.265] (-389.163) * (-386.707) (-387.489) [-387.065] (-388.014) -- 0:00:34
409500 -- (-390.553) [-388.700] (-388.402) (-389.183) * (-387.728) (-388.739) [-387.483] (-387.921) -- 0:00:34
410000 -- [-386.395] (-388.384) (-387.712) (-388.323) * (-390.363) [-388.019] (-388.495) (-389.802) -- 0:00:34
Average standard deviation of split frequencies: 0.013488
410500 -- (-387.213) [-388.128] (-388.855) (-388.241) * (-389.003) [-390.139] (-386.234) (-389.976) -- 0:00:34
411000 -- (-388.408) (-388.588) (-388.211) [-388.632] * (-386.505) (-389.009) [-386.707] (-387.466) -- 0:00:34
411500 -- (-386.468) (-387.092) [-389.962] (-386.864) * [-386.288] (-391.184) (-386.859) (-386.962) -- 0:00:34
412000 -- (-390.616) (-388.119) [-389.002] (-389.916) * (-387.162) (-387.726) (-392.566) [-387.392] -- 0:00:34
412500 -- [-386.844] (-389.266) (-393.461) (-389.305) * (-386.939) (-387.888) [-391.669] (-391.586) -- 0:00:34
413000 -- [-386.440] (-386.485) (-387.255) (-390.251) * [-387.424] (-387.571) (-389.024) (-390.800) -- 0:00:34
413500 -- (-386.888) (-386.879) (-387.339) [-389.367] * (-387.194) (-386.491) [-391.352] (-386.406) -- 0:00:34
414000 -- (-387.495) [-387.693] (-387.682) (-389.219) * [-391.106] (-387.382) (-393.074) (-387.670) -- 0:00:33
414500 -- (-389.852) [-388.029] (-387.437) (-389.485) * (-387.458) (-390.064) (-390.404) [-386.409] -- 0:00:33
415000 -- [-386.549] (-391.257) (-386.513) (-389.588) * (-387.395) (-388.390) (-390.965) [-388.144] -- 0:00:33
Average standard deviation of split frequencies: 0.013244
415500 -- (-386.945) [-387.503] (-386.970) (-394.272) * (-387.278) (-387.006) [-391.621] (-387.423) -- 0:00:33
416000 -- (-388.406) [-388.308] (-388.627) (-388.644) * (-387.967) (-387.758) (-387.754) [-390.872] -- 0:00:33
416500 -- [-391.024] (-387.940) (-388.573) (-388.623) * [-387.234] (-389.822) (-386.976) (-389.182) -- 0:00:33
417000 -- (-387.694) (-387.745) [-389.392] (-387.595) * (-392.560) (-387.546) (-390.411) [-387.925] -- 0:00:33
417500 -- (-390.803) (-387.638) [-389.673] (-387.916) * (-393.344) [-388.197] (-388.127) (-388.664) -- 0:00:33
418000 -- (-390.855) [-388.474] (-395.232) (-389.047) * (-388.744) [-386.349] (-388.017) (-388.469) -- 0:00:34
418500 -- (-390.198) (-387.773) (-389.982) [-388.722] * (-387.062) (-387.689) (-387.759) [-386.661] -- 0:00:34
419000 -- [-387.797] (-388.068) (-388.509) (-396.936) * (-389.778) (-389.195) (-388.303) [-389.237] -- 0:00:34
419500 -- [-386.783] (-390.168) (-387.300) (-386.845) * (-388.582) (-388.423) [-386.879] (-387.591) -- 0:00:34
420000 -- (-389.185) (-390.610) (-386.954) [-386.490] * [-386.355] (-388.685) (-393.679) (-387.944) -- 0:00:34
Average standard deviation of split frequencies: 0.012327
420500 -- (-388.579) [-388.071] (-388.064) (-388.024) * (-390.109) (-386.792) [-389.058] (-391.043) -- 0:00:34
421000 -- (-388.614) (-387.305) (-388.541) [-387.293] * (-388.472) (-390.015) [-388.686] (-386.525) -- 0:00:34
421500 -- (-391.972) (-390.634) (-390.434) [-388.100] * (-391.602) (-386.882) [-386.952] (-389.776) -- 0:00:34
422000 -- (-389.370) [-388.287] (-388.958) (-392.577) * (-387.137) [-386.344] (-394.661) (-387.622) -- 0:00:34
422500 -- (-387.326) (-387.666) (-389.325) [-388.724] * [-389.931] (-392.822) (-387.001) (-388.307) -- 0:00:34
423000 -- [-389.083] (-386.676) (-391.113) (-390.830) * (-387.424) (-395.000) [-389.451] (-386.358) -- 0:00:34
423500 -- (-386.867) (-391.634) (-387.714) [-391.701] * (-388.367) (-390.096) (-389.276) [-389.631] -- 0:00:34
424000 -- (-391.649) (-389.569) (-386.546) [-386.970] * (-387.450) [-388.143] (-387.744) (-388.960) -- 0:00:33
424500 -- (-390.142) [-388.359] (-386.911) (-386.549) * (-389.666) (-390.566) [-387.135] (-388.827) -- 0:00:33
425000 -- (-390.635) [-389.457] (-387.267) (-387.530) * [-393.176] (-395.484) (-388.279) (-389.937) -- 0:00:33
Average standard deviation of split frequencies: 0.013072
425500 -- [-388.247] (-387.318) (-388.870) (-388.988) * (-392.628) [-390.571] (-389.826) (-387.609) -- 0:00:33
426000 -- [-388.720] (-387.412) (-389.048) (-389.589) * (-388.042) (-390.912) [-386.627] (-387.970) -- 0:00:33
426500 -- (-387.641) (-389.198) [-388.245] (-387.444) * (-388.751) (-390.645) (-386.831) [-387.922] -- 0:00:33
427000 -- (-387.280) (-388.110) [-386.801] (-386.941) * (-388.699) (-386.762) (-392.742) [-387.529] -- 0:00:33
427500 -- [-389.092] (-390.391) (-387.122) (-388.673) * (-388.670) [-386.001] (-391.707) (-387.946) -- 0:00:33
428000 -- (-389.636) [-387.848] (-393.375) (-386.269) * (-389.211) [-388.874] (-390.030) (-386.122) -- 0:00:33
428500 -- (-391.635) (-386.837) [-386.885] (-387.605) * [-387.836] (-389.408) (-388.238) (-390.080) -- 0:00:33
429000 -- [-390.243] (-386.091) (-386.383) (-394.729) * [-388.172] (-387.244) (-394.602) (-389.619) -- 0:00:33
429500 -- (-386.773) [-386.927] (-386.522) (-386.856) * (-387.755) [-388.980] (-389.115) (-387.813) -- 0:00:33
430000 -- (-387.258) [-390.152] (-386.514) (-388.217) * (-390.181) [-389.996] (-393.447) (-388.409) -- 0:00:33
Average standard deviation of split frequencies: 0.013135
430500 -- [-388.700] (-394.321) (-387.653) (-388.341) * (-387.608) [-389.719] (-389.053) (-388.600) -- 0:00:33
431000 -- [-387.123] (-392.939) (-391.072) (-388.610) * (-387.076) (-391.946) [-388.060] (-387.320) -- 0:00:33
431500 -- [-386.672] (-390.616) (-390.276) (-387.675) * [-389.444] (-388.436) (-387.740) (-387.972) -- 0:00:32
432000 -- (-391.438) [-387.693] (-387.683) (-392.171) * (-387.719) (-389.639) (-390.296) [-387.004] -- 0:00:32
432500 -- (-386.186) (-387.624) [-389.070] (-386.475) * (-387.783) (-391.720) (-389.662) [-386.789] -- 0:00:32
433000 -- [-387.461] (-389.646) (-388.205) (-387.280) * (-391.372) (-388.925) (-389.280) [-386.986] -- 0:00:32
433500 -- (-387.777) (-390.054) [-387.695] (-388.421) * (-391.867) [-386.906] (-389.446) (-388.360) -- 0:00:32
434000 -- [-387.777] (-392.989) (-388.729) (-388.667) * (-388.551) (-387.297) (-388.102) [-387.069] -- 0:00:32
434500 -- [-388.522] (-389.743) (-387.853) (-388.427) * (-390.152) (-386.681) [-391.646] (-389.079) -- 0:00:32
435000 -- (-388.687) (-389.476) (-387.572) [-388.062] * (-389.665) (-389.245) (-391.071) [-387.360] -- 0:00:32
Average standard deviation of split frequencies: 0.013515
435500 -- (-389.661) [-386.470] (-387.334) (-391.715) * [-391.164] (-389.452) (-389.131) (-390.735) -- 0:00:33
436000 -- (-388.462) (-386.584) [-390.449] (-387.406) * [-399.367] (-386.643) (-390.865) (-391.153) -- 0:00:33
436500 -- (-386.962) [-389.371] (-389.244) (-389.425) * (-387.854) (-392.054) [-387.663] (-390.359) -- 0:00:33
437000 -- (-387.044) (-389.088) (-391.625) [-391.060] * (-390.895) (-392.445) [-389.219] (-389.803) -- 0:00:33
437500 -- (-391.096) (-387.190) (-387.456) [-388.087] * (-390.755) [-386.599] (-388.602) (-389.781) -- 0:00:33
438000 -- (-391.650) (-387.483) [-386.999] (-393.104) * (-392.189) (-388.506) (-388.930) [-389.041] -- 0:00:33
438500 -- (-387.534) (-389.265) [-387.766] (-387.496) * (-388.312) [-390.051] (-389.181) (-386.817) -- 0:00:33
439000 -- (-391.262) [-387.847] (-388.428) (-387.001) * [-387.758] (-391.657) (-391.688) (-392.102) -- 0:00:33
439500 -- (-389.028) (-388.835) (-389.364) [-387.859] * [-391.661] (-389.526) (-391.938) (-388.424) -- 0:00:33
440000 -- (-390.794) [-389.860] (-389.181) (-388.520) * (-386.872) [-387.095] (-390.684) (-392.428) -- 0:00:33
Average standard deviation of split frequencies: 0.014041
440500 -- (-390.566) [-387.534] (-392.578) (-387.125) * (-388.039) (-387.848) [-389.372] (-386.448) -- 0:00:33
441000 -- (-389.977) (-388.691) [-389.352] (-388.804) * (-388.520) [-390.666] (-387.441) (-387.662) -- 0:00:32
441500 -- (-389.867) (-387.326) (-387.989) [-387.258] * (-392.367) [-390.465] (-388.769) (-388.435) -- 0:00:32
442000 -- (-389.461) [-386.779] (-388.727) (-389.340) * (-392.522) [-386.990] (-390.593) (-389.016) -- 0:00:32
442500 -- [-388.500] (-388.096) (-390.405) (-388.643) * (-388.770) [-389.531] (-394.097) (-390.334) -- 0:00:32
443000 -- (-386.540) (-389.362) [-386.247] (-387.291) * [-387.256] (-390.072) (-388.899) (-388.473) -- 0:00:32
443500 -- (-389.725) [-386.831] (-387.704) (-390.364) * (-388.715) (-387.005) [-389.968] (-387.965) -- 0:00:32
444000 -- [-393.698] (-388.239) (-389.648) (-392.536) * (-387.341) [-389.092] (-388.248) (-386.888) -- 0:00:32
444500 -- (-388.585) (-389.291) [-386.614] (-396.364) * (-387.145) (-388.845) [-387.956] (-389.559) -- 0:00:32
445000 -- (-386.767) (-387.885) [-387.241] (-387.257) * (-388.363) (-387.714) [-389.328] (-389.918) -- 0:00:32
Average standard deviation of split frequencies: 0.013212
445500 -- (-390.562) (-386.793) [-387.065] (-388.501) * (-391.738) (-387.440) (-387.827) [-388.524] -- 0:00:32
446000 -- (-390.791) (-388.609) (-388.819) [-387.556] * (-392.706) (-390.707) (-390.193) [-387.119] -- 0:00:32
446500 -- (-386.868) (-393.860) (-393.825) [-389.686] * (-387.411) (-387.658) (-387.167) [-386.591] -- 0:00:32
447000 -- (-390.158) (-392.507) (-388.868) [-389.086] * (-392.461) [-387.729] (-386.506) (-387.987) -- 0:00:32
447500 -- (-391.750) (-391.021) [-386.816] (-391.501) * [-387.958] (-387.038) (-386.759) (-387.120) -- 0:00:32
448000 -- (-389.687) (-388.211) [-387.156] (-389.408) * (-389.215) (-388.173) (-387.435) [-386.776] -- 0:00:32
448500 -- (-389.555) (-388.324) (-392.403) [-390.369] * (-391.765) [-395.621] (-387.345) (-387.240) -- 0:00:31
449000 -- (-389.639) [-387.509] (-390.009) (-388.127) * (-387.739) [-394.458] (-391.061) (-390.327) -- 0:00:31
449500 -- [-390.063] (-389.529) (-387.955) (-392.358) * [-387.345] (-389.426) (-388.036) (-387.216) -- 0:00:31
450000 -- [-388.086] (-391.033) (-388.735) (-388.141) * (-388.306) (-387.911) [-390.283] (-389.039) -- 0:00:31
Average standard deviation of split frequencies: 0.012879
450500 -- (-386.501) (-386.964) [-387.447] (-387.671) * (-390.893) [-387.105] (-388.683) (-387.596) -- 0:00:31
451000 -- (-389.854) [-388.363] (-387.248) (-387.771) * (-388.451) [-387.534] (-387.249) (-387.007) -- 0:00:31
451500 -- (-388.709) (-387.180) [-388.308] (-388.276) * (-387.463) (-387.147) (-387.963) [-391.099] -- 0:00:31
452000 -- (-390.758) (-389.130) [-388.384] (-390.337) * (-386.555) (-387.815) [-387.106] (-386.996) -- 0:00:31
452500 -- [-387.789] (-387.449) (-386.538) (-389.208) * (-392.830) (-390.392) [-387.625] (-388.369) -- 0:00:32
453000 -- [-389.529] (-388.815) (-390.050) (-386.608) * [-387.221] (-387.722) (-394.021) (-389.843) -- 0:00:32
453500 -- (-393.819) (-387.943) (-389.424) [-387.786] * (-390.481) (-387.574) (-387.278) [-388.358] -- 0:00:32
454000 -- (-396.727) (-387.530) [-391.256] (-386.768) * (-392.621) [-390.553] (-387.203) (-387.007) -- 0:00:32
454500 -- (-387.767) (-387.986) [-393.607] (-387.478) * (-388.257) (-388.021) (-387.753) [-387.783] -- 0:00:32
455000 -- (-390.349) [-386.620] (-388.850) (-386.709) * (-388.958) (-387.521) (-387.579) [-392.271] -- 0:00:32
Average standard deviation of split frequencies: 0.011493
455500 -- (-395.921) (-388.285) [-390.722] (-387.411) * (-386.350) (-387.196) (-391.153) [-389.463] -- 0:00:32
456000 -- (-393.445) (-389.303) (-387.905) [-390.020] * (-390.421) [-388.447] (-389.211) (-388.732) -- 0:00:32
456500 -- [-391.442] (-391.317) (-386.540) (-390.462) * (-387.775) (-390.988) [-387.265] (-388.509) -- 0:00:32
457000 -- (-388.060) [-386.347] (-387.341) (-391.266) * (-396.567) (-394.856) (-388.052) [-388.908] -- 0:00:32
457500 -- (-390.126) (-387.189) [-386.990] (-393.563) * (-386.736) (-386.255) [-388.319] (-388.379) -- 0:00:32
458000 -- [-388.826] (-388.919) (-388.268) (-387.685) * (-386.859) (-387.890) [-388.023] (-390.094) -- 0:00:31
458500 -- (-389.045) (-389.375) (-386.736) [-387.363] * [-386.510] (-389.148) (-386.940) (-391.149) -- 0:00:31
459000 -- (-391.159) (-389.256) [-386.846] (-390.424) * [-386.615] (-388.389) (-389.206) (-388.027) -- 0:00:31
459500 -- (-388.633) [-389.047] (-387.448) (-390.527) * [-386.568] (-389.597) (-389.189) (-387.032) -- 0:00:31
460000 -- (-388.210) [-388.569] (-392.730) (-387.513) * (-389.790) (-390.821) [-389.424] (-387.815) -- 0:00:31
Average standard deviation of split frequencies: 0.011768
460500 -- (-389.500) [-387.217] (-389.645) (-387.017) * [-388.304] (-388.557) (-388.707) (-387.078) -- 0:00:31
461000 -- (-393.234) (-391.708) (-390.349) [-386.607] * [-389.191] (-387.526) (-387.494) (-389.196) -- 0:00:31
461500 -- (-388.301) (-387.302) [-389.094] (-386.402) * (-387.008) (-388.726) (-387.223) [-387.246] -- 0:00:31
462000 -- (-387.017) [-389.025] (-387.264) (-391.403) * (-387.724) (-387.792) (-387.267) [-387.365] -- 0:00:31
462500 -- (-390.930) [-389.407] (-386.926) (-388.122) * [-389.460] (-388.176) (-389.776) (-387.494) -- 0:00:31
463000 -- [-386.819] (-390.133) (-388.045) (-388.328) * (-391.702) (-388.950) (-389.171) [-388.140] -- 0:00:31
463500 -- [-387.171] (-388.877) (-391.894) (-386.854) * (-388.988) (-387.860) [-389.597] (-387.358) -- 0:00:31
464000 -- (-388.176) [-388.332] (-388.455) (-388.437) * [-387.984] (-389.685) (-392.638) (-389.067) -- 0:00:31
464500 -- [-386.681] (-388.357) (-387.866) (-387.507) * [-388.239] (-388.915) (-388.069) (-388.870) -- 0:00:31
465000 -- [-386.270] (-388.773) (-388.110) (-388.017) * (-388.531) (-387.497) [-387.752] (-389.170) -- 0:00:31
Average standard deviation of split frequencies: 0.011485
465500 -- [-386.901] (-388.012) (-387.257) (-387.384) * (-388.524) [-391.434] (-388.166) (-390.650) -- 0:00:31
466000 -- [-387.819] (-389.033) (-388.500) (-389.553) * (-390.282) [-388.729] (-388.090) (-391.889) -- 0:00:30
466500 -- (-388.422) (-390.410) (-389.201) [-393.597] * (-390.197) [-388.760] (-388.819) (-388.265) -- 0:00:30
467000 -- [-389.015] (-386.544) (-388.040) (-394.696) * (-394.189) (-390.012) (-389.182) [-387.240] -- 0:00:30
467500 -- (-389.554) (-387.205) [-389.651] (-392.223) * [-390.315] (-388.495) (-390.755) (-388.635) -- 0:00:30
468000 -- [-388.743] (-387.133) (-390.004) (-388.577) * (-390.585) [-387.750] (-387.338) (-389.053) -- 0:00:30
468500 -- (-389.645) [-388.175] (-387.759) (-386.809) * (-389.521) [-387.907] (-389.461) (-390.675) -- 0:00:30
469000 -- (-388.910) (-389.772) [-389.524] (-388.160) * [-387.288] (-391.426) (-389.809) (-387.383) -- 0:00:30
469500 -- (-388.575) [-386.648] (-388.555) (-391.603) * (-386.420) [-388.384] (-390.879) (-387.089) -- 0:00:31
470000 -- (-387.226) (-390.786) [-387.546] (-389.507) * (-386.894) (-388.738) [-389.657] (-387.640) -- 0:00:31
Average standard deviation of split frequencies: 0.011312
470500 -- (-389.597) (-388.440) (-387.932) [-390.054] * (-386.972) (-389.264) (-389.581) [-388.239] -- 0:00:31
471000 -- (-390.180) [-386.080] (-388.645) (-388.847) * (-387.410) (-387.752) [-389.232] (-387.910) -- 0:00:31
471500 -- [-388.747] (-389.989) (-391.136) (-387.923) * [-387.146] (-390.843) (-395.353) (-386.416) -- 0:00:31
472000 -- (-388.488) (-391.489) [-387.631] (-392.125) * [-389.004] (-389.865) (-387.561) (-390.492) -- 0:00:31
472500 -- (-387.328) (-386.948) (-391.306) [-388.022] * [-387.623] (-391.809) (-388.429) (-389.428) -- 0:00:31
473000 -- (-388.590) [-388.059] (-387.567) (-388.168) * (-388.971) (-389.560) [-390.565] (-392.698) -- 0:00:31
473500 -- (-386.784) (-386.983) [-390.030] (-388.298) * (-393.911) (-387.414) (-389.933) [-386.323] -- 0:00:31
474000 -- (-387.524) (-388.129) [-388.661] (-389.617) * (-386.672) (-388.827) [-390.018] (-387.901) -- 0:00:31
474500 -- (-390.649) (-388.266) (-387.372) [-388.556] * (-388.194) (-387.935) [-387.206] (-387.328) -- 0:00:31
475000 -- (-391.371) [-388.426] (-388.367) (-389.179) * (-387.490) [-386.660] (-389.315) (-389.364) -- 0:00:30
Average standard deviation of split frequencies: 0.011243
475500 -- (-388.961) (-387.118) [-386.794] (-388.629) * (-389.010) (-387.032) (-388.128) [-389.548] -- 0:00:30
476000 -- (-387.543) (-388.424) [-388.558] (-392.894) * [-389.468] (-386.695) (-390.330) (-388.108) -- 0:00:30
476500 -- (-392.045) (-389.570) (-389.234) [-390.203] * (-386.771) [-386.063] (-392.564) (-387.353) -- 0:00:30
477000 -- (-389.883) (-387.756) (-391.927) [-388.074] * (-386.430) [-386.423] (-388.561) (-387.270) -- 0:00:30
477500 -- (-390.236) (-389.978) [-387.538] (-387.519) * (-393.676) (-386.968) [-390.177] (-389.141) -- 0:00:30
478000 -- [-388.252] (-387.669) (-390.631) (-388.935) * (-387.423) (-387.599) (-387.974) [-389.722] -- 0:00:30
478500 -- (-387.821) (-387.296) (-391.529) [-386.793] * (-386.461) (-388.175) [-387.469] (-388.805) -- 0:00:30
479000 -- (-386.735) (-390.361) [-387.429] (-390.265) * [-387.457] (-387.468) (-390.666) (-386.934) -- 0:00:30
479500 -- (-388.974) (-388.427) [-390.235] (-387.691) * (-388.521) (-391.378) [-387.618] (-392.688) -- 0:00:30
480000 -- [-389.512] (-389.015) (-386.594) (-388.103) * (-389.301) (-387.462) [-388.870] (-387.824) -- 0:00:30
Average standard deviation of split frequencies: 0.011462
480500 -- (-388.937) (-389.044) [-387.282] (-388.263) * (-388.206) (-388.968) [-388.306] (-391.668) -- 0:00:30
481000 -- (-389.369) (-387.894) [-388.024] (-389.420) * [-387.713] (-389.110) (-386.570) (-387.232) -- 0:00:30
481500 -- (-388.374) (-390.637) (-391.260) [-388.930] * (-388.091) (-386.644) (-386.825) [-389.450] -- 0:00:30
482000 -- [-393.051] (-386.703) (-388.175) (-388.407) * (-389.669) (-389.777) (-387.847) [-389.267] -- 0:00:30
482500 -- (-389.098) [-387.704] (-393.278) (-392.969) * (-391.153) (-387.427) (-388.875) [-386.756] -- 0:00:30
483000 -- [-389.258] (-388.903) (-390.049) (-390.053) * (-392.256) [-387.961] (-391.305) (-387.079) -- 0:00:29
483500 -- (-387.064) [-387.590] (-388.804) (-388.927) * [-388.369] (-389.582) (-387.264) (-395.660) -- 0:00:29
484000 -- (-387.224) (-387.668) [-389.132] (-392.602) * (-387.665) (-392.557) (-390.698) [-391.914] -- 0:00:29
484500 -- (-390.747) (-388.964) [-387.983] (-394.575) * [-386.355] (-387.565) (-390.799) (-388.556) -- 0:00:29
485000 -- (-391.238) (-391.720) (-386.558) [-387.142] * (-388.181) (-387.431) [-388.562] (-390.804) -- 0:00:29
Average standard deviation of split frequencies: 0.011337
485500 -- (-387.043) [-392.643] (-389.681) (-388.668) * [-392.182] (-387.885) (-387.716) (-387.824) -- 0:00:29
486000 -- [-388.606] (-386.882) (-387.215) (-388.807) * (-391.365) (-388.053) [-388.317] (-386.761) -- 0:00:29
486500 -- (-387.390) (-387.628) [-386.382] (-387.952) * (-391.196) (-389.815) (-387.544) [-386.894] -- 0:00:30
487000 -- (-390.538) (-389.774) [-387.456] (-390.072) * (-387.321) (-389.429) (-386.622) [-390.807] -- 0:00:30
487500 -- [-388.951] (-390.207) (-387.086) (-388.678) * [-386.727] (-394.292) (-387.535) (-390.429) -- 0:00:30
488000 -- [-391.141] (-388.042) (-389.435) (-388.448) * (-390.490) (-391.049) (-393.201) [-387.049] -- 0:00:30
488500 -- [-392.661] (-388.458) (-386.742) (-388.507) * (-391.200) (-389.143) (-390.341) [-387.873] -- 0:00:30
489000 -- [-390.327] (-388.349) (-391.919) (-391.782) * (-389.633) (-389.009) (-387.831) [-389.554] -- 0:00:30
489500 -- (-387.915) (-389.275) [-386.108] (-398.852) * [-387.243] (-387.362) (-387.000) (-392.212) -- 0:00:30
490000 -- (-390.276) [-394.346] (-388.410) (-390.522) * [-389.244] (-390.252) (-387.574) (-388.439) -- 0:00:30
Average standard deviation of split frequencies: 0.010738
490500 -- (-393.626) [-387.611] (-389.184) (-388.725) * (-386.798) (-387.510) (-389.576) [-388.271] -- 0:00:30
491000 -- [-386.863] (-387.228) (-387.276) (-387.705) * (-386.877) (-388.474) [-389.091] (-388.924) -- 0:00:30
491500 -- (-387.184) (-391.209) [-387.876] (-389.485) * (-386.615) (-389.366) [-389.794] (-387.817) -- 0:00:30
492000 -- [-389.116] (-388.106) (-388.696) (-387.163) * [-386.846] (-390.253) (-386.948) (-391.035) -- 0:00:29
492500 -- (-389.276) (-387.490) [-388.065] (-389.855) * (-386.483) [-388.820] (-387.675) (-392.591) -- 0:00:29
493000 -- (-391.131) [-387.116] (-387.336) (-388.466) * [-388.612] (-387.422) (-386.782) (-395.473) -- 0:00:29
493500 -- (-387.022) [-386.528] (-392.557) (-390.610) * (-387.314) (-389.273) [-389.397] (-388.511) -- 0:00:29
494000 -- (-387.790) (-389.663) (-390.741) [-387.910] * (-387.058) [-387.743] (-387.562) (-389.011) -- 0:00:29
494500 -- (-389.009) (-392.538) [-388.815] (-388.326) * [-386.883] (-391.601) (-388.806) (-387.300) -- 0:00:29
495000 -- (-391.435) [-388.849] (-390.696) (-388.342) * (-391.657) (-388.077) (-388.540) [-388.366] -- 0:00:29
Average standard deviation of split frequencies: 0.010633
495500 -- (-391.562) (-394.740) (-392.072) [-389.718] * [-388.684] (-389.770) (-387.502) (-386.765) -- 0:00:29
496000 -- (-390.299) (-387.468) [-387.447] (-388.384) * [-387.863] (-389.042) (-386.679) (-389.626) -- 0:00:29
496500 -- (-389.312) (-388.373) [-389.733] (-388.011) * (-388.521) (-391.765) (-387.267) [-388.462] -- 0:00:29
497000 -- (-387.527) (-388.866) [-388.438] (-389.883) * (-391.485) (-389.590) [-386.917] (-388.690) -- 0:00:29
497500 -- (-388.529) (-386.745) [-392.116] (-387.091) * (-387.275) (-391.196) (-389.913) [-390.887] -- 0:00:29
498000 -- [-387.153] (-387.487) (-387.345) (-386.577) * (-388.418) (-390.121) [-387.772] (-392.705) -- 0:00:29
498500 -- [-388.441] (-389.795) (-388.758) (-387.194) * (-387.268) (-395.472) (-388.932) [-390.541] -- 0:00:29
499000 -- (-387.295) (-390.572) (-388.769) [-389.475] * (-387.570) [-391.210] (-387.885) (-389.298) -- 0:00:29
499500 -- (-390.512) (-388.317) [-388.027] (-386.707) * (-388.921) (-387.341) [-388.583] (-389.025) -- 0:00:29
500000 -- [-387.085] (-389.961) (-396.635) (-388.572) * (-388.143) (-387.718) (-390.054) [-389.612] -- 0:00:29
Average standard deviation of split frequencies: 0.009918
500500 -- (-387.924) (-394.500) [-389.569] (-386.451) * (-388.457) (-391.186) [-388.232] (-386.998) -- 0:00:28
501000 -- (-389.768) [-393.679] (-396.686) (-388.648) * (-390.709) (-392.555) (-386.919) [-389.583] -- 0:00:28
501500 -- (-389.980) [-386.739] (-388.693) (-387.234) * (-392.830) (-389.963) [-389.555] (-386.936) -- 0:00:28
502000 -- (-388.809) (-391.745) [-388.993] (-390.677) * (-387.209) [-388.399] (-389.938) (-386.566) -- 0:00:28
502500 -- (-387.250) [-387.689] (-387.465) (-388.349) * (-387.323) (-390.702) (-386.971) [-390.229] -- 0:00:28
503000 -- (-390.122) [-389.000] (-387.728) (-390.820) * (-393.023) (-393.236) (-386.205) [-387.339] -- 0:00:28
503500 -- (-387.151) (-388.801) (-387.422) [-390.778] * (-386.735) (-386.579) (-387.681) [-394.186] -- 0:00:29
504000 -- (-386.148) (-388.672) [-388.400] (-388.442) * (-387.918) (-389.280) [-386.569] (-387.808) -- 0:00:29
504500 -- [-389.816] (-386.862) (-386.971) (-388.921) * [-386.492] (-393.892) (-386.479) (-388.904) -- 0:00:29
505000 -- [-388.095] (-387.155) (-387.060) (-387.999) * [-386.536] (-389.320) (-388.874) (-390.084) -- 0:00:29
Average standard deviation of split frequencies: 0.010015
505500 -- [-387.947] (-386.352) (-387.734) (-388.424) * (-386.978) [-387.892] (-387.858) (-387.809) -- 0:00:29
506000 -- (-389.445) (-387.281) (-388.958) [-388.401] * (-388.292) (-388.160) [-387.306] (-387.135) -- 0:00:29
506500 -- (-390.116) (-391.428) (-392.425) [-391.204] * (-387.918) (-388.207) [-388.112] (-387.835) -- 0:00:29
507000 -- [-387.261] (-389.986) (-391.053) (-388.705) * (-388.906) (-393.776) (-386.574) [-389.148] -- 0:00:29
507500 -- (-386.709) [-390.689] (-392.182) (-389.331) * (-388.345) (-389.048) [-390.847] (-391.409) -- 0:00:29
508000 -- (-392.169) (-396.177) [-389.325] (-388.442) * [-390.434] (-393.546) (-387.615) (-389.709) -- 0:00:29
508500 -- (-386.785) (-388.212) (-391.395) [-387.132] * (-388.631) [-388.248] (-386.933) (-389.061) -- 0:00:28
509000 -- [-388.204] (-390.324) (-390.077) (-389.533) * [-389.441] (-387.888) (-387.665) (-387.213) -- 0:00:28
509500 -- [-386.719] (-386.711) (-390.399) (-392.479) * [-388.447] (-391.132) (-390.784) (-389.522) -- 0:00:28
510000 -- (-388.833) (-389.431) [-387.865] (-389.236) * (-387.202) (-388.198) (-395.832) [-388.237] -- 0:00:28
Average standard deviation of split frequencies: 0.010093
510500 -- [-390.597] (-389.270) (-387.247) (-387.212) * (-388.148) [-388.167] (-387.871) (-388.336) -- 0:00:28
511000 -- (-387.424) (-388.487) [-386.780] (-387.924) * (-388.855) (-388.564) (-390.040) [-389.775] -- 0:00:28
511500 -- (-388.490) (-387.877) (-389.414) [-389.334] * (-388.792) [-386.615] (-387.389) (-389.642) -- 0:00:28
512000 -- (-387.063) (-387.549) (-388.391) [-387.528] * (-386.815) [-387.455] (-390.215) (-388.256) -- 0:00:28
512500 -- (-387.618) (-389.154) [-388.345] (-391.356) * (-389.768) (-387.479) (-388.261) [-386.452] -- 0:00:28
513000 -- (-388.291) [-386.636] (-386.378) (-389.539) * (-387.390) (-388.381) (-392.737) [-386.437] -- 0:00:28
513500 -- (-388.418) (-388.163) [-387.063] (-391.728) * [-389.057] (-388.316) (-393.151) (-391.299) -- 0:00:28
514000 -- (-388.366) [-389.934] (-388.956) (-387.533) * (-388.180) [-388.001] (-388.429) (-393.379) -- 0:00:28
514500 -- [-387.838] (-387.307) (-387.835) (-388.096) * (-390.456) (-386.796) (-388.692) [-388.443] -- 0:00:28
515000 -- (-386.767) (-386.619) [-388.263] (-398.590) * (-386.699) (-387.997) (-390.770) [-390.402] -- 0:00:28
Average standard deviation of split frequencies: 0.010719
515500 -- (-387.644) (-388.700) (-387.373) [-389.201] * [-386.573] (-386.858) (-388.449) (-390.398) -- 0:00:28
516000 -- (-388.203) (-387.532) [-392.068] (-387.356) * (-389.082) (-387.061) [-390.698] (-391.556) -- 0:00:28
516500 -- (-387.685) (-388.275) [-387.526] (-389.508) * (-388.557) [-392.098] (-387.829) (-388.214) -- 0:00:28
517000 -- (-386.756) [-386.535] (-387.938) (-387.649) * [-386.946] (-388.623) (-387.432) (-392.821) -- 0:00:28
517500 -- (-388.582) (-386.574) [-395.655] (-388.324) * (-387.083) (-388.840) [-386.879] (-387.757) -- 0:00:27
518000 -- (-387.501) (-390.058) (-394.424) [-389.649] * (-388.277) (-393.888) (-389.498) [-388.664] -- 0:00:27
518500 -- (-386.877) (-389.818) (-388.593) [-386.695] * (-387.265) (-386.733) (-389.382) [-386.249] -- 0:00:27
519000 -- [-387.002] (-387.132) (-387.459) (-387.641) * (-388.206) [-391.776] (-389.576) (-386.776) -- 0:00:27
519500 -- [-391.815] (-386.382) (-387.763) (-388.858) * (-391.852) (-388.202) [-390.101] (-389.762) -- 0:00:27
520000 -- (-387.231) (-387.373) (-386.442) [-387.210] * (-393.331) (-387.040) [-389.329] (-388.436) -- 0:00:27
Average standard deviation of split frequencies: 0.010080
520500 -- (-388.255) [-386.296] (-389.717) (-386.685) * (-388.490) (-390.190) (-391.336) [-387.217] -- 0:00:28
521000 -- [-388.167] (-391.207) (-388.316) (-388.557) * [-386.691] (-387.762) (-390.060) (-387.884) -- 0:00:28
521500 -- (-389.614) (-389.595) [-390.589] (-387.790) * (-388.170) (-386.735) (-390.881) [-388.489] -- 0:00:28
522000 -- (-390.957) (-389.633) (-388.967) [-387.440] * (-387.854) [-387.477] (-388.791) (-387.100) -- 0:00:28
522500 -- (-388.441) (-392.239) (-387.575) [-387.748] * [-387.292] (-386.904) (-390.190) (-387.789) -- 0:00:28
523000 -- (-387.619) [-387.156] (-387.884) (-389.731) * [-390.355] (-386.675) (-387.724) (-388.642) -- 0:00:28
523500 -- [-387.477] (-391.098) (-387.642) (-388.706) * (-389.263) [-387.358] (-393.098) (-388.479) -- 0:00:28
524000 -- (-389.115) (-388.498) [-386.911] (-386.558) * (-387.659) (-389.302) [-386.200] (-389.795) -- 0:00:28
524500 -- (-389.548) (-387.936) (-387.522) [-389.162] * (-390.363) (-387.558) (-386.520) [-389.605] -- 0:00:28
525000 -- (-395.549) [-388.097] (-390.472) (-387.741) * (-387.946) (-391.129) (-386.819) [-386.781] -- 0:00:28
Average standard deviation of split frequencies: 0.010754
525500 -- [-390.610] (-390.004) (-386.966) (-390.201) * (-387.948) (-387.641) (-386.851) [-386.666] -- 0:00:27
526000 -- (-388.561) [-389.487] (-389.168) (-389.939) * (-387.700) (-387.455) (-386.486) [-386.767] -- 0:00:27
526500 -- [-388.599] (-388.235) (-389.490) (-389.587) * [-386.708] (-387.175) (-387.945) (-387.104) -- 0:00:27
527000 -- [-387.239] (-388.057) (-386.901) (-390.328) * (-389.848) (-389.193) (-393.429) [-392.579] -- 0:00:27
527500 -- (-387.796) [-387.687] (-389.658) (-388.959) * (-392.853) [-389.573] (-389.299) (-388.462) -- 0:00:27
528000 -- (-387.848) [-390.978] (-387.481) (-391.325) * (-390.214) (-390.538) (-396.320) [-393.260] -- 0:00:27
528500 -- (-388.450) (-392.617) (-391.711) [-386.990] * (-389.010) (-388.436) (-387.608) [-388.070] -- 0:00:27
529000 -- [-390.586] (-389.347) (-387.372) (-387.729) * (-387.371) (-387.230) (-391.406) [-387.410] -- 0:00:27
529500 -- (-387.089) [-388.456] (-387.879) (-387.593) * (-388.323) [-387.059] (-388.171) (-390.211) -- 0:00:27
530000 -- (-388.307) [-386.548] (-389.212) (-387.687) * [-387.426] (-388.229) (-388.034) (-389.676) -- 0:00:27
Average standard deviation of split frequencies: 0.010601
530500 -- (-387.699) (-387.236) (-391.141) [-386.324] * (-389.735) [-387.385] (-391.501) (-390.016) -- 0:00:27
531000 -- (-387.476) (-386.924) [-389.446] (-387.032) * (-386.805) (-393.645) (-386.115) [-392.401] -- 0:00:27
531500 -- (-386.714) (-386.888) [-392.021] (-390.738) * (-389.335) (-386.594) (-388.012) [-390.037] -- 0:00:27
532000 -- (-391.459) (-388.881) (-388.121) [-386.839] * [-390.312] (-388.866) (-388.854) (-389.017) -- 0:00:27
532500 -- (-388.250) (-388.069) (-388.195) [-389.971] * (-391.856) (-386.555) (-386.801) [-388.355] -- 0:00:27
533000 -- (-390.329) [-387.391] (-389.089) (-387.211) * (-387.019) (-389.182) [-387.435] (-391.558) -- 0:00:27
533500 -- (-387.056) (-389.851) (-390.163) [-388.403] * (-386.327) (-389.640) [-388.353] (-387.942) -- 0:00:27
534000 -- [-386.431] (-388.324) (-389.451) (-389.997) * [-386.622] (-389.141) (-389.211) (-390.575) -- 0:00:27
534500 -- (-386.379) (-388.455) (-390.388) [-388.720] * (-389.045) (-388.078) [-387.983] (-390.182) -- 0:00:26
535000 -- (-387.465) (-389.075) [-388.888] (-388.580) * (-391.595) (-388.009) (-387.164) [-388.365] -- 0:00:26
Average standard deviation of split frequencies: 0.010847
535500 -- [-395.323] (-392.919) (-388.124) (-389.651) * [-391.470] (-388.980) (-388.490) (-388.181) -- 0:00:26
536000 -- (-388.369) [-390.408] (-390.735) (-386.778) * (-390.234) (-389.009) [-389.849] (-389.153) -- 0:00:26
536500 -- (-386.952) (-390.676) [-388.777] (-388.234) * (-388.766) (-389.319) [-388.589] (-389.737) -- 0:00:26
537000 -- (-387.130) [-387.822] (-389.816) (-387.568) * (-389.144) [-387.835] (-387.153) (-387.337) -- 0:00:26
537500 -- (-388.113) [-388.968] (-389.696) (-389.613) * (-388.522) [-387.494] (-386.743) (-395.476) -- 0:00:27
538000 -- (-388.137) (-387.767) (-389.825) [-386.963] * [-387.480] (-387.622) (-390.445) (-389.533) -- 0:00:27
538500 -- (-387.351) [-387.827] (-390.387) (-389.946) * (-387.413) (-387.662) [-387.642] (-386.930) -- 0:00:27
539000 -- (-389.059) (-389.413) (-387.882) [-393.113] * (-387.691) (-389.128) [-387.098] (-387.921) -- 0:00:27
539500 -- [-388.551] (-388.703) (-388.833) (-387.831) * (-393.031) [-387.406] (-388.082) (-389.155) -- 0:00:27
540000 -- (-391.942) (-388.677) (-388.943) [-386.915] * (-387.323) (-388.699) (-387.933) [-390.132] -- 0:00:27
Average standard deviation of split frequencies: 0.010811
540500 -- [-386.857] (-387.408) (-389.477) (-387.080) * (-388.110) [-386.977] (-388.986) (-387.444) -- 0:00:27
541000 -- (-388.609) (-387.758) (-392.056) [-387.293] * (-389.428) (-390.368) (-387.880) [-387.343] -- 0:00:27
541500 -- (-387.014) [-387.895] (-388.892) (-390.392) * [-392.324] (-387.064) (-390.707) (-389.984) -- 0:00:27
542000 -- (-387.719) (-387.502) (-387.554) [-387.147] * (-388.045) (-390.169) [-387.952] (-387.418) -- 0:00:27
542500 -- (-387.812) [-387.557] (-386.824) (-394.213) * (-390.743) (-386.662) [-388.969] (-387.642) -- 0:00:26
543000 -- (-386.977) (-387.617) [-387.802] (-388.457) * [-386.498] (-390.977) (-388.462) (-388.707) -- 0:00:26
543500 -- (-389.408) [-387.197] (-389.679) (-388.994) * (-388.102) (-389.641) [-389.721] (-387.844) -- 0:00:26
544000 -- (-388.742) [-389.469] (-389.841) (-389.369) * (-389.546) (-388.611) [-389.757] (-387.430) -- 0:00:26
544500 -- (-387.884) (-389.534) (-390.745) [-389.016] * (-389.936) (-389.926) (-389.144) [-388.457] -- 0:00:26
545000 -- [-387.410] (-386.463) (-389.312) (-389.601) * [-386.359] (-388.312) (-388.519) (-386.277) -- 0:00:26
Average standard deviation of split frequencies: 0.011512
545500 -- (-391.830) [-387.798] (-386.747) (-389.810) * (-390.020) (-386.705) [-390.185] (-387.481) -- 0:00:26
546000 -- [-388.030] (-389.675) (-387.860) (-387.375) * (-390.666) (-387.186) [-388.442] (-386.978) -- 0:00:26
546500 -- (-390.552) (-388.445) (-391.640) [-390.296] * (-388.401) (-386.471) [-387.494] (-388.087) -- 0:00:26
547000 -- (-389.672) [-391.203] (-387.666) (-386.454) * (-387.185) [-386.901] (-390.295) (-386.798) -- 0:00:26
547500 -- (-388.284) (-389.483) [-387.768] (-386.972) * (-388.965) (-386.748) [-388.644] (-389.927) -- 0:00:26
548000 -- (-386.666) (-389.376) [-387.088] (-387.339) * (-388.157) [-387.856] (-387.752) (-392.271) -- 0:00:26
548500 -- [-387.015] (-387.757) (-388.928) (-387.233) * (-389.453) [-386.698] (-389.809) (-388.501) -- 0:00:26
549000 -- (-388.834) (-388.366) [-391.567] (-390.155) * [-387.796] (-392.079) (-387.776) (-389.096) -- 0:00:26
549500 -- (-388.949) (-386.893) (-387.915) [-387.540] * (-387.338) (-387.633) (-389.163) [-389.083] -- 0:00:26
550000 -- (-390.155) (-386.809) (-391.068) [-388.361] * (-388.456) [-388.279] (-387.700) (-389.199) -- 0:00:26
Average standard deviation of split frequencies: 0.011585
550500 -- (-388.636) [-386.566] (-390.970) (-389.825) * (-389.546) (-390.515) [-386.134] (-387.529) -- 0:00:26
551000 -- (-387.306) (-389.383) (-390.997) [-387.281] * (-387.805) (-392.255) (-391.125) [-389.895] -- 0:00:26
551500 -- (-388.988) (-387.025) [-392.535] (-389.083) * [-391.384] (-390.254) (-388.197) (-387.318) -- 0:00:26
552000 -- [-387.114] (-391.116) (-387.874) (-389.106) * (-386.758) (-388.431) (-388.073) [-386.618] -- 0:00:25
552500 -- [-388.148] (-388.620) (-387.174) (-389.854) * (-386.807) [-390.906] (-393.147) (-390.981) -- 0:00:25
553000 -- [-386.376] (-389.325) (-388.998) (-386.352) * [-386.377] (-396.340) (-387.233) (-387.224) -- 0:00:25
553500 -- (-389.939) [-387.844] (-392.747) (-388.060) * (-388.414) (-391.641) [-387.214] (-389.382) -- 0:00:25
554000 -- [-388.344] (-392.852) (-388.643) (-386.417) * (-386.869) (-393.367) [-389.120] (-387.818) -- 0:00:25
554500 -- (-389.056) (-389.664) (-387.491) [-389.788] * (-388.342) (-392.290) [-387.776] (-386.439) -- 0:00:25
555000 -- (-390.342) (-388.219) (-387.658) [-388.652] * (-392.137) [-391.696] (-387.359) (-386.495) -- 0:00:26
Average standard deviation of split frequencies: 0.010863
555500 -- [-388.739] (-388.089) (-386.702) (-388.243) * (-387.158) (-386.952) (-388.321) [-389.579] -- 0:00:26
556000 -- (-387.813) [-387.328] (-387.735) (-390.653) * (-387.253) (-391.563) (-389.471) [-391.181] -- 0:00:26
556500 -- (-392.118) [-388.255] (-387.821) (-390.687) * (-388.522) (-389.093) [-386.922] (-391.128) -- 0:00:26
557000 -- [-387.839] (-387.983) (-389.813) (-388.310) * (-391.294) (-390.582) [-390.955] (-391.991) -- 0:00:26
557500 -- [-389.792] (-387.423) (-388.427) (-386.752) * [-389.027] (-388.876) (-387.520) (-387.616) -- 0:00:26
558000 -- (-395.488) (-387.894) (-392.329) [-387.157] * (-395.788) [-388.680] (-386.868) (-388.158) -- 0:00:26
558500 -- (-387.064) (-388.281) [-387.954] (-386.497) * (-387.679) (-387.161) (-386.802) [-387.206] -- 0:00:26
559000 -- (-387.852) (-393.753) [-387.387] (-386.476) * (-393.931) (-387.927) (-388.133) [-390.353] -- 0:00:26
559500 -- (-392.804) (-390.592) [-387.303] (-389.120) * (-390.289) (-388.083) [-386.135] (-388.904) -- 0:00:25
560000 -- (-387.991) (-390.787) [-386.681] (-387.899) * (-386.298) [-387.841] (-389.331) (-387.743) -- 0:00:25
Average standard deviation of split frequencies: 0.011042
560500 -- (-388.984) (-391.278) (-389.672) [-386.557] * (-386.677) (-387.335) (-392.271) [-387.714] -- 0:00:25
561000 -- (-388.118) (-389.605) [-387.704] (-388.737) * [-387.420] (-390.499) (-388.902) (-387.800) -- 0:00:25
561500 -- (-387.805) (-387.544) (-389.906) [-388.660] * [-393.021] (-387.872) (-388.563) (-386.868) -- 0:00:25
562000 -- (-388.000) [-390.632] (-392.953) (-388.754) * (-392.990) (-391.052) [-389.813] (-389.720) -- 0:00:25
562500 -- (-386.650) (-388.283) [-387.193] (-387.019) * (-389.095) (-387.489) [-388.203] (-397.991) -- 0:00:25
563000 -- (-390.474) (-387.658) [-390.546] (-387.648) * (-386.641) (-388.669) (-387.926) [-396.114] -- 0:00:25
563500 -- [-389.176] (-387.887) (-390.127) (-387.289) * (-390.300) (-390.057) [-388.948] (-387.911) -- 0:00:25
564000 -- (-389.754) [-390.005] (-386.539) (-386.867) * [-388.246] (-389.323) (-391.226) (-387.346) -- 0:00:25
564500 -- (-390.152) [-389.237] (-387.970) (-388.685) * (-389.169) (-387.586) [-387.963] (-386.652) -- 0:00:25
565000 -- (-388.619) (-391.969) [-388.570] (-386.660) * (-388.066) [-389.031] (-389.099) (-386.979) -- 0:00:25
Average standard deviation of split frequencies: 0.010307
565500 -- (-387.989) (-392.428) (-386.412) [-389.417] * [-387.041] (-391.524) (-388.472) (-388.209) -- 0:00:25
566000 -- (-389.037) [-388.530] (-386.996) (-390.267) * (-386.827) (-390.774) (-386.874) [-387.990] -- 0:00:25
566500 -- (-386.823) (-388.001) [-389.992] (-392.507) * (-387.423) (-392.545) [-387.959] (-387.315) -- 0:00:25
567000 -- [-387.545] (-388.018) (-389.535) (-397.904) * [-387.031] (-391.281) (-391.861) (-390.062) -- 0:00:25
567500 -- (-389.836) [-388.721] (-387.044) (-388.153) * (-387.670) (-392.000) [-388.338] (-389.458) -- 0:00:25
568000 -- (-387.672) [-387.519] (-388.194) (-388.373) * (-387.130) (-390.957) [-387.424] (-387.370) -- 0:00:25
568500 -- [-390.265] (-387.030) (-394.249) (-389.244) * (-389.557) (-387.893) (-386.756) [-387.352] -- 0:00:25
569000 -- (-388.181) (-389.320) (-394.636) [-388.639] * (-389.791) [-388.294] (-388.582) (-388.094) -- 0:00:24
569500 -- [-387.509] (-388.102) (-391.701) (-390.261) * (-389.439) [-389.457] (-388.591) (-390.103) -- 0:00:24
570000 -- (-386.954) (-387.379) (-387.202) [-389.249] * (-389.324) (-388.260) (-388.776) [-388.861] -- 0:00:24
Average standard deviation of split frequencies: 0.010377
570500 -- [-388.309] (-388.547) (-388.347) (-387.833) * (-388.745) [-387.208] (-393.661) (-387.306) -- 0:00:24
571000 -- (-387.931) [-387.395] (-390.094) (-387.678) * (-390.066) [-391.497] (-390.761) (-387.871) -- 0:00:24
571500 -- [-386.159] (-386.609) (-386.672) (-388.030) * [-387.869] (-388.414) (-391.306) (-389.612) -- 0:00:24
572000 -- [-386.912] (-387.253) (-387.373) (-390.288) * (-388.037) (-390.351) (-389.963) [-387.422] -- 0:00:25
572500 -- (-389.624) [-390.378] (-387.124) (-387.796) * [-387.839] (-386.474) (-392.440) (-388.502) -- 0:00:25
573000 -- [-387.425] (-387.035) (-387.327) (-388.830) * [-386.617] (-386.688) (-389.802) (-389.843) -- 0:00:25
573500 -- [-386.436] (-389.332) (-388.793) (-387.716) * (-386.635) (-386.528) [-389.348] (-386.957) -- 0:00:25
574000 -- [-386.321] (-387.355) (-389.130) (-391.850) * (-389.627) (-387.003) [-386.711] (-387.594) -- 0:00:25
574500 -- (-390.378) (-386.291) (-387.842) [-390.988] * (-388.896) [-388.658] (-387.418) (-388.625) -- 0:00:25
575000 -- (-387.666) [-387.496] (-390.665) (-388.993) * (-387.862) (-387.444) [-387.988] (-387.154) -- 0:00:25
Average standard deviation of split frequencies: 0.011021
575500 -- (-387.222) (-387.146) (-389.128) [-389.212] * (-388.248) [-388.734] (-388.343) (-389.381) -- 0:00:25
576000 -- (-388.257) (-389.646) [-389.204] (-387.215) * (-386.459) (-388.096) (-391.525) [-388.839] -- 0:00:25
576500 -- [-387.007] (-387.011) (-390.261) (-386.653) * [-387.287] (-389.643) (-394.196) (-388.499) -- 0:00:24
577000 -- [-391.127] (-386.617) (-387.385) (-387.689) * (-390.368) [-389.118] (-389.364) (-387.182) -- 0:00:24
577500 -- (-395.091) [-390.292] (-386.631) (-389.080) * (-389.485) (-387.787) (-388.197) [-387.543] -- 0:00:24
578000 -- (-391.004) (-391.412) (-387.577) [-388.237] * (-391.092) (-388.275) (-390.115) [-386.837] -- 0:00:24
578500 -- [-388.107] (-388.825) (-389.315) (-392.415) * (-387.609) (-388.373) (-388.326) [-387.898] -- 0:00:24
579000 -- (-391.822) [-389.650] (-389.263) (-390.750) * (-387.678) [-387.654] (-389.201) (-389.391) -- 0:00:24
579500 -- (-387.463) (-388.655) [-389.511] (-386.303) * (-387.153) (-398.079) (-389.016) [-390.283] -- 0:00:24
580000 -- (-388.960) (-390.929) (-389.084) [-387.268] * (-390.405) (-391.724) (-391.625) [-388.753] -- 0:00:24
Average standard deviation of split frequencies: 0.012232
580500 -- (-388.747) [-388.332] (-387.907) (-386.434) * (-390.402) [-386.331] (-388.474) (-386.300) -- 0:00:24
581000 -- (-390.862) [-389.260] (-390.419) (-386.867) * (-390.548) (-388.948) (-386.228) [-387.821] -- 0:00:24
581500 -- [-389.044] (-389.274) (-393.115) (-389.738) * (-390.594) (-386.936) [-388.978] (-387.488) -- 0:00:24
582000 -- [-388.717] (-387.937) (-388.277) (-391.176) * [-387.462] (-388.192) (-391.001) (-388.922) -- 0:00:24
582500 -- [-387.565] (-386.839) (-388.939) (-387.805) * (-386.459) (-390.444) [-388.698] (-386.653) -- 0:00:24
583000 -- [-390.753] (-387.538) (-388.081) (-389.294) * (-387.298) (-392.231) [-388.077] (-388.678) -- 0:00:24
583500 -- (-387.702) [-386.418] (-387.449) (-386.818) * (-387.055) (-387.639) (-388.479) [-388.471] -- 0:00:24
584000 -- (-391.697) (-389.081) (-387.417) [-387.326] * [-387.905] (-386.290) (-387.253) (-388.998) -- 0:00:24
584500 -- (-397.668) (-390.277) [-389.607] (-388.748) * (-387.374) (-388.227) [-387.021] (-388.557) -- 0:00:24
585000 -- (-389.416) (-388.356) [-390.354] (-390.935) * (-388.769) (-387.842) [-388.361] (-388.382) -- 0:00:24
Average standard deviation of split frequencies: 0.013032
585500 -- (-387.553) (-388.265) (-387.938) [-392.404] * [-390.664] (-389.696) (-387.416) (-389.832) -- 0:00:24
586000 -- (-388.373) (-389.946) [-388.558] (-389.348) * (-388.187) [-387.493] (-386.465) (-391.102) -- 0:00:24
586500 -- (-391.193) [-388.176] (-389.717) (-386.544) * (-386.448) (-389.659) (-391.018) [-387.348] -- 0:00:23
587000 -- [-387.032] (-388.297) (-387.748) (-390.935) * (-386.742) [-387.940] (-388.858) (-386.683) -- 0:00:23
587500 -- (-389.765) [-387.390] (-390.298) (-387.166) * (-390.803) (-394.168) (-394.208) [-388.106] -- 0:00:23
588000 -- (-392.327) (-390.239) (-386.590) [-388.838] * (-387.911) (-391.967) (-388.191) [-387.556] -- 0:00:23
588500 -- (-387.044) (-386.498) (-387.365) [-387.610] * (-388.181) (-393.031) (-387.504) [-387.038] -- 0:00:23
589000 -- (-388.353) (-389.976) (-391.168) [-387.448] * (-386.906) (-387.472) [-388.055] (-390.171) -- 0:00:23
589500 -- (-386.887) (-387.868) (-389.006) [-389.858] * (-387.551) (-388.817) (-387.456) [-389.982] -- 0:00:24
590000 -- (-388.879) (-387.532) [-389.270] (-387.252) * (-388.026) [-388.970] (-389.431) (-389.583) -- 0:00:24
Average standard deviation of split frequencies: 0.012610
590500 -- [-392.263] (-387.295) (-386.928) (-388.125) * (-389.518) (-391.120) [-390.870] (-388.536) -- 0:00:24
591000 -- (-391.754) (-391.805) [-388.883] (-391.260) * (-390.546) (-387.858) [-387.465] (-388.015) -- 0:00:24
591500 -- [-386.691] (-387.918) (-390.108) (-387.186) * (-393.470) (-397.834) [-387.324] (-389.622) -- 0:00:24
592000 -- (-388.505) (-387.289) [-386.954] (-386.755) * [-388.679] (-392.496) (-393.157) (-390.599) -- 0:00:24
592500 -- (-390.603) (-389.398) (-387.558) [-388.073] * (-386.892) (-387.856) (-386.430) [-390.979] -- 0:00:24
593000 -- [-387.229] (-389.952) (-391.714) (-387.820) * (-387.498) [-387.847] (-387.947) (-389.150) -- 0:00:24
593500 -- (-388.755) (-386.983) [-387.093] (-389.476) * (-389.347) (-387.947) (-388.765) [-390.463] -- 0:00:23
594000 -- (-388.447) (-389.904) [-386.492] (-390.254) * (-388.420) [-387.080] (-389.541) (-388.252) -- 0:00:23
594500 -- (-393.776) (-388.202) (-389.710) [-390.528] * (-386.994) (-386.542) (-387.995) [-390.382] -- 0:00:23
595000 -- (-391.483) [-387.220] (-388.383) (-392.738) * (-389.753) (-387.115) (-386.860) [-389.206] -- 0:00:23
Average standard deviation of split frequencies: 0.012919
595500 -- (-387.611) [-388.073] (-391.625) (-388.324) * [-387.183] (-387.677) (-388.922) (-390.318) -- 0:00:23
596000 -- [-388.077] (-390.255) (-388.190) (-390.886) * (-386.907) [-387.084] (-388.887) (-388.987) -- 0:00:23
596500 -- (-387.155) [-387.746] (-392.208) (-389.570) * (-390.498) (-387.312) (-387.313) [-386.690] -- 0:00:23
597000 -- (-389.105) (-387.566) (-389.382) [-387.470] * (-387.341) (-388.948) [-389.588] (-388.260) -- 0:00:23
597500 -- (-388.145) (-387.481) (-387.397) [-387.431] * (-387.855) (-389.192) (-387.259) [-388.776] -- 0:00:23
598000 -- (-387.413) (-387.387) (-387.815) [-388.097] * (-390.455) [-388.603] (-387.497) (-391.625) -- 0:00:23
598500 -- (-387.347) (-387.860) [-387.839] (-387.984) * (-392.800) (-390.382) [-386.578] (-387.039) -- 0:00:23
599000 -- (-389.841) [-386.441] (-386.931) (-387.296) * (-391.987) [-386.917] (-392.367) (-387.384) -- 0:00:23
599500 -- (-387.181) (-386.609) [-387.310] (-387.293) * (-388.621) (-387.430) [-389.936] (-388.639) -- 0:00:23
600000 -- (-388.918) (-388.613) (-390.712) [-386.598] * (-391.679) (-392.584) (-389.134) [-390.132] -- 0:00:23
Average standard deviation of split frequencies: 0.012086
600500 -- [-395.406] (-391.509) (-392.956) (-391.856) * [-387.081] (-390.582) (-391.506) (-388.300) -- 0:00:23
601000 -- (-391.415) (-388.619) (-388.711) [-389.728] * [-386.448] (-388.968) (-389.157) (-391.977) -- 0:00:23
601500 -- (-391.208) [-386.273] (-392.849) (-389.683) * [-387.120] (-387.982) (-386.545) (-390.103) -- 0:00:23
602000 -- (-388.429) [-387.130] (-387.729) (-389.532) * (-386.487) (-388.640) [-387.113] (-388.192) -- 0:00:23
602500 -- (-386.416) (-392.284) (-386.711) [-390.316] * (-389.511) [-387.230] (-387.972) (-386.825) -- 0:00:23
603000 -- (-388.244) (-389.052) [-387.692] (-388.214) * (-390.146) (-388.208) [-387.054] (-389.816) -- 0:00:23
603500 -- (-389.498) [-391.731] (-388.826) (-387.593) * (-387.369) (-387.376) (-388.845) [-386.728] -- 0:00:22
604000 -- (-391.024) [-387.393] (-392.008) (-388.831) * [-386.432] (-389.347) (-388.563) (-386.669) -- 0:00:22
604500 -- (-395.188) (-386.725) (-386.974) [-388.241] * (-386.814) (-394.243) [-386.597] (-390.444) -- 0:00:22
605000 -- (-388.261) (-389.086) (-388.571) [-389.832] * (-391.356) (-389.427) (-386.852) [-389.428] -- 0:00:22
Average standard deviation of split frequencies: 0.011772
605500 -- (-393.392) (-389.019) [-390.154] (-392.021) * (-390.051) (-387.328) [-387.032] (-387.956) -- 0:00:22
606000 -- (-390.843) (-387.298) (-388.166) [-388.368] * [-387.204] (-387.191) (-388.086) (-388.326) -- 0:00:22
606500 -- (-389.221) (-389.227) (-387.226) [-388.216] * (-387.580) [-387.047] (-387.291) (-386.840) -- 0:00:23
607000 -- (-388.846) (-388.649) (-387.803) [-386.525] * [-388.719] (-392.381) (-386.928) (-389.199) -- 0:00:23
607500 -- (-388.592) (-387.241) [-388.447] (-390.979) * [-388.826] (-388.922) (-392.041) (-387.355) -- 0:00:23
608000 -- [-388.743] (-387.766) (-388.938) (-396.455) * (-386.644) [-390.432] (-387.199) (-389.007) -- 0:00:23
608500 -- (-390.114) (-388.272) [-386.679] (-388.263) * (-388.569) [-388.117] (-387.170) (-388.264) -- 0:00:23
609000 -- [-388.013] (-389.095) (-388.496) (-391.152) * (-390.000) [-389.575] (-389.603) (-387.715) -- 0:00:23
609500 -- (-389.913) (-391.669) [-390.799] (-387.427) * (-390.386) (-388.307) (-391.213) [-387.362] -- 0:00:23
610000 -- (-387.498) (-387.422) [-387.396] (-388.415) * [-389.626] (-387.270) (-387.101) (-388.977) -- 0:00:23
Average standard deviation of split frequencies: 0.011940
610500 -- (-387.143) (-387.285) (-387.291) [-389.367] * (-390.730) (-387.358) (-390.101) [-387.536] -- 0:00:22
611000 -- [-387.134] (-388.455) (-388.678) (-387.922) * (-389.710) (-386.652) [-387.207] (-390.102) -- 0:00:22
611500 -- (-387.396) [-388.389] (-389.601) (-389.919) * (-388.987) (-386.512) [-388.938] (-387.408) -- 0:00:22
612000 -- (-389.165) [-388.241] (-390.251) (-391.201) * (-388.200) (-391.469) (-388.772) [-390.201] -- 0:00:22
612500 -- [-389.902] (-387.879) (-389.215) (-388.426) * (-391.734) (-390.069) [-387.513] (-387.875) -- 0:00:22
613000 -- (-388.127) (-392.213) [-389.065] (-391.724) * (-387.531) (-388.451) [-386.865] (-389.040) -- 0:00:22
613500 -- (-387.505) (-390.692) [-387.089] (-387.889) * [-392.624] (-390.007) (-388.515) (-388.752) -- 0:00:22
614000 -- (-389.508) (-388.475) (-389.431) [-387.453] * (-389.004) (-387.249) (-392.956) [-388.234] -- 0:00:22
614500 -- [-393.058] (-386.936) (-386.933) (-392.178) * (-387.771) (-390.730) [-391.142] (-387.565) -- 0:00:22
615000 -- (-387.106) (-386.672) [-386.781] (-388.752) * [-387.896] (-389.553) (-390.398) (-393.040) -- 0:00:22
Average standard deviation of split frequencies: 0.012244
615500 -- (-387.381) (-388.078) [-386.881] (-389.103) * (-387.947) [-387.343] (-392.555) (-389.990) -- 0:00:22
616000 -- (-388.896) [-390.363] (-389.890) (-386.525) * (-388.023) (-389.313) (-390.714) [-387.187] -- 0:00:22
616500 -- (-394.762) [-387.592] (-386.596) (-388.884) * (-388.954) (-393.178) [-389.058] (-387.395) -- 0:00:22
617000 -- (-387.915) (-386.239) (-393.279) [-388.126] * (-391.099) (-390.432) (-395.972) [-386.856] -- 0:00:22
617500 -- (-387.309) (-391.523) (-388.747) [-390.901] * (-387.829) (-388.331) [-387.930] (-387.637) -- 0:00:22
618000 -- (-389.723) (-392.568) (-387.087) [-389.631] * (-388.362) [-390.772] (-387.924) (-386.236) -- 0:00:22
618500 -- (-391.793) [-390.076] (-387.364) (-394.029) * [-387.329] (-388.950) (-387.112) (-386.479) -- 0:00:22
619000 -- (-387.709) (-387.988) (-386.965) [-392.556] * (-389.176) [-387.452] (-390.536) (-387.980) -- 0:00:22
619500 -- (-386.907) (-388.413) (-386.854) [-387.273] * (-388.775) (-390.391) (-389.976) [-387.050] -- 0:00:22
620000 -- (-386.685) (-386.863) [-386.905] (-387.615) * (-388.202) (-391.459) (-388.121) [-386.454] -- 0:00:22
Average standard deviation of split frequencies: 0.012405
620500 -- [-387.705] (-386.708) (-395.036) (-388.675) * (-387.476) [-387.265] (-387.410) (-386.801) -- 0:00:22
621000 -- (-388.714) [-386.921] (-387.321) (-391.756) * (-387.694) (-388.327) [-386.707] (-387.707) -- 0:00:21
621500 -- (-388.801) (-388.372) (-387.714) [-388.689] * [-386.968] (-388.487) (-387.846) (-388.456) -- 0:00:21
622000 -- (-388.336) (-387.522) (-387.838) [-387.326] * [-389.040] (-387.329) (-387.506) (-390.867) -- 0:00:21
622500 -- (-388.275) (-387.877) (-388.584) [-388.517] * (-388.863) (-389.506) (-391.656) [-387.192] -- 0:00:21
623000 -- [-386.556] (-386.909) (-387.460) (-389.414) * (-386.994) [-387.537] (-389.329) (-387.190) -- 0:00:21
623500 -- (-387.158) [-388.253] (-387.763) (-386.643) * (-387.903) (-387.147) (-386.413) [-389.521] -- 0:00:22
624000 -- (-389.851) [-386.913] (-387.385) (-389.700) * [-387.396] (-391.203) (-388.218) (-387.334) -- 0:00:22
624500 -- [-387.189] (-390.048) (-387.023) (-387.805) * [-386.989] (-387.705) (-391.741) (-394.537) -- 0:00:22
625000 -- (-388.213) (-389.549) [-390.596] (-392.179) * (-388.386) [-386.553] (-389.689) (-391.322) -- 0:00:22
Average standard deviation of split frequencies: 0.012651
625500 -- [-387.302] (-388.661) (-389.983) (-389.633) * (-388.233) (-392.855) [-388.338] (-386.231) -- 0:00:22
626000 -- [-389.853] (-388.102) (-392.561) (-390.323) * (-386.806) (-390.852) [-387.693] (-386.976) -- 0:00:22
626500 -- (-389.467) (-388.789) (-390.370) [-391.623] * (-388.518) (-388.721) [-387.567] (-388.562) -- 0:00:22
627000 -- (-388.920) [-388.683] (-387.150) (-393.436) * (-386.538) (-389.202) (-386.962) [-390.638] -- 0:00:22
627500 -- [-389.949] (-388.289) (-393.226) (-387.550) * (-387.217) [-387.445] (-387.702) (-389.653) -- 0:00:21
628000 -- (-393.670) (-388.271) [-386.910] (-386.552) * (-387.088) (-391.784) [-387.136] (-388.834) -- 0:00:21
628500 -- [-387.705] (-386.346) (-387.022) (-387.108) * (-389.226) [-392.860] (-386.960) (-388.975) -- 0:00:21
629000 -- (-386.498) (-387.995) (-387.340) [-387.149] * (-388.860) (-387.673) [-387.592] (-388.928) -- 0:00:21
629500 -- [-386.710] (-390.030) (-388.126) (-391.083) * [-388.046] (-388.112) (-388.971) (-388.985) -- 0:00:21
630000 -- [-388.081] (-387.735) (-388.664) (-386.359) * (-388.835) (-386.579) [-387.767] (-387.732) -- 0:00:21
Average standard deviation of split frequencies: 0.011910
630500 -- (-388.824) [-387.752] (-386.412) (-389.888) * (-386.642) (-387.577) (-386.462) [-387.171] -- 0:00:21
631000 -- (-387.364) (-388.681) [-388.251] (-389.774) * (-386.409) (-388.196) (-389.154) [-386.406] -- 0:00:21
631500 -- (-387.071) (-391.357) (-390.902) [-386.859] * [-387.952] (-389.867) (-390.334) (-388.872) -- 0:00:21
632000 -- (-388.941) (-388.926) (-388.634) [-387.157] * [-391.521] (-391.720) (-388.384) (-387.261) -- 0:00:21
632500 -- [-388.044] (-388.296) (-386.937) (-390.918) * [-387.095] (-389.500) (-387.118) (-387.796) -- 0:00:21
633000 -- [-386.526] (-387.049) (-387.654) (-392.407) * (-394.261) (-388.096) [-387.171] (-395.162) -- 0:00:21
633500 -- (-390.416) (-388.176) [-388.256] (-389.589) * (-391.494) (-392.617) [-386.705] (-394.928) -- 0:00:21
634000 -- (-391.278) (-388.083) (-389.005) [-387.209] * (-398.243) [-386.963] (-388.349) (-389.181) -- 0:00:21
634500 -- [-388.699] (-389.662) (-389.994) (-387.699) * (-390.946) (-388.946) (-387.967) [-388.979] -- 0:00:21
635000 -- (-387.471) [-387.138] (-388.047) (-386.799) * (-392.636) [-389.271] (-387.389) (-386.904) -- 0:00:21
Average standard deviation of split frequencies: 0.012106
635500 -- (-388.068) [-388.114] (-386.341) (-387.128) * (-391.464) (-391.402) [-388.679] (-387.404) -- 0:00:21
636000 -- (-386.692) (-389.903) (-387.374) [-388.609] * (-390.562) (-388.616) [-389.201] (-388.755) -- 0:00:21
636500 -- (-386.528) (-389.815) (-387.800) [-388.012] * (-388.692) [-388.936] (-387.407) (-388.295) -- 0:00:21
637000 -- (-391.144) [-387.635] (-387.816) (-389.967) * (-391.150) (-388.113) [-386.804] (-390.079) -- 0:00:21
637500 -- (-387.864) [-387.799] (-387.605) (-386.911) * (-392.700) [-388.412] (-388.356) (-387.333) -- 0:00:21
638000 -- (-389.821) [-389.692] (-389.632) (-386.425) * (-388.308) (-388.782) [-387.318] (-387.580) -- 0:00:20
638500 -- (-390.926) [-387.365] (-392.764) (-388.084) * (-389.070) [-392.474] (-387.132) (-392.094) -- 0:00:20
639000 -- (-388.870) [-386.578] (-389.020) (-388.491) * (-392.296) (-389.981) (-389.201) [-390.198] -- 0:00:20
639500 -- (-388.281) (-387.679) (-391.025) [-390.017] * (-389.719) [-388.064] (-391.239) (-389.417) -- 0:00:20
640000 -- (-390.889) [-389.367] (-389.471) (-390.643) * (-388.352) (-389.986) (-389.970) [-386.837] -- 0:00:20
Average standard deviation of split frequencies: 0.012361
640500 -- (-390.962) (-390.466) (-389.718) [-387.132] * (-386.989) (-388.765) (-391.908) [-388.544] -- 0:00:21
641000 -- (-386.588) (-388.707) [-390.572] (-392.522) * (-389.444) (-387.377) (-388.153) [-390.101] -- 0:00:21
641500 -- [-387.605] (-387.772) (-387.281) (-390.720) * (-391.355) (-387.278) [-389.000] (-390.117) -- 0:00:21
642000 -- [-390.433] (-391.906) (-391.078) (-389.417) * (-392.247) [-390.546] (-390.657) (-387.511) -- 0:00:21
642500 -- (-386.934) [-389.933] (-392.065) (-388.234) * (-387.327) (-390.395) (-388.640) [-387.359] -- 0:00:21
643000 -- (-392.060) (-390.391) [-386.375] (-393.602) * [-387.921] (-389.242) (-386.718) (-387.156) -- 0:00:21
643500 -- (-392.377) [-387.119] (-386.852) (-389.314) * (-389.143) (-387.942) [-388.992] (-389.373) -- 0:00:21
644000 -- [-391.490] (-390.209) (-387.464) (-391.532) * (-396.108) (-390.812) [-388.145] (-392.584) -- 0:00:21
644500 -- (-388.984) (-388.495) [-388.532] (-389.291) * (-391.337) (-392.306) (-393.612) [-389.434] -- 0:00:20
645000 -- (-389.456) (-390.343) (-390.881) [-387.585] * (-388.255) (-388.995) (-386.998) [-392.736] -- 0:00:20
Average standard deviation of split frequencies: 0.012065
645500 -- [-389.660] (-387.687) (-391.606) (-386.501) * [-388.855] (-387.498) (-388.202) (-387.225) -- 0:00:20
646000 -- (-389.761) [-390.397] (-387.864) (-387.421) * (-392.085) (-388.405) (-387.233) [-386.347] -- 0:00:20
646500 -- (-388.954) (-387.588) (-388.337) [-388.656] * (-392.042) [-387.293] (-391.194) (-388.109) -- 0:00:20
647000 -- (-386.501) (-390.316) [-386.704] (-389.732) * (-391.568) (-387.965) [-389.496] (-388.787) -- 0:00:20
647500 -- (-386.472) (-391.324) [-387.459] (-386.158) * [-389.168] (-389.473) (-390.766) (-388.887) -- 0:00:20
648000 -- (-391.523) [-391.199] (-387.557) (-387.240) * (-389.353) (-387.596) (-390.893) [-386.748] -- 0:00:20
648500 -- (-388.386) (-389.181) [-388.533] (-386.935) * (-394.080) (-388.082) [-387.531] (-387.722) -- 0:00:20
649000 -- (-387.667) [-388.724] (-388.777) (-386.572) * (-392.288) (-390.449) [-387.519] (-390.554) -- 0:00:20
649500 -- (-388.976) (-386.980) (-390.586) [-388.837] * (-388.042) [-387.282] (-391.233) (-387.576) -- 0:00:20
650000 -- (-387.807) (-388.985) (-391.019) [-389.371] * (-387.389) (-391.651) [-388.779] (-387.496) -- 0:00:20
Average standard deviation of split frequencies: 0.011495
650500 -- (-387.564) (-388.199) [-389.498] (-386.950) * [-389.719] (-390.954) (-388.426) (-389.595) -- 0:00:20
651000 -- (-389.795) [-388.231] (-392.595) (-388.718) * (-389.526) (-388.792) (-391.232) [-387.642] -- 0:00:20
651500 -- (-386.287) [-388.360] (-389.262) (-388.227) * (-387.102) (-388.278) [-388.083] (-388.525) -- 0:00:20
652000 -- (-387.696) (-387.665) (-387.199) [-388.427] * [-390.319] (-388.160) (-391.772) (-387.089) -- 0:00:20
652500 -- (-388.866) (-388.059) [-388.051] (-388.420) * (-388.143) (-388.543) [-388.101] (-388.840) -- 0:00:20
653000 -- [-390.915] (-386.756) (-387.681) (-389.009) * (-392.460) (-388.727) (-386.731) [-387.896] -- 0:00:20
653500 -- (-389.586) [-388.899] (-386.879) (-390.220) * [-390.021] (-394.656) (-387.242) (-387.730) -- 0:00:20
654000 -- (-389.023) [-387.598] (-388.609) (-392.015) * [-387.984] (-388.062) (-388.115) (-388.929) -- 0:00:20
654500 -- [-388.747] (-389.675) (-389.466) (-387.940) * (-388.262) (-386.410) (-386.798) [-387.695] -- 0:00:20
655000 -- (-389.119) (-388.239) (-387.560) [-386.732] * (-388.918) (-387.263) [-388.324] (-388.636) -- 0:00:20
Average standard deviation of split frequencies: 0.011593
655500 -- (-387.384) [-386.324] (-389.146) (-389.179) * (-388.469) [-387.158] (-389.353) (-388.053) -- 0:00:19
656000 -- [-388.062] (-393.335) (-388.010) (-387.686) * (-386.280) (-389.752) [-387.076] (-390.087) -- 0:00:19
656500 -- (-390.504) (-388.241) (-387.185) [-387.588] * (-388.916) (-388.923) [-388.984] (-389.568) -- 0:00:19
657000 -- [-387.887] (-387.795) (-389.026) (-390.230) * (-386.660) [-387.070] (-392.196) (-387.737) -- 0:00:19
657500 -- (-387.963) (-387.075) [-386.597] (-392.848) * (-390.627) (-390.352) [-387.939] (-386.075) -- 0:00:20
658000 -- (-387.475) (-388.434) [-386.407] (-388.916) * [-390.052] (-395.000) (-386.851) (-386.499) -- 0:00:20
658500 -- (-388.791) (-388.162) (-386.443) [-388.424] * [-388.064] (-388.200) (-387.159) (-387.025) -- 0:00:20
659000 -- (-391.576) [-388.068] (-388.953) (-387.913) * [-389.224] (-389.532) (-387.851) (-390.126) -- 0:00:20
659500 -- (-387.217) [-387.954] (-388.315) (-388.067) * [-387.512] (-388.584) (-387.361) (-386.677) -- 0:00:20
660000 -- (-389.989) (-387.660) [-388.242] (-386.812) * [-387.358] (-388.163) (-388.181) (-387.647) -- 0:00:20
Average standard deviation of split frequencies: 0.011321
660500 -- (-387.606) (-386.759) [-389.445] (-389.787) * (-387.023) (-388.127) (-386.898) [-387.263] -- 0:00:20
661000 -- (-391.759) (-387.020) (-387.906) [-386.400] * (-386.389) [-390.527] (-387.238) (-387.886) -- 0:00:20
661500 -- (-387.272) [-387.585] (-392.326) (-388.188) * (-393.604) (-387.335) [-388.557] (-387.601) -- 0:00:19
662000 -- (-387.450) [-387.881] (-389.036) (-387.731) * (-391.335) (-388.039) [-388.859] (-386.790) -- 0:00:19
662500 -- (-388.441) (-391.668) [-388.224] (-387.647) * (-388.739) (-387.407) (-389.138) [-388.930] -- 0:00:19
663000 -- (-387.428) [-392.530] (-387.231) (-388.396) * (-388.507) (-388.271) (-389.687) [-388.680] -- 0:00:19
663500 -- (-387.393) [-388.317] (-387.345) (-389.745) * (-387.332) [-389.718] (-386.561) (-389.415) -- 0:00:19
664000 -- (-389.794) (-391.202) [-388.206] (-389.118) * [-386.795] (-390.398) (-391.146) (-389.357) -- 0:00:19
664500 -- (-388.333) (-386.353) [-388.379] (-390.881) * (-386.281) (-390.544) [-387.827] (-395.544) -- 0:00:19
665000 -- [-390.865] (-389.262) (-388.294) (-391.220) * (-387.794) (-387.068) (-392.592) [-391.233] -- 0:00:19
Average standard deviation of split frequencies: 0.011561
665500 -- [-386.936] (-387.771) (-387.218) (-387.877) * (-388.140) [-389.129] (-395.393) (-391.987) -- 0:00:19
666000 -- (-387.469) (-387.210) (-387.976) [-386.935] * [-390.927] (-387.662) (-391.462) (-389.116) -- 0:00:19
666500 -- (-387.196) (-388.419) (-389.868) [-391.010] * [-388.728] (-390.579) (-391.628) (-387.162) -- 0:00:19
667000 -- (-387.795) (-388.167) (-392.343) [-391.607] * [-388.412] (-390.637) (-391.503) (-387.580) -- 0:00:19
667500 -- (-388.014) [-386.763] (-387.845) (-388.633) * (-388.403) (-387.347) [-388.207] (-389.488) -- 0:00:19
668000 -- [-387.407] (-390.445) (-390.537) (-388.407) * [-389.358] (-387.312) (-389.597) (-388.509) -- 0:00:19
668500 -- [-388.607] (-388.116) (-391.663) (-388.360) * (-388.126) (-388.232) [-389.134] (-389.675) -- 0:00:19
669000 -- [-386.525] (-389.129) (-388.402) (-389.193) * (-390.637) [-388.417] (-388.227) (-394.197) -- 0:00:19
669500 -- (-386.902) (-388.368) (-388.624) [-386.800] * (-386.982) (-391.317) (-388.561) [-387.034] -- 0:00:19
670000 -- (-387.453) (-389.065) [-386.708] (-388.142) * (-388.779) (-395.115) (-389.136) [-386.962] -- 0:00:19
Average standard deviation of split frequencies: 0.011481
670500 -- (-389.906) (-388.274) (-386.747) [-388.526] * (-389.075) (-390.730) [-390.664] (-388.016) -- 0:00:19
671000 -- (-387.619) (-388.785) [-387.182] (-387.471) * (-389.043) [-388.773] (-390.333) (-387.329) -- 0:00:19
671500 -- [-391.573] (-387.003) (-391.301) (-386.983) * (-389.444) [-391.743] (-392.763) (-390.671) -- 0:00:19
672000 -- (-390.091) (-386.675) [-386.528] (-388.401) * [-387.057] (-388.978) (-390.675) (-391.163) -- 0:00:19
672500 -- (-388.590) (-386.497) (-388.933) [-388.946] * (-386.968) (-390.470) (-391.522) [-390.621] -- 0:00:18
673000 -- [-389.943] (-389.860) (-394.372) (-389.541) * (-389.497) (-388.008) (-391.520) [-388.430] -- 0:00:18
673500 -- (-386.484) (-388.565) [-388.184] (-391.817) * (-390.669) (-389.047) [-386.650] (-387.151) -- 0:00:18
674000 -- (-387.524) (-387.380) (-386.833) [-391.194] * (-387.488) [-388.322] (-390.655) (-389.291) -- 0:00:18
674500 -- (-390.794) (-389.048) [-386.889] (-388.346) * (-389.108) (-388.351) (-386.956) [-388.203] -- 0:00:18
675000 -- (-388.559) (-390.867) (-391.626) [-389.513] * (-392.784) [-392.164] (-388.084) (-388.002) -- 0:00:19
Average standard deviation of split frequencies: 0.011622
675500 -- (-388.711) [-386.969] (-389.824) (-387.864) * (-392.476) (-387.807) [-387.125] (-387.536) -- 0:00:19
676000 -- (-387.533) [-388.364] (-389.080) (-386.421) * (-393.087) (-388.368) [-386.952] (-387.048) -- 0:00:19
676500 -- (-387.041) (-387.391) [-388.773] (-389.466) * (-389.555) (-389.820) [-387.710] (-388.792) -- 0:00:19
677000 -- (-386.754) (-388.012) [-388.958] (-389.866) * (-387.057) [-388.070] (-390.489) (-390.281) -- 0:00:19
677500 -- (-386.609) [-386.944] (-388.662) (-389.873) * [-386.657] (-388.900) (-388.401) (-391.136) -- 0:00:19
678000 -- (-388.758) [-388.149] (-388.151) (-391.446) * (-387.348) (-388.649) [-388.066] (-388.314) -- 0:00:18
678500 -- (-388.903) (-389.163) (-388.704) [-387.513] * (-387.372) (-389.208) (-388.950) [-387.257] -- 0:00:18
679000 -- (-389.950) [-388.780] (-391.580) (-389.787) * (-386.327) (-387.654) [-391.974] (-386.883) -- 0:00:18
679500 -- (-387.892) (-387.633) [-389.504] (-388.786) * [-388.937] (-387.454) (-389.532) (-388.010) -- 0:00:18
680000 -- [-386.723] (-392.340) (-389.227) (-388.092) * (-388.086) (-392.360) [-388.541] (-387.915) -- 0:00:18
Average standard deviation of split frequencies: 0.011220
680500 -- (-386.967) [-388.676] (-390.087) (-386.518) * [-389.584] (-388.719) (-392.925) (-387.708) -- 0:00:18
681000 -- (-386.310) [-386.698] (-386.438) (-387.057) * [-389.215] (-389.518) (-390.499) (-387.325) -- 0:00:18
681500 -- [-386.491] (-386.453) (-387.193) (-388.454) * [-390.324] (-392.548) (-387.319) (-388.631) -- 0:00:18
682000 -- (-386.372) [-386.761] (-386.360) (-388.592) * [-389.064] (-389.642) (-387.670) (-390.707) -- 0:00:18
682500 -- (-386.273) (-386.191) (-390.254) [-387.494] * [-391.744] (-387.244) (-388.381) (-388.478) -- 0:00:18
683000 -- (-393.488) [-388.502] (-387.256) (-393.708) * (-388.984) (-388.679) (-392.793) [-388.100] -- 0:00:18
683500 -- (-394.842) (-392.730) (-386.437) [-388.603] * (-387.810) (-388.146) [-391.028] (-388.215) -- 0:00:18
684000 -- (-398.319) (-392.828) (-394.805) [-389.080] * (-387.801) [-386.489] (-387.174) (-386.658) -- 0:00:18
684500 -- (-388.609) [-387.771] (-388.375) (-387.273) * (-389.049) [-389.440] (-389.447) (-390.836) -- 0:00:18
685000 -- [-386.432] (-386.943) (-388.197) (-388.366) * [-391.734] (-387.721) (-388.977) (-390.727) -- 0:00:18
Average standard deviation of split frequencies: 0.011316
685500 -- (-387.009) (-387.750) (-388.236) [-388.222] * (-389.786) (-388.152) [-387.033] (-386.691) -- 0:00:18
686000 -- (-390.027) (-388.600) (-390.875) [-387.004] * [-388.800] (-387.758) (-388.736) (-388.043) -- 0:00:18
686500 -- [-389.683] (-389.260) (-390.423) (-386.669) * (-390.639) [-391.366] (-386.363) (-386.839) -- 0:00:18
687000 -- (-388.550) (-390.012) [-387.614] (-387.879) * (-395.828) (-392.235) [-386.965] (-386.642) -- 0:00:18
687500 -- [-391.435] (-386.306) (-389.630) (-390.111) * [-389.814] (-390.675) (-394.315) (-393.654) -- 0:00:18
688000 -- (-389.438) (-386.395) (-391.000) [-387.507] * [-389.891] (-389.919) (-389.463) (-390.252) -- 0:00:18
688500 -- [-387.864] (-388.897) (-386.048) (-389.545) * (-386.519) (-391.606) [-388.369] (-389.131) -- 0:00:18
689000 -- (-391.284) [-387.126] (-386.255) (-388.216) * (-387.849) (-389.347) (-387.568) [-387.629] -- 0:00:18
689500 -- (-388.742) (-388.727) [-387.150] (-388.045) * (-387.637) (-388.358) [-386.800] (-388.526) -- 0:00:18
690000 -- (-389.387) (-390.278) (-388.344) [-389.214] * (-388.146) (-392.208) (-387.713) [-391.282] -- 0:00:17
Average standard deviation of split frequencies: 0.011239
690500 -- (-387.437) (-387.156) (-387.739) [-388.090] * [-387.824] (-388.822) (-389.229) (-388.823) -- 0:00:17
691000 -- [-390.069] (-387.283) (-393.048) (-387.505) * (-388.895) (-388.894) [-390.646] (-388.162) -- 0:00:17
691500 -- (-389.849) (-387.592) (-395.094) [-386.878] * (-396.350) (-390.145) [-386.318] (-386.212) -- 0:00:17
692000 -- [-389.968] (-387.513) (-390.307) (-390.959) * (-393.907) (-391.877) [-386.816] (-389.088) -- 0:00:18
692500 -- (-389.820) (-389.440) [-387.941] (-391.149) * (-387.274) (-387.112) [-386.442] (-387.456) -- 0:00:18
693000 -- (-389.655) (-386.830) [-386.539] (-389.014) * [-390.631] (-387.544) (-388.093) (-388.955) -- 0:00:18
693500 -- (-387.879) (-388.769) (-391.379) [-389.932] * [-388.762] (-388.527) (-389.536) (-388.973) -- 0:00:18
694000 -- (-387.553) [-387.135] (-391.223) (-389.117) * (-391.912) (-388.526) (-389.238) [-387.763] -- 0:00:18
694500 -- (-389.743) (-388.616) [-388.128] (-386.129) * [-387.055] (-387.984) (-388.812) (-388.577) -- 0:00:18
695000 -- (-388.274) (-389.289) (-387.389) [-391.045] * [-388.330] (-387.877) (-388.857) (-387.508) -- 0:00:17
Average standard deviation of split frequencies: 0.011243
695500 -- (-389.743) [-386.752] (-391.003) (-388.065) * (-388.065) (-389.420) (-388.477) [-387.220] -- 0:00:17
696000 -- (-390.238) (-389.070) [-387.032] (-390.773) * (-389.478) (-387.546) [-386.446] (-387.908) -- 0:00:17
696500 -- (-395.774) (-387.776) (-387.789) [-397.772] * (-387.511) (-391.189) [-387.045] (-390.485) -- 0:00:17
697000 -- (-389.896) (-388.337) [-386.657] (-393.046) * (-387.987) [-389.958] (-387.968) (-391.167) -- 0:00:17
697500 -- [-389.194] (-389.236) (-387.701) (-389.539) * [-387.806] (-388.338) (-387.783) (-391.673) -- 0:00:17
698000 -- (-388.296) (-387.530) [-388.445] (-389.182) * (-388.370) (-387.786) (-390.133) [-389.769] -- 0:00:17
698500 -- (-390.406) (-386.430) [-389.838] (-387.603) * (-387.562) (-388.385) [-387.934] (-390.248) -- 0:00:17
699000 -- [-388.702] (-386.195) (-389.550) (-389.446) * (-390.353) (-387.626) [-387.621] (-386.984) -- 0:00:17
699500 -- (-388.471) (-389.415) (-388.243) [-388.958] * (-387.839) [-388.404] (-389.572) (-387.220) -- 0:00:17
700000 -- (-390.407) [-387.598] (-390.418) (-387.322) * (-387.040) [-387.667] (-388.622) (-387.959) -- 0:00:17
Average standard deviation of split frequencies: 0.010899
700500 -- (-390.051) [-387.192] (-389.609) (-387.528) * (-391.411) (-389.733) [-390.829] (-388.451) -- 0:00:17
701000 -- (-386.530) [-388.028] (-395.030) (-391.458) * (-388.004) (-387.062) (-390.865) [-386.206] -- 0:00:17
701500 -- [-387.573] (-387.250) (-392.166) (-395.181) * (-388.046) (-388.482) (-387.180) [-386.881] -- 0:00:17
702000 -- (-387.537) [-390.776] (-393.865) (-392.636) * (-387.658) [-388.002] (-386.612) (-387.267) -- 0:00:17
702500 -- (-387.364) (-389.385) [-392.038] (-393.137) * (-387.970) (-389.469) (-387.803) [-389.534] -- 0:00:17
703000 -- (-386.932) [-388.254] (-391.611) (-389.414) * [-387.189] (-396.208) (-390.266) (-387.870) -- 0:00:17
703500 -- (-386.734) (-389.505) (-389.523) [-388.739] * (-391.014) (-390.700) (-388.267) [-388.073] -- 0:00:17
704000 -- (-389.237) (-387.868) (-386.209) [-388.549] * (-390.375) [-389.877] (-386.680) (-390.223) -- 0:00:17
704500 -- [-390.133] (-389.733) (-388.884) (-388.119) * [-386.795] (-387.030) (-389.861) (-387.790) -- 0:00:17
705000 -- [-391.834] (-389.875) (-394.040) (-386.225) * (-386.481) [-387.668] (-388.708) (-390.883) -- 0:00:17
Average standard deviation of split frequencies: 0.010433
705500 -- [-388.527] (-388.287) (-395.012) (-389.556) * (-386.239) (-391.208) [-387.974] (-390.856) -- 0:00:17
706000 -- [-391.171] (-387.148) (-388.809) (-388.842) * (-390.177) [-388.390] (-387.298) (-387.304) -- 0:00:17
706500 -- (-387.626) (-386.422) [-387.091] (-388.361) * (-387.825) (-394.804) (-387.161) [-386.477] -- 0:00:17
707000 -- [-389.490] (-386.263) (-389.702) (-388.817) * (-389.531) [-391.304] (-386.929) (-388.205) -- 0:00:16
707500 -- (-390.731) [-387.651] (-391.318) (-388.531) * (-387.957) (-390.784) [-387.160] (-387.106) -- 0:00:16
708000 -- (-389.194) (-387.001) (-389.924) [-387.655] * (-389.999) (-387.125) (-387.969) [-387.323] -- 0:00:16
708500 -- (-386.583) (-388.580) (-387.346) [-388.875] * [-389.209] (-388.006) (-388.105) (-389.568) -- 0:00:16
709000 -- (-387.924) [-389.302] (-387.216) (-388.486) * (-387.251) [-387.461] (-387.914) (-392.175) -- 0:00:17
709500 -- (-386.745) (-390.940) (-387.391) [-389.523] * (-387.003) [-386.866] (-386.371) (-391.142) -- 0:00:17
710000 -- [-386.596] (-392.899) (-390.301) (-388.545) * [-387.175] (-387.357) (-387.942) (-387.796) -- 0:00:17
Average standard deviation of split frequencies: 0.010613
710500 -- (-387.564) (-389.581) (-388.361) [-388.605] * (-387.390) (-388.295) [-386.553] (-387.199) -- 0:00:17
711000 -- [-387.602] (-392.408) (-386.634) (-388.347) * (-390.786) (-387.766) (-387.119) [-386.758] -- 0:00:17
711500 -- (-393.191) [-388.904] (-387.320) (-388.044) * [-387.782] (-390.603) (-390.719) (-388.330) -- 0:00:17
712000 -- (-394.751) (-388.547) [-386.654] (-388.605) * (-387.495) (-391.594) (-390.396) [-388.576] -- 0:00:16
712500 -- (-390.937) (-389.228) [-389.956] (-389.415) * (-386.891) [-388.261] (-390.166) (-391.803) -- 0:00:16
713000 -- (-389.047) (-390.671) [-390.961] (-388.342) * [-386.699] (-388.189) (-388.414) (-391.905) -- 0:00:16
713500 -- (-393.312) (-389.370) [-388.702] (-388.843) * [-386.159] (-387.888) (-387.326) (-390.045) -- 0:00:16
714000 -- (-389.963) (-389.719) (-386.936) [-390.517] * (-387.826) (-387.973) [-388.644] (-387.338) -- 0:00:16
714500 -- [-393.668] (-392.275) (-386.976) (-388.662) * (-386.316) [-390.932] (-389.129) (-390.182) -- 0:00:16
715000 -- [-387.624] (-390.538) (-390.069) (-388.470) * (-390.331) [-388.481] (-386.370) (-389.289) -- 0:00:16
Average standard deviation of split frequencies: 0.010699
715500 -- (-386.450) (-390.144) (-387.932) [-389.990] * [-387.508] (-388.211) (-387.574) (-389.047) -- 0:00:16
716000 -- (-390.050) (-386.380) (-390.684) [-387.118] * (-387.430) (-387.617) (-387.624) [-386.915] -- 0:00:16
716500 -- (-390.303) (-389.822) (-388.531) [-388.645] * [-387.394] (-390.719) (-390.406) (-388.054) -- 0:00:16
717000 -- (-389.548) [-390.463] (-389.146) (-388.566) * (-386.580) (-389.593) (-389.552) [-388.682] -- 0:00:16
717500 -- (-392.424) (-389.166) (-389.306) [-389.238] * (-390.347) (-390.261) (-389.673) [-388.486] -- 0:00:16
718000 -- [-389.535] (-389.592) (-388.952) (-390.668) * (-387.548) (-387.663) (-386.754) [-389.755] -- 0:00:16
718500 -- (-389.149) (-388.482) (-387.656) [-389.856] * (-389.990) (-395.124) [-386.730] (-389.664) -- 0:00:16
719000 -- (-389.433) [-386.227] (-390.064) (-388.682) * (-389.114) (-388.193) (-388.704) [-388.028] -- 0:00:16
719500 -- (-388.121) [-386.171] (-386.878) (-386.974) * (-391.302) (-388.940) (-390.526) [-389.697] -- 0:00:16
720000 -- (-388.021) (-388.783) (-387.166) [-388.982] * [-390.001] (-391.892) (-389.153) (-391.065) -- 0:00:16
Average standard deviation of split frequencies: 0.011774
720500 -- (-390.040) (-389.414) [-388.036] (-388.845) * (-388.031) [-388.978] (-389.628) (-391.162) -- 0:00:16
721000 -- (-390.478) [-388.867] (-388.378) (-388.580) * (-386.905) (-390.575) [-391.624] (-388.051) -- 0:00:16
721500 -- (-388.856) (-391.176) [-386.418] (-389.229) * (-387.868) [-389.018] (-388.401) (-391.834) -- 0:00:16
722000 -- (-387.419) (-386.681) (-394.312) [-386.697] * [-387.661] (-388.395) (-387.709) (-388.265) -- 0:00:16
722500 -- (-388.475) (-387.898) (-388.997) [-389.600] * [-386.959] (-387.806) (-387.356) (-393.998) -- 0:00:16
723000 -- (-386.953) [-387.171] (-392.102) (-388.258) * (-387.416) [-387.115] (-391.744) (-389.992) -- 0:00:16
723500 -- (-387.421) (-389.909) (-390.577) [-389.712] * [-386.630] (-389.131) (-390.519) (-388.798) -- 0:00:16
724000 -- (-386.797) (-388.174) [-386.306] (-388.524) * (-389.130) (-395.996) [-388.976] (-387.763) -- 0:00:16
724500 -- (-387.907) (-388.100) [-388.171] (-392.726) * (-388.379) (-387.365) (-389.124) [-388.803] -- 0:00:15
725000 -- (-387.855) (-392.598) [-386.282] (-391.408) * (-388.159) (-389.013) [-386.815] (-387.162) -- 0:00:15
Average standard deviation of split frequencies: 0.011471
725500 -- (-387.961) (-386.206) (-387.365) [-390.909] * (-387.291) [-387.406] (-387.030) (-390.333) -- 0:00:15
726000 -- [-388.341] (-390.088) (-387.458) (-387.800) * (-387.864) (-394.637) [-387.716] (-386.837) -- 0:00:16
726500 -- [-386.311] (-388.716) (-388.587) (-388.285) * (-386.737) [-388.161] (-392.925) (-386.558) -- 0:00:16
727000 -- (-387.510) (-387.254) [-386.457] (-390.230) * (-388.807) (-390.483) [-387.413] (-387.099) -- 0:00:16
727500 -- (-390.383) (-389.176) (-388.707) [-387.647] * (-388.381) [-386.229] (-390.553) (-388.919) -- 0:00:16
728000 -- (-387.792) (-387.967) [-387.102] (-390.156) * [-388.449] (-387.648) (-388.582) (-391.208) -- 0:00:16
728500 -- [-387.705] (-389.858) (-387.363) (-386.982) * (-387.549) (-389.596) (-392.230) [-388.397] -- 0:00:16
729000 -- (-392.616) (-389.839) (-388.206) [-387.935] * (-387.692) (-388.817) (-392.514) [-387.543] -- 0:00:15
729500 -- [-388.929] (-388.200) (-386.907) (-390.087) * [-386.681] (-388.616) (-387.360) (-387.743) -- 0:00:15
730000 -- (-388.314) [-387.985] (-388.325) (-389.174) * [-388.126] (-386.415) (-389.706) (-388.278) -- 0:00:15
Average standard deviation of split frequencies: 0.010686
730500 -- [-386.779] (-387.161) (-388.521) (-388.962) * (-386.485) (-387.933) (-390.204) [-388.284] -- 0:00:15
731000 -- (-387.804) [-387.440] (-391.187) (-386.699) * (-386.508) (-389.165) (-387.982) [-391.623] -- 0:00:15
731500 -- (-386.593) (-387.416) [-387.364] (-386.406) * (-386.340) (-389.445) [-387.868] (-389.319) -- 0:00:15
732000 -- [-387.013] (-389.081) (-388.353) (-388.433) * (-387.074) [-387.193] (-390.668) (-388.617) -- 0:00:15
732500 -- [-386.902] (-387.259) (-387.904) (-393.967) * (-389.084) (-388.968) [-390.428] (-388.075) -- 0:00:15
733000 -- (-386.159) (-388.011) (-386.755) [-390.229] * (-386.793) [-389.083] (-392.915) (-390.410) -- 0:00:15
733500 -- (-389.813) (-386.631) (-386.683) [-387.564] * (-386.381) [-388.775] (-386.928) (-387.449) -- 0:00:15
734000 -- (-390.416) (-388.129) (-386.360) [-387.444] * (-388.308) (-388.103) [-387.882] (-388.857) -- 0:00:15
734500 -- (-390.301) [-388.747] (-390.423) (-389.051) * (-390.991) (-389.323) (-393.140) [-387.694] -- 0:00:15
735000 -- (-390.185) (-386.587) (-390.893) [-387.400] * (-389.983) [-387.372] (-388.280) (-389.057) -- 0:00:15
Average standard deviation of split frequencies: 0.010688
735500 -- [-388.086] (-388.038) (-389.503) (-389.681) * (-388.127) (-387.476) [-389.439] (-390.895) -- 0:00:15
736000 -- (-389.498) (-388.675) [-387.836] (-388.724) * (-390.974) [-387.262] (-390.442) (-387.726) -- 0:00:15
736500 -- (-391.331) [-387.953] (-390.883) (-388.346) * (-388.148) (-387.694) (-388.807) [-387.502] -- 0:00:15
737000 -- (-388.096) [-386.824] (-389.057) (-388.639) * (-387.946) (-389.500) (-387.866) [-386.719] -- 0:00:15
737500 -- (-399.893) (-388.198) (-387.570) [-387.909] * [-388.965] (-387.096) (-388.414) (-388.198) -- 0:00:15
738000 -- (-389.409) (-390.603) [-387.622] (-386.539) * (-386.911) (-387.458) [-388.765] (-390.020) -- 0:00:15
738500 -- (-390.247) (-387.526) (-387.789) [-389.517] * (-389.544) [-390.875] (-387.939) (-390.255) -- 0:00:15
739000 -- (-389.111) [-387.474] (-386.598) (-388.380) * (-389.759) (-387.521) (-391.990) [-387.571] -- 0:00:15
739500 -- (-388.431) (-387.916) [-386.478] (-390.021) * (-386.952) (-389.103) (-386.595) [-386.519] -- 0:00:15
740000 -- (-393.332) [-390.616] (-390.531) (-388.454) * (-386.586) (-390.018) [-387.765] (-387.420) -- 0:00:15
Average standard deviation of split frequencies: 0.010462
740500 -- (-392.227) (-390.731) (-390.951) [-387.670] * (-388.036) [-386.694] (-388.053) (-388.007) -- 0:00:15
741000 -- (-387.854) [-387.648] (-392.518) (-389.692) * (-389.534) [-391.098] (-387.992) (-388.831) -- 0:00:15
741500 -- (-387.456) [-386.668] (-386.778) (-388.469) * (-387.252) (-388.312) (-388.255) [-388.417] -- 0:00:14
742000 -- (-387.218) (-389.822) [-386.886] (-388.411) * (-388.135) (-387.472) [-388.249] (-387.938) -- 0:00:14
742500 -- [-389.856] (-388.544) (-394.769) (-388.849) * [-387.896] (-386.805) (-388.388) (-389.720) -- 0:00:14
743000 -- (-386.392) [-391.395] (-387.398) (-390.339) * (-386.733) (-387.799) [-386.811] (-389.317) -- 0:00:15
743500 -- [-388.504] (-387.797) (-387.488) (-390.624) * [-388.018] (-389.931) (-390.523) (-386.897) -- 0:00:15
744000 -- (-387.338) (-390.689) (-389.202) [-388.671] * [-389.121] (-388.019) (-391.121) (-390.044) -- 0:00:15
744500 -- [-386.718] (-386.716) (-387.534) (-391.425) * [-388.634] (-389.512) (-390.260) (-388.650) -- 0:00:15
745000 -- (-388.445) [-389.395] (-387.257) (-392.831) * (-387.747) (-389.188) (-387.726) [-388.426] -- 0:00:15
Average standard deviation of split frequencies: 0.010782
745500 -- [-387.806] (-393.191) (-391.940) (-387.398) * (-386.894) (-388.507) (-388.473) [-387.703] -- 0:00:15
746000 -- (-386.508) (-387.938) [-389.178] (-390.211) * (-387.354) [-387.137] (-388.425) (-388.965) -- 0:00:14
746500 -- [-388.133] (-387.939) (-387.215) (-387.765) * (-387.809) (-390.072) [-392.588] (-388.824) -- 0:00:14
747000 -- (-390.452) (-388.722) (-388.625) [-387.038] * (-391.170) (-389.124) (-389.513) [-386.538] -- 0:00:14
747500 -- (-388.781) (-388.155) [-386.794] (-386.462) * (-388.658) [-388.474] (-388.857) (-386.493) -- 0:00:14
748000 -- (-389.705) (-388.907) (-387.215) [-388.233] * (-388.254) [-386.486] (-389.392) (-390.130) -- 0:00:14
748500 -- [-387.157] (-393.227) (-388.158) (-388.659) * [-388.184] (-389.305) (-388.988) (-389.445) -- 0:00:14
749000 -- (-388.221) (-387.784) [-389.038] (-386.861) * [-388.913] (-389.328) (-390.828) (-389.531) -- 0:00:14
749500 -- (-388.573) (-388.848) [-387.944] (-386.526) * [-389.120] (-391.406) (-390.389) (-388.831) -- 0:00:14
750000 -- (-388.066) (-390.106) (-389.232) [-387.366] * (-391.250) [-390.218] (-388.604) (-390.826) -- 0:00:14
Average standard deviation of split frequencies: 0.010833
750500 -- (-388.253) (-389.627) [-387.044] (-388.166) * (-389.165) (-392.560) [-388.515] (-388.019) -- 0:00:14
751000 -- (-387.094) (-387.645) [-389.390] (-388.039) * (-388.624) (-389.720) [-387.697] (-388.282) -- 0:00:14
751500 -- (-390.691) (-388.605) [-388.168] (-386.713) * (-401.269) (-387.594) (-393.637) [-387.270] -- 0:00:14
752000 -- (-390.241) (-387.483) (-388.408) [-387.306] * (-393.070) (-387.252) [-388.228] (-388.193) -- 0:00:14
752500 -- (-392.152) (-386.306) [-388.039] (-388.901) * [-389.254] (-388.778) (-387.060) (-388.834) -- 0:00:14
753000 -- (-390.101) [-387.445] (-387.266) (-389.058) * (-388.337) (-388.146) [-387.453] (-387.595) -- 0:00:14
753500 -- [-386.883] (-388.294) (-386.890) (-387.574) * (-389.024) (-388.381) (-389.259) [-387.567] -- 0:00:14
754000 -- (-391.289) (-387.539) [-387.047] (-394.216) * (-388.456) [-387.562] (-389.012) (-389.058) -- 0:00:14
754500 -- (-387.636) (-387.209) (-387.880) [-386.846] * (-388.297) [-389.245] (-386.307) (-387.447) -- 0:00:14
755000 -- (-391.930) (-386.957) [-388.169] (-388.422) * (-389.947) (-387.671) [-388.574] (-386.498) -- 0:00:14
Average standard deviation of split frequencies: 0.009704
755500 -- [-389.415] (-389.568) (-387.666) (-390.052) * [-387.390] (-386.502) (-387.998) (-395.185) -- 0:00:14
756000 -- (-390.999) [-388.181] (-388.188) (-387.950) * (-393.743) (-389.189) (-395.284) [-392.332] -- 0:00:14
756500 -- [-389.556] (-386.973) (-389.120) (-387.466) * (-389.512) [-387.837] (-389.479) (-387.939) -- 0:00:14
757000 -- (-390.157) [-389.776] (-388.143) (-390.374) * (-389.196) [-387.715] (-391.860) (-392.242) -- 0:00:14
757500 -- (-390.694) (-390.235) (-387.166) [-387.825] * (-386.572) (-388.411) [-387.340] (-389.170) -- 0:00:14
758000 -- (-389.956) (-387.911) [-387.294] (-390.702) * [-386.690] (-389.701) (-389.675) (-388.430) -- 0:00:14
758500 -- (-387.103) (-390.402) (-388.618) [-386.800] * (-388.412) (-388.154) [-388.478] (-389.961) -- 0:00:14
759000 -- (-387.954) (-390.208) [-387.254] (-395.314) * (-390.573) (-388.577) (-391.726) [-390.059] -- 0:00:13
759500 -- [-387.683] (-387.686) (-389.882) (-389.091) * (-388.627) (-388.467) [-386.899] (-388.511) -- 0:00:13
760000 -- (-387.874) (-389.669) (-388.563) [-389.631] * (-389.927) (-387.410) (-388.288) [-387.765] -- 0:00:13
Average standard deviation of split frequencies: 0.009296
760500 -- [-388.603] (-389.001) (-388.282) (-395.231) * (-388.394) (-388.929) [-390.775] (-386.507) -- 0:00:14
761000 -- [-388.921] (-388.799) (-392.059) (-393.338) * (-388.275) [-391.664] (-392.403) (-387.527) -- 0:00:14
761500 -- (-387.571) (-388.638) (-386.931) [-386.586] * (-387.645) [-390.148] (-387.827) (-387.019) -- 0:00:14
762000 -- (-387.533) (-389.342) [-386.805] (-389.282) * (-387.629) (-390.932) [-387.674] (-387.258) -- 0:00:14
762500 -- (-386.928) (-388.605) (-386.989) [-387.942] * [-389.496] (-388.788) (-387.821) (-387.141) -- 0:00:14
763000 -- [-387.305] (-387.366) (-386.957) (-391.479) * (-386.463) (-387.985) [-386.186] (-388.230) -- 0:00:13
763500 -- (-388.008) (-387.237) (-387.181) [-386.598] * [-388.381] (-392.890) (-389.848) (-387.306) -- 0:00:13
764000 -- (-389.820) (-387.137) (-387.593) [-389.298] * (-388.187) (-390.551) (-389.476) [-387.001] -- 0:00:13
764500 -- (-391.324) (-389.041) (-387.542) [-387.732] * (-386.876) [-388.871] (-388.922) (-388.121) -- 0:00:13
765000 -- (-389.890) (-388.999) (-388.908) [-387.317] * (-387.171) (-389.305) [-389.131] (-389.742) -- 0:00:13
Average standard deviation of split frequencies: 0.008808
765500 -- [-388.014] (-388.850) (-388.846) (-387.768) * (-387.286) [-388.064] (-386.482) (-387.909) -- 0:00:13
766000 -- (-390.844) (-392.232) [-388.303] (-393.410) * (-388.806) (-389.464) [-387.533] (-386.903) -- 0:00:13
766500 -- [-393.798] (-386.890) (-387.911) (-394.310) * [-389.615] (-396.159) (-387.799) (-387.686) -- 0:00:13
767000 -- [-388.463] (-387.048) (-386.789) (-390.908) * (-387.693) [-387.622] (-392.825) (-388.680) -- 0:00:13
767500 -- (-386.403) (-391.534) (-386.371) [-390.822] * (-388.222) [-387.495] (-387.971) (-389.270) -- 0:00:13
768000 -- [-386.876] (-388.706) (-391.687) (-387.677) * (-387.865) (-388.374) [-388.567] (-387.939) -- 0:00:13
768500 -- [-386.278] (-389.491) (-390.432) (-389.546) * [-389.171] (-388.192) (-389.615) (-390.924) -- 0:00:13
769000 -- [-388.270] (-387.684) (-389.743) (-390.491) * [-388.900] (-389.604) (-388.121) (-387.174) -- 0:00:13
769500 -- (-386.515) [-388.636] (-386.736) (-391.194) * (-387.955) (-389.265) (-389.966) [-387.730] -- 0:00:13
770000 -- (-386.854) (-387.595) [-388.971] (-386.406) * [-388.198] (-388.741) (-389.836) (-387.236) -- 0:00:13
Average standard deviation of split frequencies: 0.009061
770500 -- [-391.562] (-388.274) (-390.452) (-386.693) * (-389.158) (-390.172) [-390.365] (-388.791) -- 0:00:13
771000 -- [-386.615] (-388.671) (-388.019) (-388.002) * (-390.329) (-386.781) (-386.671) [-388.647] -- 0:00:13
771500 -- (-390.234) [-387.532] (-387.923) (-389.825) * [-392.626] (-387.446) (-387.996) (-387.865) -- 0:00:13
772000 -- (-387.615) (-388.286) [-392.222] (-388.784) * [-387.671] (-390.258) (-386.102) (-388.534) -- 0:00:13
772500 -- (-387.037) [-388.988] (-388.278) (-387.879) * (-388.025) (-389.025) (-388.494) [-388.618] -- 0:00:13
773000 -- (-386.964) (-391.822) (-390.805) [-387.557] * (-387.091) (-388.388) [-386.985] (-392.282) -- 0:00:13
773500 -- [-389.989] (-386.959) (-390.593) (-391.984) * (-389.652) (-386.627) [-387.181] (-389.416) -- 0:00:13
774000 -- (-391.914) (-389.500) [-386.433] (-387.555) * (-389.194) (-386.661) [-391.414] (-392.243) -- 0:00:13
774500 -- (-389.363) (-387.281) [-393.383] (-390.593) * [-388.949] (-387.356) (-390.455) (-397.508) -- 0:00:13
775000 -- (-389.085) (-386.145) (-398.208) [-388.445] * (-387.007) (-386.971) [-387.017] (-390.984) -- 0:00:13
Average standard deviation of split frequencies: 0.008884
775500 -- (-387.555) [-386.246] (-390.462) (-388.954) * [-386.746] (-386.483) (-389.395) (-389.567) -- 0:00:13
776000 -- (-390.506) [-386.219] (-389.855) (-388.827) * [-386.309] (-393.510) (-390.065) (-390.392) -- 0:00:12
776500 -- (-388.356) (-389.438) [-390.615] (-389.951) * (-389.207) [-390.885] (-387.424) (-389.341) -- 0:00:12
777000 -- (-390.682) (-389.812) (-390.648) [-390.675] * [-387.717] (-387.474) (-392.464) (-388.047) -- 0:00:12
777500 -- (-392.141) (-391.303) [-389.459] (-389.037) * [-387.518] (-391.542) (-391.003) (-388.330) -- 0:00:13
778000 -- (-387.930) [-387.915] (-387.939) (-390.681) * (-388.641) (-388.783) (-388.362) [-390.439] -- 0:00:13
778500 -- (-388.748) (-392.018) (-386.717) [-389.496] * [-388.082] (-387.008) (-388.565) (-390.116) -- 0:00:13
779000 -- (-386.976) [-388.411] (-389.115) (-387.672) * (-390.351) (-389.448) [-389.815] (-387.944) -- 0:00:13
779500 -- (-390.764) (-391.601) [-388.896] (-387.068) * (-389.717) [-390.813] (-390.811) (-387.940) -- 0:00:13
780000 -- (-388.181) [-388.663] (-388.397) (-387.963) * (-387.807) (-389.926) (-394.008) [-388.314] -- 0:00:12
Average standard deviation of split frequencies: 0.008937
780500 -- (-391.228) (-387.568) [-391.480] (-389.005) * (-386.276) (-390.044) (-387.149) [-386.767] -- 0:00:12
781000 -- (-388.012) [-386.680] (-390.175) (-387.169) * (-387.167) (-390.463) (-387.723) [-387.022] -- 0:00:12
781500 -- [-387.373] (-388.865) (-389.229) (-389.206) * (-388.295) [-388.124] (-389.102) (-389.849) -- 0:00:12
782000 -- (-387.770) (-387.082) (-386.738) [-391.490] * [-389.964] (-389.418) (-387.902) (-390.214) -- 0:00:12
782500 -- (-388.226) [-388.278] (-387.820) (-386.872) * (-387.587) [-392.753] (-387.687) (-391.021) -- 0:00:12
783000 -- (-386.847) [-389.367] (-386.970) (-388.001) * [-387.921] (-391.001) (-388.149) (-389.560) -- 0:00:12
783500 -- (-387.462) (-388.160) (-387.377) [-388.822] * (-389.832) (-389.387) [-387.023] (-388.643) -- 0:00:12
784000 -- [-386.957] (-387.876) (-386.993) (-386.729) * (-387.836) (-392.721) [-390.389] (-388.282) -- 0:00:12
784500 -- (-389.510) (-390.776) (-387.821) [-386.741] * (-387.716) (-388.209) (-386.178) [-388.129] -- 0:00:12
785000 -- [-387.610] (-386.899) (-389.126) (-391.261) * [-386.632] (-386.781) (-386.870) (-388.101) -- 0:00:12
Average standard deviation of split frequencies: 0.008097
785500 -- (-390.729) (-388.218) [-392.032] (-389.115) * [-386.607] (-392.843) (-390.954) (-389.718) -- 0:00:12
786000 -- (-389.401) [-387.009] (-389.757) (-389.204) * [-386.330] (-387.021) (-386.615) (-387.463) -- 0:00:12
786500 -- [-390.388] (-391.792) (-390.125) (-388.440) * (-386.726) (-386.950) [-386.392] (-390.079) -- 0:00:12
787000 -- [-387.322] (-387.351) (-391.020) (-389.440) * (-386.498) [-388.743] (-391.951) (-390.296) -- 0:00:12
787500 -- (-390.681) (-386.677) (-391.243) [-388.444] * [-388.377] (-386.454) (-387.992) (-392.191) -- 0:00:12
788000 -- (-388.424) (-387.058) [-387.971] (-387.966) * (-390.557) (-386.946) [-387.410] (-388.518) -- 0:00:12
788500 -- [-390.970] (-391.004) (-387.834) (-389.162) * (-394.768) [-388.954] (-390.301) (-389.932) -- 0:00:12
789000 -- (-392.377) (-390.627) (-389.361) [-389.196] * [-388.265] (-386.622) (-389.436) (-392.189) -- 0:00:12
789500 -- (-389.054) [-389.171] (-390.180) (-387.327) * (-389.777) (-387.464) [-389.333] (-390.078) -- 0:00:12
790000 -- (-387.759) [-394.298] (-389.193) (-389.430) * (-391.026) (-393.672) (-389.679) [-390.498] -- 0:00:12
Average standard deviation of split frequencies: 0.008049
790500 -- [-387.857] (-394.049) (-387.660) (-389.915) * (-389.160) [-388.138] (-389.409) (-390.853) -- 0:00:12
791000 -- (-387.266) (-393.027) [-388.887] (-388.436) * [-387.812] (-389.329) (-389.962) (-389.877) -- 0:00:12
791500 -- [-387.416] (-391.796) (-389.335) (-386.119) * (-388.825) (-389.920) (-388.909) [-387.630] -- 0:00:12
792000 -- (-388.538) [-391.518] (-388.618) (-387.815) * (-389.150) (-389.343) (-387.033) [-386.831] -- 0:00:12
792500 -- (-388.952) [-389.734] (-388.303) (-390.549) * [-387.462] (-388.027) (-388.572) (-390.107) -- 0:00:12
793000 -- [-387.727] (-391.938) (-388.510) (-389.739) * [-387.063] (-389.563) (-390.842) (-389.759) -- 0:00:12
793500 -- (-390.390) (-388.819) [-389.800] (-390.898) * (-392.018) [-386.769] (-393.196) (-388.260) -- 0:00:11
794000 -- (-386.316) [-388.004] (-388.350) (-390.669) * (-387.359) (-387.468) (-388.061) [-387.723] -- 0:00:11
794500 -- (-387.644) [-388.723] (-388.768) (-386.962) * (-388.128) [-389.972] (-387.292) (-386.693) -- 0:00:12
795000 -- (-386.371) (-389.450) [-386.649] (-387.689) * (-386.880) [-386.895] (-387.338) (-387.258) -- 0:00:12
Average standard deviation of split frequencies: 0.008291
795500 -- (-392.537) [-389.077] (-386.304) (-389.103) * (-386.863) (-388.376) [-387.684] (-388.659) -- 0:00:12
796000 -- [-389.684] (-391.874) (-387.706) (-391.189) * (-390.510) (-386.536) (-387.705) [-387.943] -- 0:00:12
796500 -- [-387.080] (-388.523) (-390.474) (-388.811) * (-391.167) [-389.127] (-388.319) (-386.454) -- 0:00:12
797000 -- [-388.035] (-388.236) (-390.571) (-391.024) * (-392.742) (-387.796) [-389.249] (-386.408) -- 0:00:11
797500 -- (-390.412) [-386.719] (-392.420) (-390.593) * (-391.658) (-390.671) [-389.048] (-386.525) -- 0:00:11
798000 -- (-391.031) (-387.299) (-387.988) [-387.055] * [-388.913] (-388.866) (-392.022) (-392.639) -- 0:00:11
798500 -- (-390.646) [-387.801] (-390.249) (-389.962) * (-390.521) [-387.213] (-390.832) (-388.696) -- 0:00:11
799000 -- (-387.346) (-387.795) [-386.999] (-388.702) * (-390.964) [-390.356] (-388.889) (-389.481) -- 0:00:11
799500 -- [-390.109] (-387.324) (-387.035) (-387.142) * (-390.359) (-389.686) [-387.939] (-387.962) -- 0:00:11
800000 -- (-386.887) [-388.476] (-387.214) (-392.960) * (-391.200) (-389.193) [-386.994] (-390.121) -- 0:00:11
Average standard deviation of split frequencies: 0.008439
800500 -- [-389.627] (-391.350) (-387.325) (-388.452) * (-390.760) (-386.522) [-387.636] (-392.342) -- 0:00:11
801000 -- (-389.157) (-389.012) (-389.760) [-389.149] * (-388.012) (-388.331) [-389.930] (-388.166) -- 0:00:11
801500 -- [-389.061] (-390.016) (-387.736) (-388.146) * [-390.276] (-387.183) (-387.169) (-390.119) -- 0:00:11
802000 -- (-387.886) [-388.860] (-388.028) (-386.846) * (-391.463) (-388.683) [-388.382] (-391.605) -- 0:00:11
802500 -- (-386.992) (-387.571) (-389.210) [-388.932] * (-395.398) (-395.148) [-388.000] (-387.457) -- 0:00:11
803000 -- (-390.018) (-386.431) (-388.485) [-390.107] * (-393.658) (-388.688) [-391.181] (-387.697) -- 0:00:11
803500 -- (-388.434) [-387.891] (-389.148) (-389.660) * (-388.643) (-389.936) [-389.409] (-391.273) -- 0:00:11
804000 -- (-388.059) (-386.491) [-389.402] (-390.791) * (-389.207) [-387.889] (-388.908) (-395.200) -- 0:00:11
804500 -- [-390.725] (-390.110) (-389.340) (-388.950) * (-387.599) (-388.694) (-387.943) [-389.446] -- 0:00:11
805000 -- (-387.294) (-387.604) (-390.037) [-388.027] * [-388.359] (-389.714) (-389.288) (-392.507) -- 0:00:11
Average standard deviation of split frequencies: 0.008422
805500 -- (-388.910) (-390.067) (-387.646) [-387.016] * (-388.884) (-388.220) [-386.424] (-389.599) -- 0:00:11
806000 -- (-387.426) (-389.365) [-387.453] (-390.411) * (-387.486) (-387.448) (-386.476) [-392.528] -- 0:00:11
806500 -- (-391.606) [-393.600] (-386.245) (-388.945) * (-390.944) (-386.886) (-390.140) [-387.663] -- 0:00:11
807000 -- (-387.265) (-390.411) [-386.183] (-388.927) * (-389.988) (-386.441) (-389.043) [-387.570] -- 0:00:11
807500 -- (-387.887) (-387.112) [-386.670] (-389.486) * (-388.564) (-386.666) [-388.084] (-388.588) -- 0:00:11
808000 -- (-391.108) [-387.971] (-386.877) (-388.974) * (-389.585) (-386.796) (-389.287) [-391.888] -- 0:00:11
808500 -- [-389.153] (-389.915) (-391.517) (-387.058) * (-394.528) (-388.600) [-387.214] (-388.599) -- 0:00:11
809000 -- [-386.559] (-388.732) (-389.882) (-387.157) * [-387.703] (-388.074) (-389.025) (-390.893) -- 0:00:11
809500 -- [-391.790] (-388.900) (-386.586) (-387.607) * (-387.187) [-389.661] (-389.496) (-387.510) -- 0:00:11
810000 -- (-388.896) (-388.461) [-386.260] (-389.299) * [-389.378] (-388.911) (-387.788) (-387.081) -- 0:00:11
Average standard deviation of split frequencies: 0.007986
810500 -- (-387.617) [-389.321] (-387.644) (-387.519) * (-390.030) (-388.042) (-390.103) [-388.510] -- 0:00:10
811000 -- (-388.605) (-387.956) (-386.859) [-387.635] * [-387.619] (-386.450) (-391.513) (-386.966) -- 0:00:10
811500 -- (-387.505) (-388.051) [-386.358] (-392.288) * (-387.474) (-387.217) (-391.565) [-389.702] -- 0:00:11
812000 -- (-388.216) [-387.051] (-388.017) (-389.993) * (-387.916) [-387.320] (-389.239) (-390.267) -- 0:00:11
812500 -- (-387.999) (-390.523) (-389.198) [-387.865] * [-388.988] (-388.327) (-391.702) (-388.874) -- 0:00:11
813000 -- (-391.366) [-391.389] (-387.596) (-391.106) * (-389.292) (-391.578) [-386.944] (-389.962) -- 0:00:11
813500 -- [-388.329] (-387.804) (-387.325) (-388.184) * [-388.294] (-391.266) (-387.518) (-390.619) -- 0:00:11
814000 -- [-387.786] (-392.749) (-388.855) (-389.673) * (-390.724) (-387.105) (-390.248) [-386.889] -- 0:00:10
814500 -- (-389.517) (-390.116) [-387.136] (-389.475) * (-396.284) (-389.164) [-387.544] (-386.650) -- 0:00:10
815000 -- (-389.842) (-389.703) [-387.246] (-389.091) * (-391.410) [-386.922] (-387.373) (-387.961) -- 0:00:10
Average standard deviation of split frequencies: 0.007741
815500 -- (-388.924) (-392.029) [-388.122] (-389.870) * (-389.063) (-390.582) [-387.187] (-387.628) -- 0:00:10
816000 -- (-388.194) (-386.906) [-388.225] (-388.004) * (-391.905) (-388.653) [-392.324] (-388.209) -- 0:00:10
816500 -- (-388.108) [-388.204] (-387.865) (-387.383) * [-390.407] (-389.881) (-388.023) (-388.728) -- 0:00:10
817000 -- (-387.438) (-387.480) (-387.095) [-390.873] * (-388.292) (-387.292) (-388.855) [-389.917] -- 0:00:10
817500 -- (-390.580) [-389.108] (-388.031) (-389.218) * [-387.180] (-386.886) (-389.764) (-388.192) -- 0:00:10
818000 -- (-387.038) [-390.752] (-387.968) (-390.760) * (-389.502) (-388.418) [-388.884] (-388.246) -- 0:00:10
818500 -- (-387.172) [-389.771] (-387.980) (-386.682) * [-389.474] (-389.122) (-390.492) (-387.615) -- 0:00:10
819000 -- [-387.938] (-389.852) (-387.378) (-390.191) * [-387.860] (-387.983) (-388.978) (-388.612) -- 0:00:10
819500 -- (-389.023) (-390.385) (-389.579) [-386.599] * (-387.035) [-389.811] (-389.519) (-388.754) -- 0:00:10
820000 -- (-387.786) [-390.957] (-388.348) (-388.453) * (-387.182) (-391.466) (-389.430) [-390.380] -- 0:00:10
Average standard deviation of split frequencies: 0.007544
820500 -- (-389.156) (-389.382) (-389.538) [-396.175] * [-389.542] (-392.071) (-388.261) (-391.802) -- 0:00:10
821000 -- [-387.053] (-390.013) (-389.599) (-391.667) * (-388.765) (-391.285) [-387.917] (-390.938) -- 0:00:10
821500 -- (-391.243) [-390.021] (-390.742) (-390.915) * [-387.536] (-390.459) (-387.207) (-388.670) -- 0:00:10
822000 -- (-389.876) [-388.799] (-391.905) (-387.217) * (-386.860) (-388.018) [-388.608] (-388.366) -- 0:00:10
822500 -- (-390.913) (-389.513) (-391.518) [-388.723] * [-387.986] (-387.811) (-386.714) (-386.990) -- 0:00:10
823000 -- (-391.100) [-387.549] (-391.961) (-387.944) * (-387.509) (-387.667) [-387.794] (-387.265) -- 0:00:10
823500 -- (-390.841) (-392.015) (-391.799) [-386.620] * (-386.299) [-388.958] (-389.615) (-386.494) -- 0:00:10
824000 -- [-389.004] (-387.255) (-391.382) (-389.939) * [-389.307] (-387.747) (-390.434) (-387.931) -- 0:00:10
824500 -- [-388.848] (-389.095) (-387.559) (-390.074) * (-392.131) [-386.770] (-388.689) (-387.377) -- 0:00:10
825000 -- (-389.219) (-388.230) (-391.832) [-390.783] * [-387.884] (-389.000) (-388.966) (-387.960) -- 0:00:10
Average standard deviation of split frequencies: 0.007348
825500 -- (-388.600) (-386.912) (-388.204) [-388.484] * [-391.215] (-387.010) (-389.900) (-387.117) -- 0:00:10
826000 -- (-389.508) (-388.532) (-386.233) [-387.256] * (-387.735) [-387.130] (-388.865) (-387.635) -- 0:00:10
826500 -- (-387.660) (-387.694) (-387.906) [-386.848] * (-387.249) [-387.668] (-391.423) (-388.556) -- 0:00:10
827000 -- (-389.413) [-387.842] (-388.943) (-391.378) * [-388.222] (-393.594) (-388.106) (-388.700) -- 0:00:10
827500 -- (-389.733) [-386.689] (-389.292) (-388.332) * (-386.704) (-390.164) [-387.356] (-389.041) -- 0:00:10
828000 -- (-394.160) (-388.271) [-387.919] (-389.243) * [-387.902] (-388.328) (-388.662) (-389.334) -- 0:00:10
828500 -- (-389.448) [-388.018] (-392.739) (-387.721) * (-387.918) (-391.103) [-389.285] (-389.244) -- 0:00:10
829000 -- (-388.040) [-388.646] (-391.347) (-387.192) * (-387.309) [-387.138] (-388.769) (-386.680) -- 0:00:10
829500 -- [-388.796] (-387.827) (-388.275) (-386.328) * (-389.034) (-386.904) [-390.440] (-388.730) -- 0:00:10
830000 -- (-389.231) (-391.015) [-389.578] (-390.459) * (-387.624) (-387.872) [-388.987] (-390.581) -- 0:00:10
Average standard deviation of split frequencies: 0.007094
830500 -- (-388.121) (-389.761) [-389.741] (-389.613) * (-387.081) (-388.297) (-387.113) [-388.396] -- 0:00:10
831000 -- (-386.647) [-386.299] (-387.382) (-390.085) * (-390.140) (-391.543) (-392.735) [-386.066] -- 0:00:09
831500 -- (-386.507) (-387.093) (-387.570) [-388.167] * (-388.819) (-386.918) (-387.252) [-388.660] -- 0:00:09
832000 -- (-389.750) (-387.730) [-388.415] (-393.570) * (-389.076) [-387.324] (-386.888) (-392.271) -- 0:00:09
832500 -- (-386.954) [-388.795] (-389.890) (-394.044) * (-387.315) [-387.049] (-387.652) (-390.183) -- 0:00:09
833000 -- (-388.091) (-389.174) (-387.941) [-390.323] * [-388.349] (-391.355) (-386.708) (-391.640) -- 0:00:09
833500 -- (-389.490) [-387.275] (-386.420) (-399.289) * (-387.705) [-388.778] (-388.675) (-387.337) -- 0:00:09
834000 -- (-388.111) [-387.161] (-386.429) (-401.324) * (-387.807) (-390.996) [-388.370] (-386.727) -- 0:00:09
834500 -- [-388.639] (-388.127) (-388.352) (-391.457) * (-388.987) (-390.336) [-393.566] (-386.923) -- 0:00:09
835000 -- (-391.305) (-388.150) (-391.530) [-389.793] * [-388.968] (-391.439) (-391.316) (-392.799) -- 0:00:09
Average standard deviation of split frequencies: 0.007154
835500 -- [-389.541] (-388.515) (-388.171) (-390.750) * [-386.864] (-387.309) (-391.604) (-387.607) -- 0:00:09
836000 -- (-388.919) (-389.836) [-389.352] (-389.645) * [-389.892] (-391.136) (-391.049) (-394.498) -- 0:00:09
836500 -- (-389.306) [-388.180] (-387.559) (-387.734) * [-389.797] (-391.004) (-387.802) (-391.992) -- 0:00:09
837000 -- (-391.328) (-387.754) (-394.801) [-389.398] * (-391.011) (-391.054) (-387.079) [-388.563] -- 0:00:09
837500 -- (-387.043) (-388.466) [-387.952] (-387.748) * (-387.116) [-386.871] (-388.900) (-389.176) -- 0:00:09
838000 -- (-389.650) (-393.996) (-388.391) [-388.946] * (-386.774) (-386.312) (-389.729) [-391.676] -- 0:00:09
838500 -- (-389.874) [-392.666] (-389.802) (-387.598) * (-392.947) [-386.335] (-388.505) (-388.599) -- 0:00:09
839000 -- [-386.890] (-391.306) (-386.558) (-387.364) * (-386.884) (-388.888) [-390.847] (-389.426) -- 0:00:09
839500 -- (-394.146) (-386.912) [-386.774] (-388.492) * [-387.388] (-391.200) (-389.980) (-396.285) -- 0:00:09
840000 -- (-390.654) (-387.509) [-387.508] (-387.710) * (-389.417) (-391.185) [-390.728] (-388.911) -- 0:00:09
Average standard deviation of split frequencies: 0.006953
840500 -- [-391.236] (-387.306) (-388.992) (-391.990) * (-389.634) (-387.064) [-387.840] (-391.496) -- 0:00:09
841000 -- (-388.027) (-389.357) (-388.912) [-388.528] * (-389.828) (-388.318) [-389.649] (-390.345) -- 0:00:09
841500 -- (-390.845) [-387.960] (-387.887) (-389.990) * (-390.944) (-392.450) [-390.230] (-386.549) -- 0:00:09
842000 -- (-393.975) (-387.911) (-386.225) [-386.272] * (-390.105) (-391.981) (-388.544) [-386.619] -- 0:00:09
842500 -- (-389.941) (-389.701) (-386.730) [-387.652] * (-388.779) [-391.794] (-387.417) (-390.619) -- 0:00:09
843000 -- [-387.638] (-386.918) (-387.522) (-389.407) * [-387.231] (-390.103) (-388.535) (-386.271) -- 0:00:09
843500 -- (-388.204) (-388.574) (-390.314) [-388.921] * (-388.879) [-389.399] (-389.708) (-388.802) -- 0:00:09
844000 -- (-392.371) (-387.999) (-390.461) [-389.781] * (-388.932) [-388.237] (-387.733) (-389.664) -- 0:00:09
844500 -- (-389.603) (-391.897) (-389.257) [-388.237] * [-387.484] (-389.452) (-389.252) (-386.764) -- 0:00:09
845000 -- (-393.199) (-387.551) (-390.051) [-389.522] * (-390.136) [-387.552] (-392.493) (-388.879) -- 0:00:09
Average standard deviation of split frequencies: 0.007170
845500 -- (-395.434) (-393.088) [-388.271] (-388.405) * [-388.980] (-388.809) (-392.551) (-387.804) -- 0:00:09
846000 -- (-395.140) (-391.033) (-387.434) [-387.094] * (-387.409) (-388.125) (-388.440) [-387.229] -- 0:00:09
846500 -- (-393.539) [-388.053] (-387.453) (-387.091) * [-388.093] (-387.693) (-388.568) (-390.648) -- 0:00:09
847000 -- (-387.661) (-387.265) (-388.475) [-388.617] * (-387.179) [-387.948] (-389.534) (-387.027) -- 0:00:09
847500 -- [-390.476] (-386.487) (-388.741) (-387.237) * [-390.630] (-387.322) (-386.844) (-387.615) -- 0:00:08
848000 -- (-390.946) (-387.739) (-388.493) [-388.165] * (-389.151) (-387.818) (-388.081) [-387.982] -- 0:00:08
848500 -- (-394.597) [-386.980] (-386.729) (-388.931) * (-389.742) [-387.705] (-389.852) (-388.719) -- 0:00:08
849000 -- [-393.328] (-389.541) (-389.186) (-390.167) * (-389.593) [-387.401] (-389.152) (-393.463) -- 0:00:08
849500 -- (-390.796) (-387.142) (-387.846) [-387.424] * (-386.804) (-386.846) (-386.432) [-388.012] -- 0:00:08
850000 -- (-386.728) (-388.897) [-387.942] (-388.008) * [-389.599] (-388.416) (-389.150) (-389.434) -- 0:00:08
Average standard deviation of split frequencies: 0.007574
850500 -- (-389.021) (-388.661) (-386.289) [-389.746] * (-387.198) (-388.412) [-387.905] (-386.939) -- 0:00:08
851000 -- (-388.917) (-387.690) (-387.529) [-387.739] * (-387.916) [-392.840] (-389.764) (-387.073) -- 0:00:08
851500 -- (-391.421) [-389.905] (-387.848) (-387.398) * (-389.282) (-392.689) (-387.269) [-387.150] -- 0:00:08
852000 -- (-388.677) (-387.191) [-387.306] (-389.543) * (-389.024) (-388.283) [-386.376] (-388.019) -- 0:00:08
852500 -- (-389.945) (-387.455) [-387.407] (-389.127) * (-389.854) (-389.903) (-389.823) [-389.522] -- 0:00:08
853000 -- (-388.393) [-386.516] (-387.754) (-396.973) * (-388.757) (-391.107) (-387.491) [-388.470] -- 0:00:08
853500 -- (-387.753) [-388.671] (-389.336) (-396.223) * (-388.365) (-393.563) (-387.961) [-388.999] -- 0:00:08
854000 -- [-386.890] (-387.899) (-391.439) (-388.672) * (-388.325) (-390.573) [-389.976] (-389.125) -- 0:00:08
854500 -- (-388.723) (-389.110) (-390.222) [-388.566] * (-388.155) (-392.309) (-390.423) [-388.864] -- 0:00:08
855000 -- [-390.816] (-391.287) (-391.725) (-389.187) * (-388.648) (-388.840) (-386.897) [-387.468] -- 0:00:08
Average standard deviation of split frequencies: 0.007435
855500 -- [-392.454] (-390.418) (-390.666) (-387.090) * (-388.155) (-387.452) (-386.658) [-387.687] -- 0:00:08
856000 -- (-389.243) (-390.490) [-388.321] (-387.225) * [-392.754] (-388.783) (-388.234) (-390.891) -- 0:00:08
856500 -- (-388.319) [-388.042] (-387.422) (-388.024) * (-387.755) (-386.463) (-388.294) [-388.173] -- 0:00:08
857000 -- [-387.716] (-388.373) (-389.566) (-388.255) * (-388.189) [-389.073] (-388.142) (-387.517) -- 0:00:08
857500 -- (-391.914) [-388.329] (-387.353) (-388.425) * [-389.703] (-387.866) (-386.696) (-387.138) -- 0:00:08
858000 -- (-391.490) [-387.867] (-387.327) (-386.801) * (-388.187) (-387.537) (-388.330) [-387.277] -- 0:00:08
858500 -- [-388.724] (-386.926) (-389.949) (-386.512) * (-389.210) [-387.193] (-386.696) (-387.336) -- 0:00:08
859000 -- (-388.617) (-388.563) [-387.616] (-388.609) * [-387.506] (-389.663) (-387.456) (-388.362) -- 0:00:08
859500 -- (-388.582) (-389.192) (-391.446) [-387.184] * (-388.528) [-386.901] (-388.033) (-394.239) -- 0:00:08
860000 -- (-389.800) [-386.564] (-390.741) (-388.307) * (-389.178) [-387.854] (-388.503) (-391.633) -- 0:00:08
Average standard deviation of split frequencies: 0.007632
860500 -- [-387.782] (-387.073) (-388.548) (-388.704) * [-386.725] (-388.632) (-392.056) (-389.767) -- 0:00:08
861000 -- (-391.187) (-386.835) (-389.799) [-389.332] * (-391.553) (-388.870) (-387.037) [-390.312] -- 0:00:08
861500 -- [-389.243] (-388.681) (-389.209) (-388.570) * (-388.022) [-386.869] (-390.225) (-388.738) -- 0:00:08
862000 -- [-388.707] (-388.646) (-390.328) (-388.910) * (-389.823) (-387.838) (-387.513) [-387.187] -- 0:00:08
862500 -- [-387.138] (-386.996) (-390.189) (-388.229) * (-388.678) [-387.233] (-389.718) (-387.898) -- 0:00:08
863000 -- (-387.906) [-386.624] (-388.332) (-388.170) * [-389.125] (-389.235) (-390.136) (-389.480) -- 0:00:08
863500 -- (-389.724) (-386.707) (-387.576) [-390.739] * (-390.377) (-391.057) (-390.367) [-387.047] -- 0:00:08
864000 -- (-388.353) [-388.887] (-388.189) (-387.896) * (-390.843) (-390.750) (-390.079) [-389.839] -- 0:00:08
864500 -- (-388.783) [-387.443] (-387.334) (-388.935) * (-393.342) [-386.687] (-387.157) (-389.640) -- 0:00:07
865000 -- [-388.356] (-388.773) (-388.209) (-387.333) * (-387.231) (-388.498) [-390.259] (-387.062) -- 0:00:07
Average standard deviation of split frequencies: 0.007689
865500 -- (-390.493) (-389.640) (-390.255) [-388.893] * (-387.435) [-387.039] (-391.008) (-391.218) -- 0:00:07
866000 -- (-390.412) (-387.262) [-389.153] (-387.706) * (-391.527) [-388.568] (-395.169) (-389.851) -- 0:00:07
866500 -- (-390.270) [-391.249] (-389.339) (-389.682) * (-389.565) [-387.542] (-388.402) (-389.499) -- 0:00:07
867000 -- [-387.660] (-391.003) (-388.575) (-387.632) * [-387.049] (-388.003) (-392.783) (-386.927) -- 0:00:07
867500 -- (-387.393) (-388.549) [-388.591] (-390.098) * [-387.472] (-388.537) (-394.387) (-386.963) -- 0:00:07
868000 -- (-386.745) (-393.360) (-391.545) [-387.589] * (-388.964) (-389.634) (-387.855) [-386.496] -- 0:00:07
868500 -- [-389.582] (-390.996) (-392.289) (-387.293) * [-388.328] (-386.809) (-390.571) (-392.288) -- 0:00:07
869000 -- (-390.240) (-388.631) [-390.217] (-387.999) * [-387.025] (-394.020) (-387.595) (-387.716) -- 0:00:07
869500 -- [-388.537] (-387.374) (-389.211) (-387.066) * [-390.995] (-394.651) (-386.822) (-392.321) -- 0:00:07
870000 -- (-390.585) [-389.036] (-390.371) (-387.754) * (-389.154) (-389.450) [-388.928] (-388.146) -- 0:00:07
Average standard deviation of split frequencies: 0.007869
870500 -- (-387.515) [-387.327] (-389.840) (-387.811) * (-388.831) (-387.713) (-390.991) [-389.460] -- 0:00:07
871000 -- (-389.817) [-387.698] (-388.355) (-387.847) * (-392.924) (-388.690) [-386.215] (-387.931) -- 0:00:07
871500 -- (-389.515) [-389.228] (-390.042) (-394.998) * (-387.102) [-389.900] (-386.194) (-388.359) -- 0:00:07
872000 -- (-387.866) (-389.436) (-387.256) [-386.640] * (-387.015) (-390.430) [-387.365] (-388.535) -- 0:00:07
872500 -- (-388.772) (-390.223) (-387.479) [-387.123] * (-386.882) (-393.337) (-387.440) [-389.036] -- 0:00:07
873000 -- (-390.067) (-392.436) [-389.316] (-387.522) * (-387.715) [-389.634] (-386.870) (-386.739) -- 0:00:07
873500 -- [-388.500] (-388.756) (-388.778) (-386.966) * (-388.753) [-387.738] (-388.280) (-386.378) -- 0:00:07
874000 -- (-389.131) (-390.435) (-389.335) [-388.261] * [-388.901] (-388.165) (-389.231) (-386.627) -- 0:00:07
874500 -- (-387.883) [-388.867] (-389.807) (-387.122) * (-390.211) [-387.161] (-387.176) (-387.803) -- 0:00:07
875000 -- (-386.367) [-388.317] (-389.547) (-387.161) * (-388.737) (-387.582) (-391.316) [-387.523] -- 0:00:07
Average standard deviation of split frequencies: 0.008108
875500 -- (-387.369) (-386.981) (-391.048) [-387.187] * (-388.713) (-392.895) [-387.532] (-388.544) -- 0:00:07
876000 -- (-388.038) (-387.438) [-387.706] (-386.370) * (-389.354) [-394.506] (-387.489) (-387.702) -- 0:00:07
876500 -- (-388.753) [-387.562] (-387.251) (-390.504) * (-386.710) [-387.693] (-388.865) (-395.534) -- 0:00:07
877000 -- (-390.807) [-386.999] (-387.519) (-388.586) * [-388.046] (-388.046) (-388.413) (-388.186) -- 0:00:07
877500 -- (-387.299) (-392.445) [-389.299] (-389.391) * (-391.047) [-386.725] (-389.285) (-390.493) -- 0:00:07
878000 -- (-387.144) [-388.151] (-389.484) (-387.641) * [-388.348] (-387.745) (-390.087) (-395.758) -- 0:00:07
878500 -- [-389.171] (-387.951) (-388.781) (-386.434) * (-387.895) (-388.094) (-387.042) [-386.796] -- 0:00:07
879000 -- (-392.154) (-393.746) [-388.426] (-386.747) * (-388.614) (-390.841) [-387.191] (-392.628) -- 0:00:07
879500 -- (-386.993) (-392.493) (-393.111) [-389.344] * (-389.214) (-388.079) (-393.045) [-390.932] -- 0:00:07
880000 -- (-387.476) (-394.704) (-399.428) [-389.925] * [-386.807] (-388.055) (-392.906) (-389.209) -- 0:00:07
Average standard deviation of split frequencies: 0.008422
880500 -- (-388.730) [-388.688] (-387.482) (-390.048) * (-390.984) [-388.732] (-391.720) (-388.710) -- 0:00:07
881000 -- [-391.581] (-387.305) (-388.595) (-388.183) * (-386.489) (-386.939) [-390.567] (-387.974) -- 0:00:07
881500 -- [-389.340] (-387.833) (-387.072) (-388.957) * (-390.589) [-391.770] (-386.589) (-387.822) -- 0:00:06
882000 -- [-388.409] (-386.855) (-394.993) (-387.630) * (-388.204) (-388.273) (-388.429) [-386.695] -- 0:00:06
882500 -- (-389.098) (-388.618) [-388.161] (-391.806) * (-388.124) (-388.091) (-387.866) [-387.025] -- 0:00:06
883000 -- (-389.172) (-388.736) [-388.274] (-387.086) * (-391.308) [-387.729] (-389.530) (-387.604) -- 0:00:06
883500 -- (-387.879) [-388.993] (-387.463) (-391.049) * [-388.902] (-386.993) (-386.668) (-388.485) -- 0:00:06
884000 -- (-389.350) [-390.712] (-387.559) (-389.180) * [-389.045] (-387.026) (-388.323) (-389.313) -- 0:00:06
884500 -- (-389.603) (-387.535) [-386.922] (-391.202) * [-389.592] (-388.492) (-387.258) (-386.858) -- 0:00:06
885000 -- [-390.430] (-388.889) (-387.706) (-387.151) * (-391.133) [-388.686] (-391.431) (-387.796) -- 0:00:06
Average standard deviation of split frequencies: 0.008313
885500 -- (-387.135) (-387.432) [-389.993] (-387.317) * (-387.978) (-391.066) [-389.591] (-388.600) -- 0:00:06
886000 -- (-390.049) [-387.295] (-393.512) (-390.162) * (-387.301) [-388.748] (-394.972) (-388.655) -- 0:00:06
886500 -- (-386.981) (-391.213) [-386.380] (-391.607) * (-389.846) (-392.570) (-392.182) [-386.655] -- 0:00:06
887000 -- (-389.470) (-387.133) [-392.120] (-389.458) * (-388.419) (-390.986) (-389.771) [-388.143] -- 0:00:06
887500 -- (-388.384) (-386.841) (-388.754) [-389.785] * [-388.199] (-392.034) (-386.653) (-388.090) -- 0:00:06
888000 -- (-387.112) [-387.307] (-389.660) (-389.539) * (-390.626) (-387.756) [-387.578] (-386.822) -- 0:00:06
888500 -- (-390.053) (-387.184) (-389.118) [-388.982] * (-389.217) (-390.566) (-386.860) [-388.087] -- 0:00:06
889000 -- (-390.818) [-391.370] (-388.340) (-387.205) * (-386.264) (-387.879) [-388.131] (-387.493) -- 0:00:06
889500 -- (-387.086) [-386.312] (-388.523) (-387.626) * [-388.224] (-387.861) (-387.354) (-389.135) -- 0:00:06
890000 -- (-386.459) [-388.129] (-387.760) (-390.520) * [-387.746] (-387.649) (-386.272) (-395.798) -- 0:00:06
Average standard deviation of split frequencies: 0.008402
890500 -- (-387.000) [-389.123] (-388.327) (-386.790) * (-390.477) [-388.973] (-387.438) (-398.443) -- 0:00:06
891000 -- (-388.810) [-387.373] (-389.020) (-388.355) * (-386.600) (-387.956) (-386.653) [-389.116] -- 0:00:06
891500 -- (-387.255) (-390.512) [-389.503] (-390.360) * (-387.512) (-387.327) [-389.823] (-389.209) -- 0:00:06
892000 -- [-388.218] (-387.607) (-388.228) (-389.448) * (-386.763) (-391.489) (-389.584) [-387.092] -- 0:00:06
892500 -- (-389.988) (-393.956) [-387.077] (-387.060) * [-390.751] (-393.418) (-388.320) (-388.443) -- 0:00:06
893000 -- (-392.823) [-387.808] (-386.269) (-388.556) * (-391.765) [-387.372] (-386.876) (-390.930) -- 0:00:06
893500 -- (-389.231) [-389.416] (-387.153) (-387.238) * (-387.627) (-387.773) [-387.134] (-387.366) -- 0:00:06
894000 -- (-389.692) [-386.535] (-387.851) (-387.091) * (-390.000) [-388.684] (-387.122) (-388.039) -- 0:00:06
894500 -- (-388.949) (-389.228) (-389.636) [-386.934] * (-388.263) (-387.329) (-391.532) [-389.671] -- 0:00:06
895000 -- (-386.151) [-386.942] (-387.930) (-388.502) * (-387.184) (-390.162) (-390.596) [-386.554] -- 0:00:06
Average standard deviation of split frequencies: 0.008714
895500 -- (-386.642) [-387.299] (-387.783) (-386.553) * [-388.099] (-387.467) (-391.506) (-391.696) -- 0:00:06
896000 -- (-386.765) [-386.150] (-387.895) (-389.185) * (-388.307) (-386.942) [-388.539] (-387.113) -- 0:00:06
896500 -- [-386.896] (-388.944) (-387.419) (-391.457) * (-389.560) (-386.848) [-388.991] (-387.098) -- 0:00:06
897000 -- [-389.199] (-389.035) (-387.419) (-390.303) * (-391.236) (-387.533) (-398.960) [-387.969] -- 0:00:06
897500 -- (-395.425) [-387.542] (-387.030) (-389.861) * (-391.289) (-387.700) (-388.119) [-388.502] -- 0:00:06
898000 -- (-392.383) (-387.883) [-387.240] (-387.827) * (-389.655) (-387.498) (-388.073) [-387.778] -- 0:00:06
898500 -- [-390.558] (-386.376) (-391.219) (-390.047) * (-389.511) [-388.909] (-387.328) (-388.318) -- 0:00:05
899000 -- (-389.334) [-387.239] (-394.251) (-390.752) * [-387.872] (-387.912) (-388.747) (-387.351) -- 0:00:05
899500 -- (-394.520) (-387.567) (-387.564) [-387.492] * (-386.520) (-389.141) (-388.246) [-388.098] -- 0:00:05
900000 -- (-392.568) (-386.740) (-388.199) [-387.024] * (-387.937) [-389.080] (-388.216) (-391.178) -- 0:00:05
Average standard deviation of split frequencies: 0.009177
900500 -- (-392.153) (-387.258) [-388.959] (-387.674) * (-387.902) (-386.893) [-386.569] (-391.183) -- 0:00:05
901000 -- (-389.942) (-387.706) [-387.482] (-386.598) * (-387.496) [-391.428] (-389.410) (-387.625) -- 0:00:05
901500 -- [-387.831] (-387.415) (-391.227) (-387.761) * (-388.079) (-390.481) (-390.641) [-387.192] -- 0:00:05
902000 -- [-386.972] (-388.215) (-389.694) (-386.628) * (-386.702) (-389.905) (-390.199) [-387.065] -- 0:00:05
902500 -- (-388.584) (-388.577) [-389.409] (-387.691) * [-387.738] (-387.690) (-387.393) (-388.909) -- 0:00:05
903000 -- (-388.502) [-387.981] (-386.789) (-387.576) * (-388.768) [-388.301] (-387.828) (-391.431) -- 0:00:05
903500 -- (-387.818) (-389.943) [-386.330] (-391.925) * [-386.978] (-392.502) (-389.961) (-387.647) -- 0:00:05
904000 -- (-390.043) (-387.000) [-389.181] (-387.605) * (-386.799) [-387.072] (-387.184) (-387.692) -- 0:00:05
904500 -- (-388.485) (-387.003) [-389.927] (-387.148) * [-390.769] (-390.476) (-389.800) (-388.008) -- 0:00:05
905000 -- [-387.629] (-386.788) (-389.782) (-386.858) * (-390.666) (-393.197) [-388.480] (-389.690) -- 0:00:05
Average standard deviation of split frequencies: 0.008553
905500 -- (-388.732) (-392.644) (-391.244) [-387.810] * (-389.020) [-389.782] (-391.078) (-388.064) -- 0:00:05
906000 -- (-388.453) (-394.024) [-389.986] (-390.356) * (-388.393) (-387.916) [-386.828] (-387.379) -- 0:00:05
906500 -- (-386.835) (-391.482) (-387.940) [-388.660] * [-386.133] (-387.886) (-389.933) (-390.321) -- 0:00:05
907000 -- [-388.765] (-388.280) (-386.865) (-387.625) * (-387.041) (-388.641) (-394.786) [-389.253] -- 0:00:05
907500 -- (-389.783) (-388.006) (-386.787) [-391.748] * (-388.429) [-387.301] (-391.776) (-389.085) -- 0:00:05
908000 -- (-387.921) [-388.445] (-395.046) (-388.399) * [-388.836] (-386.650) (-389.057) (-387.415) -- 0:00:05
908500 -- (-389.387) [-388.278] (-395.743) (-388.610) * (-390.399) (-388.255) [-388.537] (-386.732) -- 0:00:05
909000 -- (-388.371) (-390.472) (-386.894) [-389.046] * (-390.547) (-389.539) [-388.969] (-386.637) -- 0:00:05
909500 -- (-388.698) (-389.002) [-387.556] (-390.771) * [-387.493] (-387.083) (-397.938) (-388.255) -- 0:00:05
910000 -- (-391.135) (-387.460) (-390.747) [-389.651] * (-388.266) [-386.536] (-389.029) (-389.205) -- 0:00:05
Average standard deviation of split frequencies: 0.009105
910500 -- (-389.806) (-387.711) [-388.279] (-388.732) * (-389.960) (-389.779) [-387.065] (-390.992) -- 0:00:05
911000 -- [-391.471] (-388.726) (-389.372) (-386.994) * [-388.059] (-389.170) (-386.361) (-387.117) -- 0:00:05
911500 -- (-388.179) (-389.705) (-387.496) [-388.728] * (-388.892) [-389.893] (-388.254) (-388.292) -- 0:00:05
912000 -- (-389.831) (-389.652) [-392.876] (-387.945) * (-388.366) (-391.546) [-387.176] (-386.706) -- 0:00:05
912500 -- (-390.366) (-387.513) [-392.081] (-387.538) * (-389.036) (-389.593) (-388.354) [-389.271] -- 0:00:05
913000 -- (-388.554) [-390.224] (-389.380) (-389.687) * (-392.571) (-389.263) (-386.356) [-390.975] -- 0:00:05
913500 -- [-389.284] (-396.602) (-387.524) (-392.494) * (-390.324) [-387.256] (-389.070) (-388.639) -- 0:00:05
914000 -- [-388.307] (-388.314) (-389.780) (-389.544) * (-388.353) [-388.140] (-388.323) (-390.225) -- 0:00:05
914500 -- (-387.376) [-388.625] (-389.713) (-387.992) * (-386.843) (-386.896) (-387.108) [-388.139] -- 0:00:05
915000 -- (-388.071) [-387.500] (-394.514) (-387.156) * (-387.498) [-386.890] (-391.326) (-386.896) -- 0:00:05
Average standard deviation of split frequencies: 0.009324
915500 -- [-387.101] (-390.523) (-393.517) (-388.722) * [-386.446] (-387.420) (-394.003) (-387.262) -- 0:00:04
916000 -- [-387.056] (-388.186) (-387.985) (-389.968) * (-387.790) [-387.412] (-392.691) (-387.929) -- 0:00:04
916500 -- (-387.101) [-387.913] (-392.028) (-389.415) * (-388.954) (-387.231) [-392.085] (-386.424) -- 0:00:04
917000 -- [-387.214] (-387.812) (-392.560) (-388.855) * (-387.766) (-388.186) (-389.625) [-387.036] -- 0:00:04
917500 -- (-387.963) [-392.334] (-388.050) (-388.310) * (-387.460) [-389.091] (-389.457) (-387.383) -- 0:00:04
918000 -- (-391.200) (-389.486) [-388.403] (-386.973) * (-389.944) (-389.850) [-389.851] (-387.989) -- 0:00:04
918500 -- [-388.941] (-388.000) (-386.458) (-389.131) * [-390.473] (-388.905) (-389.880) (-387.821) -- 0:00:04
919000 -- (-388.698) (-388.428) (-393.053) [-389.376] * [-386.394] (-387.881) (-393.620) (-386.437) -- 0:00:04
919500 -- (-390.090) (-389.592) (-392.863) [-386.756] * [-386.497] (-390.702) (-392.173) (-391.173) -- 0:00:04
920000 -- (-390.236) (-388.636) (-387.350) [-387.787] * (-389.339) (-387.743) (-389.034) [-387.656] -- 0:00:04
Average standard deviation of split frequencies: 0.009277
920500 -- (-392.786) [-388.471] (-388.752) (-387.960) * [-389.502] (-392.473) (-389.372) (-387.647) -- 0:00:04
921000 -- (-388.569) (-388.167) (-388.667) [-387.165] * (-387.673) (-387.686) (-390.206) [-388.294] -- 0:00:04
921500 -- (-387.858) (-388.844) [-393.566] (-387.657) * (-387.847) (-390.793) (-386.867) [-393.609] -- 0:00:04
922000 -- (-389.297) (-391.904) (-392.939) [-387.623] * (-389.375) (-389.432) (-386.897) [-391.347] -- 0:00:04
922500 -- (-388.690) (-389.048) [-389.681] (-388.511) * [-387.177] (-387.203) (-387.784) (-388.669) -- 0:00:04
923000 -- (-388.149) [-389.131] (-391.580) (-389.206) * (-387.058) (-390.787) [-387.463] (-387.316) -- 0:00:04
923500 -- (-389.467) (-391.197) (-391.681) [-390.054] * (-388.815) (-391.413) (-387.353) [-388.627] -- 0:00:04
924000 -- (-387.791) (-387.705) [-389.031] (-388.107) * (-387.611) [-387.616] (-388.212) (-388.598) -- 0:00:04
924500 -- [-387.665] (-388.429) (-387.380) (-390.485) * [-388.284] (-387.230) (-387.661) (-387.837) -- 0:00:04
925000 -- [-387.150] (-388.582) (-389.503) (-394.447) * (-387.150) (-390.294) [-387.068] (-390.838) -- 0:00:04
Average standard deviation of split frequencies: 0.009014
925500 -- (-393.687) [-386.570] (-387.201) (-391.354) * (-387.706) (-389.299) [-386.989] (-395.340) -- 0:00:04
926000 -- (-387.581) (-387.629) [-388.061] (-388.664) * [-387.653] (-388.708) (-388.800) (-390.017) -- 0:00:04
926500 -- [-390.790] (-386.740) (-388.874) (-389.019) * [-389.407] (-388.989) (-387.237) (-390.681) -- 0:00:04
927000 -- (-388.300) [-386.816] (-387.930) (-390.198) * (-388.981) [-389.531] (-387.569) (-388.564) -- 0:00:04
927500 -- (-390.660) (-388.360) [-387.295] (-389.111) * [-388.111] (-391.832) (-387.596) (-387.781) -- 0:00:04
928000 -- [-389.272] (-389.815) (-390.037) (-388.410) * (-387.622) (-388.765) (-386.741) [-387.877] -- 0:00:04
928500 -- (-387.524) (-386.886) [-386.538] (-387.001) * (-387.492) [-388.310] (-387.375) (-388.947) -- 0:00:04
929000 -- (-386.852) [-386.584] (-388.932) (-388.641) * (-387.732) (-388.879) [-389.830] (-387.828) -- 0:00:04
929500 -- (-392.046) (-386.683) (-386.940) [-387.975] * (-390.804) (-386.761) (-386.783) [-388.379] -- 0:00:04
930000 -- [-397.640] (-387.682) (-387.072) (-389.777) * [-388.163] (-392.073) (-393.358) (-392.312) -- 0:00:04
Average standard deviation of split frequencies: 0.009212
930500 -- [-387.984] (-389.744) (-387.641) (-389.091) * (-389.881) (-387.635) (-386.777) [-389.538] -- 0:00:04
931000 -- [-388.429] (-394.168) (-386.871) (-390.223) * (-391.068) (-388.095) (-387.372) [-388.335] -- 0:00:04
931500 -- [-391.072] (-392.077) (-386.924) (-390.221) * (-391.663) (-388.641) (-387.651) [-391.039] -- 0:00:04
932000 -- (-388.612) (-388.301) [-386.832] (-389.104) * (-389.228) (-394.962) [-388.425] (-390.616) -- 0:00:04
932500 -- (-390.007) (-388.210) [-387.810] (-387.312) * (-387.589) (-389.295) [-386.928] (-386.928) -- 0:00:03
933000 -- (-392.174) (-387.753) [-389.467] (-388.619) * (-391.241) (-389.500) (-390.600) [-387.471] -- 0:00:03
933500 -- (-392.646) [-386.905] (-387.715) (-387.598) * [-388.587] (-386.455) (-390.622) (-388.953) -- 0:00:03
934000 -- (-387.142) [-390.543] (-389.511) (-386.858) * (-388.435) [-391.168] (-389.325) (-395.582) -- 0:00:03
934500 -- (-386.962) [-386.755] (-387.319) (-386.786) * (-390.769) [-391.585] (-387.451) (-389.986) -- 0:00:03
935000 -- (-388.129) (-387.235) [-388.887] (-389.390) * (-389.087) (-390.670) (-389.033) [-391.577] -- 0:00:03
Average standard deviation of split frequencies: 0.009349
935500 -- (-389.152) (-387.238) [-386.845] (-387.327) * (-388.614) (-387.689) (-388.296) [-388.920] -- 0:00:03
936000 -- [-393.089] (-387.986) (-386.948) (-390.342) * [-387.745] (-391.226) (-387.628) (-390.841) -- 0:00:03
936500 -- (-389.350) [-387.765] (-386.846) (-391.192) * (-387.379) (-388.995) (-387.122) [-387.004] -- 0:00:03
937000 -- (-387.493) (-386.722) [-388.002] (-387.162) * [-390.133] (-390.946) (-387.147) (-389.852) -- 0:00:03
937500 -- [-387.871] (-388.499) (-386.052) (-386.776) * [-387.844] (-391.534) (-387.426) (-391.162) -- 0:00:03
938000 -- (-389.099) [-387.797] (-386.052) (-386.775) * (-387.969) [-392.363] (-388.349) (-391.098) -- 0:00:03
938500 -- (-389.431) (-386.511) (-389.624) [-387.598] * (-387.074) [-386.890] (-388.239) (-389.324) -- 0:00:03
939000 -- (-391.213) [-387.254] (-389.275) (-388.392) * (-387.430) [-389.204] (-387.292) (-389.098) -- 0:00:03
939500 -- (-390.791) [-388.414] (-390.026) (-387.668) * (-389.313) [-390.627] (-387.776) (-387.800) -- 0:00:03
940000 -- (-388.009) (-392.082) (-389.165) [-389.947] * (-386.609) [-387.393] (-390.078) (-388.840) -- 0:00:03
Average standard deviation of split frequencies: 0.008987
940500 -- (-389.287) (-389.848) [-390.674] (-390.556) * (-387.705) (-388.951) (-389.419) [-390.612] -- 0:00:03
941000 -- (-390.840) (-394.784) [-392.571] (-387.430) * [-386.526] (-391.084) (-387.384) (-387.529) -- 0:00:03
941500 -- (-389.252) [-388.525] (-388.320) (-386.626) * (-387.149) (-387.231) [-389.891] (-389.597) -- 0:00:03
942000 -- (-388.213) (-387.672) (-389.243) [-389.261] * [-387.087] (-387.992) (-391.211) (-389.047) -- 0:00:03
942500 -- (-386.958) (-391.585) [-388.873] (-389.086) * (-388.409) (-387.950) (-392.536) [-392.405] -- 0:00:03
943000 -- (-388.927) (-390.795) (-389.853) [-388.519] * (-390.214) (-387.696) (-388.239) [-388.091] -- 0:00:03
943500 -- [-389.070] (-389.346) (-388.981) (-387.720) * [-390.664] (-387.686) (-386.607) (-390.714) -- 0:00:03
944000 -- (-389.639) [-392.051] (-388.090) (-386.724) * [-388.957] (-387.373) (-389.060) (-389.047) -- 0:00:03
944500 -- (-390.985) [-387.750] (-388.464) (-386.721) * [-388.089] (-387.710) (-388.602) (-390.273) -- 0:00:03
945000 -- (-388.945) (-389.557) [-391.557] (-386.604) * [-387.918] (-390.243) (-391.070) (-390.748) -- 0:00:03
Average standard deviation of split frequencies: 0.009103
945500 -- (-386.355) (-388.767) [-386.877] (-388.410) * [-388.042] (-394.704) (-394.628) (-393.350) -- 0:00:03
946000 -- [-389.266] (-388.672) (-387.026) (-386.894) * (-387.195) (-391.540) [-387.452] (-390.028) -- 0:00:03
946500 -- [-386.858] (-389.946) (-388.442) (-391.011) * (-387.267) [-386.988] (-386.354) (-387.137) -- 0:00:03
947000 -- [-387.530] (-386.506) (-392.157) (-388.347) * (-388.843) (-387.693) [-386.831] (-387.492) -- 0:00:03
947500 -- [-387.962] (-388.685) (-391.473) (-390.282) * (-387.148) (-389.974) (-386.277) [-389.322] -- 0:00:03
948000 -- [-387.349] (-387.142) (-396.139) (-388.355) * (-387.240) [-386.889] (-386.425) (-390.948) -- 0:00:03
948500 -- [-386.318] (-388.070) (-389.109) (-391.015) * [-387.444] (-389.039) (-389.448) (-389.155) -- 0:00:03
949000 -- [-388.858] (-388.574) (-389.257) (-386.844) * (-387.067) [-390.115] (-388.723) (-390.112) -- 0:00:03
949500 -- (-389.472) [-389.655] (-390.036) (-386.953) * [-387.646] (-386.904) (-387.973) (-389.495) -- 0:00:02
950000 -- (-388.005) [-388.511] (-392.241) (-389.890) * (-390.193) (-387.309) (-389.173) [-387.898] -- 0:00:02
Average standard deviation of split frequencies: 0.009124
950500 -- (-388.773) (-388.565) (-391.905) [-389.683] * (-389.578) [-390.115] (-393.494) (-388.911) -- 0:00:02
951000 -- (-386.911) (-392.318) (-387.924) [-387.019] * (-388.220) [-388.463] (-390.274) (-388.573) -- 0:00:02
951500 -- (-392.568) [-387.288] (-390.139) (-391.644) * [-387.157] (-388.720) (-388.022) (-386.783) -- 0:00:02
952000 -- (-390.369) (-387.389) (-389.921) [-387.298] * (-388.815) [-391.410] (-390.521) (-389.050) -- 0:00:02
952500 -- (-393.997) [-387.422] (-387.155) (-388.214) * (-388.459) (-390.018) (-389.949) [-386.635] -- 0:00:02
953000 -- [-387.901] (-389.247) (-390.005) (-388.043) * (-389.508) (-387.927) (-388.110) [-387.684] -- 0:00:02
953500 -- (-390.126) (-386.704) (-388.217) [-388.009] * (-390.941) (-389.247) [-389.469] (-387.465) -- 0:00:02
954000 -- (-389.539) (-390.576) [-388.403] (-388.439) * (-389.269) [-387.623] (-392.987) (-386.802) -- 0:00:02
954500 -- (-390.841) (-390.132) (-388.850) [-388.584] * [-386.932] (-389.654) (-390.406) (-387.502) -- 0:00:02
955000 -- [-387.861] (-391.459) (-390.669) (-388.524) * (-387.866) (-390.780) [-387.387] (-389.332) -- 0:00:02
Average standard deviation of split frequencies: 0.009215
955500 -- [-388.506] (-386.842) (-389.074) (-387.244) * (-387.638) (-388.169) [-386.286] (-389.557) -- 0:00:02
956000 -- (-387.776) (-387.873) (-390.428) [-387.630] * [-387.340] (-387.230) (-389.677) (-390.484) -- 0:00:02
956500 -- (-389.677) (-386.740) (-388.976) [-388.881] * [-387.137] (-388.088) (-387.334) (-390.216) -- 0:00:02
957000 -- (-389.720) (-387.083) (-390.935) [-391.448] * (-387.764) (-391.178) (-390.139) [-387.444] -- 0:00:02
957500 -- [-387.106] (-386.799) (-388.574) (-388.903) * (-387.728) [-391.402] (-389.443) (-387.192) -- 0:00:02
958000 -- [-388.895] (-386.136) (-388.479) (-391.683) * (-387.519) (-389.119) [-387.482] (-389.187) -- 0:00:02
958500 -- (-388.338) [-386.906] (-387.891) (-391.509) * (-387.462) (-388.118) (-386.162) [-386.647] -- 0:00:02
959000 -- (-390.314) (-388.000) [-387.333] (-387.329) * (-387.351) (-389.012) [-388.970] (-388.185) -- 0:00:02
959500 -- [-389.017] (-387.560) (-389.569) (-391.071) * [-387.860] (-388.446) (-387.389) (-388.375) -- 0:00:02
960000 -- [-389.068] (-391.310) (-389.432) (-387.541) * (-389.992) (-387.552) (-386.631) [-387.451] -- 0:00:02
Average standard deviation of split frequencies: 0.008735
960500 -- (-386.841) (-389.536) (-387.683) [-387.836] * (-388.585) (-387.530) [-386.637] (-388.302) -- 0:00:02
961000 -- (-389.328) (-389.349) [-387.616] (-392.284) * (-389.514) (-386.539) (-387.080) [-387.864] -- 0:00:02
961500 -- [-390.140] (-387.800) (-387.396) (-396.287) * (-387.282) (-389.880) [-387.362] (-387.703) -- 0:00:02
962000 -- (-389.629) (-389.992) [-389.959] (-393.998) * (-387.763) (-391.535) (-387.872) [-386.204] -- 0:00:02
962500 -- [-387.534] (-388.723) (-389.813) (-388.275) * (-387.449) [-388.649] (-391.196) (-388.377) -- 0:00:02
963000 -- (-387.921) (-390.528) [-390.932] (-388.643) * (-386.843) (-388.308) [-388.508] (-389.338) -- 0:00:02
963500 -- (-387.379) [-390.579] (-388.303) (-387.142) * [-388.980] (-389.703) (-387.537) (-386.854) -- 0:00:02
964000 -- (-390.557) (-389.591) (-390.236) [-388.220] * (-387.114) (-389.605) (-390.709) [-386.552] -- 0:00:02
964500 -- (-389.422) (-390.064) [-390.096] (-389.564) * (-389.079) (-388.880) (-389.065) [-387.185] -- 0:00:02
965000 -- (-392.609) (-390.739) (-392.353) [-389.543] * (-389.519) [-388.062] (-392.620) (-387.995) -- 0:00:02
Average standard deviation of split frequencies: 0.008556
965500 -- [-386.460] (-388.544) (-388.815) (-392.115) * (-386.571) [-389.277] (-393.314) (-387.325) -- 0:00:02
966000 -- (-389.979) (-388.119) [-386.559] (-386.480) * [-387.128] (-390.130) (-386.516) (-387.329) -- 0:00:02
966500 -- [-386.714] (-386.560) (-389.159) (-386.529) * (-393.202) (-389.507) (-387.541) [-387.588] -- 0:00:01
967000 -- (-389.382) (-388.819) [-386.475] (-390.848) * (-387.812) (-388.883) [-388.920] (-387.386) -- 0:00:01
967500 -- (-387.561) [-387.149] (-387.571) (-387.161) * (-389.579) [-390.105] (-389.234) (-387.856) -- 0:00:01
968000 -- (-389.948) (-386.417) (-388.373) [-387.815] * [-391.829] (-392.361) (-388.927) (-390.062) -- 0:00:01
968500 -- [-390.036] (-387.053) (-389.842) (-386.709) * [-390.456] (-387.483) (-390.678) (-389.895) -- 0:00:01
969000 -- (-388.761) (-387.184) (-387.184) [-388.058] * (-389.053) [-388.635] (-393.305) (-391.010) -- 0:00:01
969500 -- [-388.201] (-386.578) (-387.224) (-388.317) * (-388.572) [-387.391] (-395.583) (-388.649) -- 0:00:01
970000 -- (-387.859) (-386.142) [-387.227] (-386.910) * (-387.174) (-387.469) (-389.231) [-387.368] -- 0:00:01
Average standard deviation of split frequencies: 0.008353
970500 -- (-386.327) [-388.903] (-389.160) (-389.089) * (-387.321) [-388.530] (-387.249) (-391.709) -- 0:00:01
971000 -- (-387.834) [-388.208] (-387.151) (-386.750) * (-387.312) (-388.044) [-388.012] (-389.928) -- 0:00:01
971500 -- (-388.362) [-390.872] (-387.353) (-387.015) * (-388.579) (-388.140) [-387.827] (-390.963) -- 0:00:01
972000 -- [-388.104] (-387.262) (-391.684) (-387.471) * (-393.075) (-394.266) [-387.355] (-390.401) -- 0:00:01
972500 -- [-390.337] (-389.225) (-389.012) (-389.948) * (-387.747) (-390.096) (-389.288) [-388.041] -- 0:00:01
973000 -- (-388.885) (-389.400) (-388.195) [-388.808] * (-388.289) (-388.188) (-389.010) [-388.292] -- 0:00:01
973500 -- [-387.650] (-386.571) (-392.589) (-387.368) * [-387.111] (-389.163) (-386.950) (-391.483) -- 0:00:01
974000 -- (-388.630) (-387.736) [-386.524] (-388.078) * (-391.026) (-387.751) [-387.826] (-388.196) -- 0:00:01
974500 -- [-388.491] (-389.487) (-387.686) (-387.721) * (-392.117) (-393.723) (-387.730) [-387.672] -- 0:00:01
975000 -- [-386.823] (-391.439) (-388.092) (-388.066) * (-394.467) (-394.931) [-391.734] (-388.446) -- 0:00:01
Average standard deviation of split frequencies: 0.008340
975500 -- [-387.547] (-390.158) (-386.630) (-388.185) * (-391.021) [-389.586] (-394.927) (-390.697) -- 0:00:01
976000 -- (-387.341) (-392.212) (-389.291) [-387.734] * (-389.866) [-388.509] (-390.758) (-390.109) -- 0:00:01
976500 -- [-387.460] (-390.000) (-390.001) (-386.801) * (-389.922) (-390.729) (-388.811) [-387.104] -- 0:00:01
977000 -- (-387.203) (-389.127) (-388.681) [-387.646] * (-388.894) (-391.035) (-389.901) [-387.932] -- 0:00:01
977500 -- (-393.713) (-389.483) [-388.811] (-390.185) * (-387.789) [-391.182] (-387.354) (-389.732) -- 0:00:01
978000 -- (-390.574) [-393.342] (-391.134) (-391.026) * [-390.917] (-388.744) (-388.585) (-391.120) -- 0:00:01
978500 -- (-387.496) [-387.948] (-390.988) (-389.165) * (-387.995) (-390.935) [-389.920] (-389.165) -- 0:00:01
979000 -- [-386.798] (-387.708) (-393.187) (-387.796) * (-386.723) [-393.125] (-390.674) (-392.418) -- 0:00:01
979500 -- (-388.596) (-389.309) (-387.360) [-389.586] * (-386.864) (-388.107) [-388.269] (-387.716) -- 0:00:01
980000 -- (-387.613) [-388.496] (-387.090) (-392.031) * (-386.674) [-388.050] (-390.211) (-387.011) -- 0:00:01
Average standard deviation of split frequencies: 0.008460
980500 -- (-393.324) (-387.562) (-387.158) [-390.878] * (-386.697) [-387.111] (-391.845) (-390.659) -- 0:00:01
981000 -- [-390.821] (-390.737) (-388.305) (-389.798) * (-387.601) [-391.131] (-393.654) (-387.674) -- 0:00:01
981500 -- (-388.894) [-387.013] (-387.552) (-390.275) * (-387.170) [-393.229] (-390.118) (-388.833) -- 0:00:01
982000 -- (-389.454) (-387.482) [-388.949] (-388.818) * [-386.599] (-388.838) (-387.092) (-389.994) -- 0:00:01
982500 -- (-388.836) (-388.106) (-389.229) [-390.284] * (-387.305) (-389.246) (-392.022) [-389.163] -- 0:00:01
983000 -- (-388.414) [-392.170] (-388.153) (-390.373) * (-389.374) [-388.879] (-391.969) (-389.773) -- 0:00:01
983500 -- (-386.736) [-387.197] (-387.571) (-390.503) * (-387.562) [-390.791] (-390.419) (-388.801) -- 0:00:00
984000 -- [-388.982] (-388.161) (-387.537) (-389.347) * (-387.054) (-390.054) (-392.787) [-386.889] -- 0:00:00
984500 -- [-387.263] (-387.357) (-387.277) (-391.874) * [-390.215] (-387.593) (-388.320) (-388.579) -- 0:00:00
985000 -- (-386.524) (-386.988) [-389.848] (-389.678) * [-390.162] (-387.723) (-386.852) (-389.501) -- 0:00:00
Average standard deviation of split frequencies: 0.008032
985500 -- (-390.815) [-388.480] (-388.201) (-388.351) * (-390.366) (-389.550) [-391.038] (-386.776) -- 0:00:00
986000 -- (-389.045) (-390.827) [-389.141] (-387.808) * (-390.906) (-388.817) [-389.009] (-388.893) -- 0:00:00
986500 -- [-387.755] (-387.840) (-391.324) (-387.185) * (-388.695) (-389.525) [-387.359] (-392.988) -- 0:00:00
987000 -- (-388.553) (-387.123) (-391.680) [-386.732] * (-387.987) [-388.693] (-387.022) (-390.265) -- 0:00:00
987500 -- (-386.928) [-386.272] (-388.102) (-387.416) * [-387.442] (-388.210) (-386.776) (-390.382) -- 0:00:00
988000 -- (-388.595) (-386.542) [-388.376] (-387.603) * (-387.170) (-386.414) (-388.384) [-390.617] -- 0:00:00
988500 -- (-387.268) (-386.281) [-386.844] (-390.071) * (-388.529) (-386.871) (-390.699) [-391.225] -- 0:00:00
989000 -- (-390.394) (-389.536) (-386.538) [-394.774] * (-388.899) (-388.162) (-391.486) [-389.807] -- 0:00:00
989500 -- (-391.745) (-386.504) [-386.634] (-389.676) * (-387.119) (-390.020) [-393.868] (-389.527) -- 0:00:00
990000 -- (-388.721) (-387.200) (-387.083) [-388.898] * (-387.793) (-389.738) [-386.647] (-390.089) -- 0:00:00
Average standard deviation of split frequencies: 0.008153
990500 -- (-388.537) (-390.556) [-388.984] (-388.409) * (-386.839) (-387.899) [-390.268] (-388.106) -- 0:00:00
991000 -- (-396.442) (-387.170) [-389.551] (-390.072) * (-386.693) (-389.705) [-389.235] (-387.013) -- 0:00:00
991500 -- (-393.078) [-388.172] (-389.025) (-388.033) * (-389.540) (-386.207) [-387.658] (-388.838) -- 0:00:00
992000 -- (-393.581) (-387.753) (-389.746) [-388.507] * (-394.351) [-387.395] (-389.483) (-393.875) -- 0:00:00
992500 -- (-393.233) (-386.973) [-389.026] (-388.206) * (-391.335) [-387.026] (-389.659) (-387.765) -- 0:00:00
993000 -- (-388.669) [-391.159] (-387.951) (-388.094) * (-390.910) [-386.631] (-393.231) (-387.671) -- 0:00:00
993500 -- (-387.294) (-392.592) (-388.591) [-389.227] * (-389.239) [-389.050] (-389.720) (-386.980) -- 0:00:00
994000 -- (-390.163) (-387.599) (-389.873) [-388.364] * (-388.849) (-387.785) (-392.091) [-386.873] -- 0:00:00
994500 -- [-391.611] (-393.178) (-387.122) (-387.144) * (-388.337) (-388.142) [-388.719] (-388.789) -- 0:00:00
995000 -- (-387.659) (-390.446) (-388.349) [-387.860] * (-388.645) (-388.622) [-388.058] (-387.749) -- 0:00:00
Average standard deviation of split frequencies: 0.007794
995500 -- [-388.396] (-389.807) (-387.900) (-390.700) * (-390.053) (-395.298) (-388.645) [-387.944] -- 0:00:00
996000 -- (-388.715) (-389.699) [-389.799] (-387.542) * (-388.922) [-387.775] (-391.517) (-388.794) -- 0:00:00
996500 -- (-387.537) (-388.088) [-387.079] (-387.678) * [-389.404] (-392.417) (-388.536) (-387.105) -- 0:00:00
997000 -- [-388.660] (-388.244) (-387.494) (-392.038) * (-387.410) (-388.061) [-388.265] (-387.700) -- 0:00:00
997500 -- (-394.728) (-387.602) [-389.763] (-388.174) * (-386.393) [-388.043] (-388.991) (-390.638) -- 0:00:00
998000 -- (-387.117) (-389.618) [-387.573] (-387.264) * (-387.176) (-386.546) [-386.186] (-387.395) -- 0:00:00
998500 -- (-389.418) [-387.782] (-388.602) (-392.252) * (-390.273) (-388.126) [-386.254] (-387.339) -- 0:00:00
999000 -- (-393.210) (-392.448) (-388.060) [-387.326] * (-389.043) [-387.493] (-392.189) (-390.899) -- 0:00:00
999500 -- (-393.462) (-387.734) [-387.378] (-388.281) * (-386.718) (-388.581) [-390.417] (-392.897) -- 0:00:00
1000000 -- (-386.274) (-389.843) [-387.075] (-387.675) * (-386.431) (-392.152) [-391.173] (-388.020) -- 0:00:00
Average standard deviation of split frequencies: 0.007883
Analysis completed in 59 seconds
Analysis used 57.81 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -385.99
Likelihood of best state for "cold" chain of run 2 was -385.99
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.3 % ( 28 %) Dirichlet(Pi{all})
39.3 % ( 28 %) Slider(Pi{all})
78.4 % ( 50 %) Multiplier(Alpha{1,2})
77.6 % ( 59 %) Multiplier(Alpha{3})
26.4 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.5 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 60 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
40.4 % ( 27 %) Dirichlet(Pi{all})
39.1 % ( 27 %) Slider(Pi{all})
78.8 % ( 53 %) Multiplier(Alpha{1,2})
77.3 % ( 55 %) Multiplier(Alpha{3})
25.9 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 84 %) ParsSPR(Tau{all},V{all})
28.3 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167332 0.82 0.67
3 | 165941 166875 0.84
4 | 166944 166823 166085
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166734 0.82 0.67
3 | 166924 166450 0.84
4 | 166266 166907 166719
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -387.53
| 2 |
| 1 |
| 2 2 |
| 1 1 122 1 2 1 1 |
| 1 22 1 1 2 1 1 2 |
| 2 111 2 2 2 1 22 2 2 |
|1 2 2 1 21 2 1 2 2 2 1 2 11 |
| 2 2 2 2 2*2 1 * 2 1 12*2212 |
| *1 12 1 2 1 2 1 221 1 212 *|
| 11 1 2 1 2 111 1 12 1 1 21 1 |
| 1 1 2 1 1 1 |
|22 22 2 |
| 1 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -389.46
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -387.71 -391.63
2 -387.69 -392.24
--------------------------------------
TOTAL -387.70 -391.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897175 0.091663 0.372903 1.502472 0.868736 1501.00 1501.00 1.000
r(A<->C){all} 0.167906 0.019682 0.000073 0.444801 0.130318 192.05 200.01 1.000
r(A<->G){all} 0.160030 0.018948 0.000044 0.436589 0.119519 275.93 282.80 1.000
r(A<->T){all} 0.171803 0.019318 0.000158 0.447288 0.137214 145.10 240.23 1.001
r(C<->G){all} 0.166722 0.019344 0.000025 0.436544 0.131707 155.84 185.01 1.000
r(C<->T){all} 0.177043 0.021983 0.000013 0.469817 0.139047 203.41 237.31 1.000
r(G<->T){all} 0.156497 0.018200 0.000049 0.428593 0.119738 303.56 315.49 1.000
pi(A){all} 0.173206 0.000481 0.132519 0.217964 0.172361 1459.71 1472.55 1.000
pi(C){all} 0.224016 0.000604 0.176397 0.271345 0.222725 1168.89 1298.64 1.000
pi(G){all} 0.346164 0.000795 0.293084 0.405108 0.344840 1299.01 1400.00 1.000
pi(T){all} 0.256614 0.000672 0.204248 0.306472 0.256159 1236.88 1252.09 1.000
alpha{1,2} 0.407062 0.217839 0.000103 1.300354 0.238773 878.39 1078.46 1.000
alpha{3} 0.476651 0.243236 0.000163 1.468328 0.318347 1421.38 1461.19 1.000
pinvar{all} 0.994416 0.000048 0.981453 0.999992 0.996679 1142.06 1264.19 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- ..*..*
9 -- .*..*.
10 -- .*...*
11 -- ..**..
12 -- .*.***
13 -- .*.*..
14 -- .***.*
15 -- .****.
16 -- ...**.
17 -- .**...
18 -- ...*.*
19 -- ....**
20 -- ..****
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.003769 0.150566 0.155896 2
8 447 0.148901 0.019315 0.135243 0.162558 2
9 444 0.147901 0.005653 0.143904 0.151899 2
10 442 0.147235 0.012248 0.138574 0.155896 2
11 433 0.144237 0.022141 0.128581 0.159893 2
12 433 0.144237 0.010835 0.136576 0.151899 2
13 430 0.143238 0.004711 0.139907 0.146569 2
14 430 0.143238 0.001884 0.141905 0.144570 2
15 427 0.142239 0.008951 0.135909 0.148568 2
16 420 0.139907 0.002827 0.137908 0.141905 2
17 420 0.139907 0.001884 0.138574 0.141239 2
18 416 0.138574 0.005653 0.134577 0.142572 2
19 415 0.138241 0.008009 0.132578 0.143904 2
20 411 0.136909 0.002355 0.135243 0.138574 2
21 387 0.128914 0.008009 0.123251 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097108 0.009492 0.000212 0.294581 0.067754 1.000 2
length{all}[2] 0.100595 0.009745 0.000010 0.301843 0.069412 1.000 2
length{all}[3] 0.102145 0.010243 0.000015 0.307594 0.071665 1.000 2
length{all}[4] 0.102035 0.011183 0.000064 0.301550 0.068789 1.000 2
length{all}[5] 0.099105 0.009427 0.000088 0.292354 0.071945 1.001 2
length{all}[6] 0.101485 0.010152 0.000086 0.301933 0.070612 1.000 2
length{all}[7] 0.099308 0.008416 0.000112 0.291641 0.070460 0.998 2
length{all}[8] 0.101360 0.009318 0.000125 0.289458 0.069944 1.000 2
length{all}[9] 0.096939 0.009735 0.000018 0.307966 0.063919 0.999 2
length{all}[10] 0.099274 0.009332 0.000505 0.281364 0.069326 0.999 2
length{all}[11] 0.106122 0.011432 0.000959 0.310283 0.074156 1.000 2
length{all}[12] 0.096260 0.008773 0.000023 0.263880 0.065896 0.998 2
length{all}[13] 0.096951 0.008725 0.000313 0.269660 0.070277 1.008 2
length{all}[14] 0.097489 0.009367 0.000104 0.299968 0.066883 1.001 2
length{all}[15] 0.091033 0.008054 0.000150 0.266635 0.066401 0.998 2
length{all}[16] 0.100058 0.009654 0.000048 0.307859 0.071782 0.998 2
length{all}[17] 0.099451 0.010369 0.000106 0.257840 0.069384 1.006 2
length{all}[18] 0.088870 0.008966 0.000336 0.300963 0.058935 1.023 2
length{all}[19] 0.099160 0.008698 0.000072 0.293941 0.069742 0.998 2
length{all}[20] 0.097559 0.009534 0.000104 0.296366 0.071883 0.998 2
length{all}[21] 0.095101 0.008575 0.000284 0.283523 0.071873 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007883
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.023
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 285
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 44 patterns at 95 / 95 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 44 patterns at 95 / 95 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099181 0.066184 0.048699 0.012826 0.031278 0.040541 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -403.600951
Iterating by ming2
Initial: fx= 403.600951
x= 0.09918 0.06618 0.04870 0.01283 0.03128 0.04054 0.30000 1.30000
1 h-m-p 0.0000 0.0001 231.0044 ++ 396.387148 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0299 48.9378 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 211.0902 +++ 387.684519 m 0.0002 45 | 2/8
4 h-m-p 0.0009 0.0356 42.1094 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 189.2297 ++ 384.170215 m 0.0001 76 | 3/8
6 h-m-p 0.0005 0.0442 34.7054 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 163.9245 ++ 381.844513 m 0.0001 107 | 4/8
8 h-m-p 0.0004 0.0589 26.1745 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 133.7619 +++ 378.511403 m 0.0002 139 | 5/8
10 h-m-p 0.0010 0.0883 17.5697 -----------.. | 5/8
11 h-m-p 0.0000 0.0004 94.5998 +++ 375.340430 m 0.0004 171 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 375.340430 m 8.0000 182 | 6/8
13 h-m-p 0.2494 8.0000 0.0001 +++ 375.340430 m 8.0000 196 | 6/8
14 h-m-p 0.0009 0.3176 1.1494 -------Y 375.340430 0 0.0000 216 | 6/8
15 h-m-p 0.3964 8.0000 0.0000 -------C 375.340430 0 0.0000 234 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 ------------N 375.340430 0 0.0000 259
Out..
lnL = -375.340430
260 lfun, 260 eigenQcodon, 1560 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075364 0.045647 0.102903 0.092779 0.049612 0.041787 0.300953 0.581730 0.361706
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.501290
np = 9
lnL0 = -412.185199
Iterating by ming2
Initial: fx= 412.185199
x= 0.07536 0.04565 0.10290 0.09278 0.04961 0.04179 0.30095 0.58173 0.36171
1 h-m-p 0.0000 0.0005 213.9547 +++ 389.958866 m 0.0005 15 | 1/9
2 h-m-p 0.0000 0.0001 133.5036 ++ 388.166488 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 921.8611 ++ 386.778951 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 5223395.0892 ++ 379.766273 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 2301917.1507 ++ 376.373542 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 23935.4362 ++ 375.340372 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 375.340371 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.0952 ------------Y 375.340371 0 0.0000 114 | 6/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340371 m 8.0000 132 | 6/9
10 h-m-p 0.0000 0.0133 30.9044 ---------.. | 6/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 375.340371 m 8.0000 169 | 6/9
12 h-m-p 0.0070 3.5142 0.2243 ----------C 375.340371 0 0.0000 194 | 6/9
13 h-m-p 0.0160 8.0000 0.0013 +++++ 375.340370 m 8.0000 212 | 6/9
14 h-m-p 0.0361 3.5324 0.2973 --------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 375.340369 m 8.0000 257 | 6/9
16 h-m-p 0.0058 2.9150 0.2733 ----------Y 375.340369 0 0.0000 282 | 6/9
17 h-m-p 0.0160 8.0000 0.0045 +++++ 375.340363 m 8.0000 300 | 6/9
18 h-m-p 0.1179 2.5231 0.3054 ---------------.. | 6/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 375.340363 m 8.0000 346 | 6/9
20 h-m-p 0.0066 3.3019 0.2561 ---------Y 375.340363 0 0.0000 370 | 6/9
21 h-m-p 0.0160 8.0000 0.0002 +++++ 375.340363 m 8.0000 388 | 6/9
22 h-m-p 0.0013 0.3171 1.2186 ++++ 375.340342 m 0.3171 405 | 7/9
23 h-m-p 0.1756 0.8778 0.4031 ++ 375.340193 m 0.8778 417 | 8/9
24 h-m-p 0.9219 8.0000 0.1935 --------------C 375.340193 0 0.0000 445 | 8/9
25 h-m-p 0.0160 8.0000 0.0000 +++++ 375.340193 m 8.0000 461 | 8/9
26 h-m-p 0.0160 8.0000 1.0295 -----------C 375.340193 0 0.0000 485 | 8/9
27 h-m-p 0.0160 8.0000 0.0000 +++++ 375.340193 m 8.0000 500 | 8/9
28 h-m-p 0.0160 8.0000 0.0007 +++++ 375.340192 m 8.0000 516 | 8/9
29 h-m-p 0.0160 8.0000 0.9051 -------------.. | 8/9
30 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340192 m 8.0000 556 | 8/9
31 h-m-p 0.0160 8.0000 0.9272 -------------.. | 8/9
32 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340192 m 8.0000 596 | 8/9
33 h-m-p 0.0160 8.0000 0.9462 -----------Y 375.340192 0 0.0000 620 | 8/9
34 h-m-p 0.0160 8.0000 0.0000 -----C 375.340192 0 0.0000 638 | 8/9
35 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
36 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340192 m 8.0000 678 | 8/9
37 h-m-p 0.0160 8.0000 0.8542 -------------.. | 8/9
38 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340192 m 8.0000 718 | 8/9
39 h-m-p 0.0160 8.0000 0.8982 -----------Y 375.340192 0 0.0000 742 | 8/9
40 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340192 m 8.0000 758 | 8/9
41 h-m-p 0.0160 8.0000 0.9686 -----------Y 375.340192 0 0.0000 782 | 8/9
42 h-m-p 0.0160 8.0000 0.0000 +++++ 375.340192 m 8.0000 798 | 8/9
43 h-m-p 0.0160 8.0000 0.9691 -----------Y 375.340192 0 0.0000 822 | 8/9
44 h-m-p 0.0160 8.0000 0.0000 +++++ 375.340192 m 8.0000 838 | 8/9
45 h-m-p 0.0160 8.0000 1.3446 -----------Y 375.340192 0 0.0000 862 | 8/9
46 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
47 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340192 m 8.0000 901 | 8/9
48 h-m-p 0.0160 8.0000 0.8450 ----------Y 375.340192 0 0.0000 924 | 8/9
49 h-m-p 0.0160 8.0000 0.0001 +++++ 375.340192 m 8.0000 940 | 8/9
50 h-m-p 0.0160 8.0000 0.9772 ----------Y 375.340192 0 0.0000 963 | 8/9
51 h-m-p 0.0160 8.0000 0.0000 ------N 375.340192 0 0.0000 982 | 8/9
52 h-m-p 0.0160 8.0000 0.0000 +++++ 375.340192 m 8.0000 998 | 8/9
53 h-m-p 0.0047 2.3736 0.0897 +++++ 375.340170 m 2.3736 1014 | 9/9
54 h-m-p 0.0160 8.0000 0.0000 Y 375.340170 0 0.0160 1027 | 9/9
55 h-m-p 0.0160 8.0000 0.0000 Y 375.340170 0 0.0160 1039
Out..
lnL = -375.340170
1040 lfun, 3120 eigenQcodon, 12480 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070252 0.067132 0.055456 0.036667 0.065285 0.084320 0.000100 1.020975 0.366684 0.161060 1.382607
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.108067
np = 11
lnL0 = -408.073812
Iterating by ming2
Initial: fx= 408.073812
x= 0.07025 0.06713 0.05546 0.03667 0.06528 0.08432 0.00011 1.02098 0.36668 0.16106 1.38261
1 h-m-p 0.0000 0.0000 195.0398 ++ 407.713321 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0015 127.0397 ++++ 390.411592 m 0.0015 32 | 2/11
3 h-m-p 0.0016 0.0078 39.6045 ++ 383.037983 m 0.0078 46 | 3/11
4 h-m-p 0.0000 0.0001 1742.4866 ++ 381.847505 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0001 967.8513 ++ 380.804384 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 3471923.4739 ++ 380.354752 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0001 1979.1741 ++ 378.651157 m 0.0001 102 | 7/11
8 h-m-p 0.0001 0.0003 2185.6156 ++ 375.340366 m 0.0003 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 375.340366 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.4941 +++++ 375.340199 m 8.0000 150 | 8/11
11 h-m-p 1.3103 8.0000 3.0167 ++ 375.340170 m 8.0000 167 | 8/11
12 h-m-p 1.6000 8.0000 0.0101 +Y 375.340170 0 6.4000 182 | 8/11
13 h-m-p 1.6000 8.0000 0.0000 N 375.340170 0 1.6000 199
Out..
lnL = -375.340170
200 lfun, 800 eigenQcodon, 3600 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -375.360113 S = -375.340571 -0.007494
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:04
did 20 / 44 patterns 0:04
did 30 / 44 patterns 0:04
did 40 / 44 patterns 0:04
did 44 / 44 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073224 0.109005 0.101027 0.029602 0.085231 0.051044 0.000100 0.929505 1.192950
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.248621
np = 9
lnL0 = -414.749137
Iterating by ming2
Initial: fx= 414.749137
x= 0.07322 0.10901 0.10103 0.02960 0.08523 0.05104 0.00011 0.92951 1.19295
1 h-m-p 0.0000 0.0000 204.2485 ++ 414.496633 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0134 40.6383 +++++ 397.881454 m 0.0134 29 | 2/9
3 h-m-p 0.0002 0.0008 63.7034 ++ 395.430183 m 0.0008 41 | 3/9
4 h-m-p 0.0001 0.0010 336.9163 ++ 389.342851 m 0.0010 53 | 4/9
5 h-m-p 0.0000 0.0001 811.9258 ++ 387.008373 m 0.0001 65 | 5/9
6 h-m-p 0.0000 0.0000 1618.1550 ++ 384.076646 m 0.0000 77 | 6/9
7 h-m-p 0.0010 0.0051 23.6959 ++ 382.783231 m 0.0051 89 | 7/9
8 h-m-p 0.0639 0.7551 1.6001 --------------.. | 7/9
9 h-m-p 0.0000 0.0012 75.4156 ++++ 375.340170 m 0.0012 127 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 N 375.340170 0 1.6000 139 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 N 375.340170 0 0.0160 152
Out..
lnL = -375.340170
153 lfun, 1683 eigenQcodon, 9180 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096090 0.062839 0.053960 0.049859 0.056339 0.028677 0.000100 0.900000 0.934341 1.196131 1.300400
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.629552
np = 11
lnL0 = -406.083512
Iterating by ming2
Initial: fx= 406.083512
x= 0.09609 0.06284 0.05396 0.04986 0.05634 0.02868 0.00011 0.90000 0.93434 1.19613 1.30040
1 h-m-p 0.0000 0.0000 206.0158 ++ 405.585952 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0089 46.5182 ++++ 390.000382 m 0.0089 32 | 2/11
3 h-m-p 0.0001 0.0003 478.2053 ++ 381.066522 m 0.0003 46 | 3/11
4 h-m-p 0.0006 0.0031 31.7035 ++ 379.823575 m 0.0031 60 | 4/11
5 h-m-p 0.0000 0.0000 606.3859 ++ 379.365531 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 6992.7943 ++ 378.603311 m 0.0000 88 | 6/11
7 h-m-p 0.0001 0.0006 139.7229 ++ 375.340395 m 0.0006 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 375.340395 m 8.0000 116 | 7/11
9 h-m-p 0.0009 0.4318 2.2198 +++++ 375.340371 m 0.4318 137 | 8/11
10 h-m-p 0.2512 1.2562 1.0883 ++ 375.340170 m 1.2562 151 | 9/11
11 h-m-p 1.6000 8.0000 0.0066 ++ 375.340170 m 8.0000 165 | 9/11
12 h-m-p 1.6000 8.0000 0.0043 ++ 375.340170 m 8.0000 181 | 9/11
13 h-m-p 0.0573 1.5363 0.6048 +++ 375.340170 m 1.5363 198 | 10/11
14 h-m-p 0.6695 8.0000 0.6632
QuantileBeta(0.15, 0.00500, 2.91487) = 8.466351e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
+ 375.340170 m 8.0000 214
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.582365e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44439) = 3.461399e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44396) = 3.461649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
| 10/11
15 h-m-p 1.6000 8.0000 0.3989
QuantileBeta(0.15, 0.00500, 5.80592) = 3.876563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.28461) = 3.556733e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.40428) = 3.484846e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.43420) = 3.467325e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.44168) = 3.462973e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.44355) = 3.461886e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.44402) = 3.461615e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44415) = 3.461535e-161 2000 rounds
N 375.340170 0 0.0001 235
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.582388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44435) = 3.461422e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44392) = 3.461671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44413) = 3.461547e-161 2000 rounds
| 10/11
16 h-m-p 0.2500 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44429) = 3.461456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44415) = 3.461535e-161 2000 rounds
Y 375.340170 0 0.2500 250
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.582365e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44439) = 3.461399e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44396) = 3.461649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44417) = 3.461524e-161 2000 rounds
| 10/11
17 h-m-p 0.3333 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44433) = 3.461434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44425) = 3.461476e-161 2000 rounds
Y 375.340170 0 0.3333 265
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.582341e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44443) = 3.461377e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44400) = 3.461626e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
| 10/11
18 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
N 375.340170 0 1.6000 280
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
Out..
lnL = -375.340170
281 lfun, 3372 eigenQcodon, 18546 P(t)
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -375.366048 S = -375.340571 -0.011221
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:12
did 20 / 44 patterns 0:12
did 30 / 44 patterns 0:12
did 40 / 44 patterns 0:12
did 44 / 44 patterns 0:12
QuantileBeta(0.15, 0.00500, 6.44421) = 3.461502e-161 2000 rounds
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=95
NC_011896_1_WP_010907838_1_645_MLBR_RS03065 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
NC_002677_1_NP_301514_1_386_ML0614 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA
**************************************************
NC_011896_1_WP_010907838_1_645_MLBR_RS03065 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
NC_002677_1_NP_301514_1_386_ML0614 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445 FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
*********************************************
>NC_011896_1_WP_010907838_1_645_MLBR_RS03065 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG >NC_002677_1_NP_301514_1_386_ML0614 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG >NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG >NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG >NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG >NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445 ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGA TGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACG GGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCC TTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTA CGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGA TGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGG
>NC_011896_1_WP_010907838_1_645_MLBR_RS03065 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG >NC_002677_1_NP_301514_1_386_ML0614 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG >NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG >NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG >NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG >NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLA FVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
#NEXUS
[ID: 0849640853]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907838_1_645_MLBR_RS03065
NC_002677_1_NP_301514_1_386_ML0614
NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160
NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105
NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365
NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907838_1_645_MLBR_RS03065,
2 NC_002677_1_NP_301514_1_386_ML0614,
3 NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160,
4 NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105,
5 NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365,
6 NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06775379,2:0.06941231,3:0.07166523,4:0.06878883,5:0.07194496,6:0.07061194);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06775379,2:0.06941231,3:0.07166523,4:0.06878883,5:0.07194496,6:0.07061194);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -387.71 -391.63
2 -387.69 -392.24
--------------------------------------
TOTAL -387.70 -391.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897175 0.091663 0.372903 1.502472 0.868736 1501.00 1501.00 1.000
r(A<->C){all} 0.167906 0.019682 0.000073 0.444801 0.130318 192.05 200.01 1.000
r(A<->G){all} 0.160030 0.018948 0.000044 0.436589 0.119519 275.93 282.80 1.000
r(A<->T){all} 0.171803 0.019318 0.000158 0.447288 0.137214 145.10 240.23 1.001
r(C<->G){all} 0.166722 0.019344 0.000025 0.436544 0.131707 155.84 185.01 1.000
r(C<->T){all} 0.177043 0.021983 0.000013 0.469817 0.139047 203.41 237.31 1.000
r(G<->T){all} 0.156497 0.018200 0.000049 0.428593 0.119738 303.56 315.49 1.000
pi(A){all} 0.173206 0.000481 0.132519 0.217964 0.172361 1459.71 1472.55 1.000
pi(C){all} 0.224016 0.000604 0.176397 0.271345 0.222725 1168.89 1298.64 1.000
pi(G){all} 0.346164 0.000795 0.293084 0.405108 0.344840 1299.01 1400.00 1.000
pi(T){all} 0.256614 0.000672 0.204248 0.306472 0.256159 1236.88 1252.09 1.000
alpha{1,2} 0.407062 0.217839 0.000103 1.300354 0.238773 878.39 1078.46 1.000
alpha{3} 0.476651 0.243236 0.000163 1.468328 0.318347 1421.38 1461.19 1.000
pinvar{all} 0.994416 0.000048 0.981453 0.999992 0.996679 1142.06 1264.19 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0614/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 95
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 3 3 3 3 3 3 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 1 1 1 1 1 1 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 3 3 3 3 3 3 | GAC 2 2 2 2 2 2 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 5 5 5 5 5 5 | GCG 6 6 6 6 6 6 | GAG 1 1 1 1 1 1 | GGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907838_1_645_MLBR_RS03065
position 1: T:0.21053 C:0.17895 A:0.21053 G:0.40000
position 2: T:0.33684 C:0.24211 A:0.20000 G:0.22105
position 3: T:0.22105 C:0.25263 A:0.10526 G:0.42105
Average T:0.25614 C:0.22456 A:0.17193 G:0.34737
#2: NC_002677_1_NP_301514_1_386_ML0614
position 1: T:0.21053 C:0.17895 A:0.21053 G:0.40000
position 2: T:0.33684 C:0.24211 A:0.20000 G:0.22105
position 3: T:0.22105 C:0.25263 A:0.10526 G:0.42105
Average T:0.25614 C:0.22456 A:0.17193 G:0.34737
#3: NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160
position 1: T:0.21053 C:0.17895 A:0.21053 G:0.40000
position 2: T:0.33684 C:0.24211 A:0.20000 G:0.22105
position 3: T:0.22105 C:0.25263 A:0.10526 G:0.42105
Average T:0.25614 C:0.22456 A:0.17193 G:0.34737
#4: NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105
position 1: T:0.21053 C:0.17895 A:0.21053 G:0.40000
position 2: T:0.33684 C:0.24211 A:0.20000 G:0.22105
position 3: T:0.22105 C:0.25263 A:0.10526 G:0.42105
Average T:0.25614 C:0.22456 A:0.17193 G:0.34737
#5: NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365
position 1: T:0.21053 C:0.17895 A:0.21053 G:0.40000
position 2: T:0.33684 C:0.24211 A:0.20000 G:0.22105
position 3: T:0.22105 C:0.25263 A:0.10526 G:0.42105
Average T:0.25614 C:0.22456 A:0.17193 G:0.34737
#6: NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445
position 1: T:0.21053 C:0.17895 A:0.21053 G:0.40000
position 2: T:0.33684 C:0.24211 A:0.20000 G:0.22105
position 3: T:0.22105 C:0.25263 A:0.10526 G:0.42105
Average T:0.25614 C:0.22456 A:0.17193 G:0.34737
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 18 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 6 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 12 | CCC 0 | CAC 6 | CGC 6
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 6
CTG 12 | CCG 12 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 18 | Ser S AGT 6
ATC 12 | ACC 6 | AAC 6 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 18 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 24 | Gly G GGT 6
GTC 6 | GCC 18 | GAC 12 | GGC 18
GTA 0 | GCA 18 | Glu E GAA 0 | GGA 0
GTG 30 | GCG 36 | GAG 6 | GGG 36
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21053 C:0.17895 A:0.21053 G:0.40000
position 2: T:0.33684 C:0.24211 A:0.20000 G:0.22105
position 3: T:0.22105 C:0.25263 A:0.10526 G:0.42105
Average T:0.25614 C:0.22456 A:0.17193 G:0.34737
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -375.340430 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300953 1.300400
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907838_1_645_MLBR_RS03065: 0.000004, NC_002677_1_NP_301514_1_386_ML0614: 0.000004, NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160: 0.000004, NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105: 0.000004, NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365: 0.000004, NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30095
omega (dN/dS) = 1.30040
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.0 67.0 1.3004 0.0000 0.0000 0.0 0.0
7..2 0.000 218.0 67.0 1.3004 0.0000 0.0000 0.0 0.0
7..3 0.000 218.0 67.0 1.3004 0.0000 0.0000 0.0 0.0
7..4 0.000 218.0 67.0 1.3004 0.0000 0.0000 0.0 0.0
7..5 0.000 218.0 67.0 1.3004 0.0000 0.0000 0.0 0.0
7..6 0.000 218.0 67.0 1.3004 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -375.340170 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907838_1_645_MLBR_RS03065: 0.000004, NC_002677_1_NP_301514_1_386_ML0614: 0.000004, NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160: 0.000004, NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105: 0.000004, NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365: 0.000004, NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -375.340170 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 14.579633
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907838_1_645_MLBR_RS03065: 0.000004, NC_002677_1_NP_301514_1_386_ML0614: 0.000004, NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160: 0.000004, NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105: 0.000004, NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365: 0.000004, NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 14.57963
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907838_1_645_MLBR_RS03065)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -375.340170 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.056648
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907838_1_645_MLBR_RS03065: 0.000004, NC_002677_1_NP_301514_1_386_ML0614: 0.000004, NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160: 0.000004, NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105: 0.000004, NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365: 0.000004, NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.05665
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -375.340170 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 6.444210 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907838_1_645_MLBR_RS03065: 0.000004, NC_002677_1_NP_301514_1_386_ML0614: 0.000004, NZ_LVXE01000001_1_WP_010907838_1_31_A3216_RS00160: 0.000004, NZ_LYPH01000001_1_WP_010907838_1_19_A8144_RS00105: 0.000004, NZ_CP029543_1_WP_010907838_1_661_DIJ64_RS03365: 0.000004, NZ_AP014567_1_WP_010907838_1_677_JK2ML_RS03445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 6.44421
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 220.3 64.7 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907838_1_645_MLBR_RS03065)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:12
Model 1: NearlyNeutral -375.34017 Model 2: PositiveSelection -375.34017 Model 0: one-ratio -375.34043 Model 7: beta -375.34017 Model 8: beta&w>1 -375.34017 Model 0 vs 1 5.200000000513683E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
