--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:32:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0679/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -299.73 -304.35
2 -299.76 -304.86
--------------------------------------
TOTAL -299.74 -304.64
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890764 0.092913 0.353948 1.498383 0.857036 985.45 1155.75 1.000
r(A<->C){all} 0.161398 0.019002 0.000241 0.445400 0.122554 154.08 242.56 1.002
r(A<->G){all} 0.155840 0.017300 0.000017 0.428531 0.123309 241.47 263.96 1.005
r(A<->T){all} 0.161341 0.019683 0.000073 0.449915 0.122731 150.31 240.04 1.001
r(C<->G){all} 0.177878 0.021783 0.000010 0.479037 0.140752 224.22 275.43 1.003
r(C<->T){all} 0.168975 0.019754 0.000060 0.460891 0.131730 233.55 250.57 1.000
r(G<->T){all} 0.174568 0.020485 0.000015 0.453411 0.142246 167.49 186.77 1.000
pi(A){all} 0.179362 0.000634 0.132946 0.229383 0.178399 1047.94 1207.65 1.000
pi(C){all} 0.279830 0.000921 0.221273 0.338059 0.279344 1111.77 1306.02 1.000
pi(G){all} 0.379361 0.001060 0.315283 0.441176 0.379710 1299.09 1317.91 1.000
pi(T){all} 0.161447 0.000575 0.115984 0.210773 0.160676 1100.90 1172.06 1.000
alpha{1,2} 0.429383 0.251234 0.000173 1.450890 0.251630 1236.07 1256.70 1.001
alpha{3} 0.441567 0.240344 0.000124 1.396356 0.281277 1095.35 1181.10 1.000
pinvar{all} 0.992265 0.000092 0.975368 0.999997 0.995264 1171.63 1262.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -290.785946
Model 2: PositiveSelection -290.786051
Model 0: one-ratio -290.786089
Model 7: beta -290.785946
Model 8: beta&w>1 -290.786022
Model 0 vs 1 2.8599999996004044E-4
Model 2 vs 1 2.0999999992454832E-4
Model 8 vs 7 1.519999999572974E-4
>C1
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C2
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C3
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C4
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C5
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C6
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=75
C1 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C2 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C3 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C4 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C5 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C6 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
**************************************************
C1 LGVEALEDGVTALDDRGAGLDHPSQ
C2 LGVEALEDGVTALDDRGAGLDHPSQ
C3 LGVEALEDGVTALDDRGAGLDHPSQ
C4 LGVEALEDGVTALDDRGAGLDHPSQ
C5 LGVEALEDGVTALDDRGAGLDHPSQ
C6 LGVEALEDGVTALDDRGAGLDHPSQ
*************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2250]--->[2250]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.595 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C2 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C3 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C4 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C5 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
C6 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
**************************************************
C1 LGVEALEDGVTALDDRGAGLDHPSQ
C2 LGVEALEDGVTALDDRGAGLDHPSQ
C3 LGVEALEDGVTALDDRGAGLDHPSQ
C4 LGVEALEDGVTALDDRGAGLDHPSQ
C5 LGVEALEDGVTALDDRGAGLDHPSQ
C6 LGVEALEDGVTALDDRGAGLDHPSQ
*************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
C2 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
C3 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
C4 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
C5 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
C6 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
**************************************************
C1 CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
C2 CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
C3 CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
C4 CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
C5 CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
C6 CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
**************************************************
C1 ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
C2 ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
C3 ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
C4 ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
C5 ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
C6 ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
**************************************************
C1 CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
C2 CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
C3 CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
C4 CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
C5 CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
C6 CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
**************************************************
C1 TGCGGGTCTTGACCATCCGTCGCAG
C2 TGCGGGTCTTGACCATCCGTCGCAG
C3 TGCGGGTCTTGACCATCCGTCGCAG
C4 TGCGGGTCTTGACCATCCGTCGCAG
C5 TGCGGGTCTTGACCATCCGTCGCAG
C6 TGCGGGTCTTGACCATCCGTCGCAG
*************************
>C1
GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
TGCGGGTCTTGACCATCCGTCGCAG
>C2
GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
TGCGGGTCTTGACCATCCGTCGCAG
>C3
GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
TGCGGGTCTTGACCATCCGTCGCAG
>C4
GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
TGCGGGTCTTGACCATCCGTCGCAG
>C5
GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
TGCGGGTCTTGACCATCCGTCGCAG
>C6
GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT
CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT
ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA
CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG
TGCGGGTCTTGACCATCCGTCGCAG
>C1
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C2
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C3
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C4
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C5
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
>C6
VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
LGVEALEDGVTALDDRGAGLDHPSQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 225 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579797049
Setting output file names to "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1402129977
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0529448337
Seed = 365848450
Swapseed = 1579797049
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -503.560757 -- -24.965149
Chain 2 -- -503.560786 -- -24.965149
Chain 3 -- -503.560786 -- -24.965149
Chain 4 -- -503.560786 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -503.560757 -- -24.965149
Chain 2 -- -503.560786 -- -24.965149
Chain 3 -- -503.560786 -- -24.965149
Chain 4 -- -503.560757 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-503.561] (-503.561) (-503.561) (-503.561) * [-503.561] (-503.561) (-503.561) (-503.561)
500 -- (-321.993) [-315.279] (-329.716) (-321.719) * (-321.998) (-307.908) [-302.245] (-314.786) -- 0:00:00
1000 -- (-307.383) [-315.702] (-314.208) (-310.136) * (-312.330) [-314.490] (-310.669) (-314.327) -- 0:00:00
1500 -- (-311.018) (-311.868) (-316.338) [-307.057] * [-311.759] (-304.997) (-313.396) (-311.688) -- 0:11:05
2000 -- (-309.821) (-311.827) [-309.978] (-306.394) * (-311.765) (-304.189) (-308.891) [-308.001] -- 0:08:19
2500 -- (-315.036) [-302.872] (-306.734) (-311.038) * (-308.659) [-310.409] (-317.578) (-310.095) -- 0:06:39
3000 -- (-321.956) (-312.477) (-308.763) [-304.920] * [-306.279] (-304.923) (-316.285) (-307.049) -- 0:05:32
3500 -- (-306.110) [-306.475] (-308.789) (-321.088) * (-307.529) (-314.233) [-305.167] (-304.198) -- 0:04:44
4000 -- (-306.103) (-307.779) (-306.348) [-306.877] * (-307.909) (-326.070) (-307.499) [-306.584] -- 0:04:09
4500 -- [-310.357] (-315.332) (-306.602) (-308.061) * [-305.111] (-308.756) (-306.387) (-307.704) -- 0:03:41
5000 -- (-314.143) [-308.288] (-315.792) (-307.104) * (-305.823) (-307.274) (-309.477) [-310.223] -- 0:03:19
Average standard deviation of split frequencies: 0.074432
5500 -- (-306.848) [-304.375] (-309.766) (-308.657) * (-307.615) [-307.153] (-307.271) (-314.419) -- 0:03:00
6000 -- (-307.640) [-309.322] (-309.681) (-310.147) * (-308.000) [-309.461] (-308.240) (-308.507) -- 0:02:45
6500 -- (-302.616) (-306.078) [-305.569] (-312.537) * (-308.211) [-305.402] (-323.762) (-311.244) -- 0:02:32
7000 -- [-302.849] (-309.429) (-308.723) (-307.404) * (-315.646) (-315.726) (-322.491) [-311.623] -- 0:02:21
7500 -- (-302.375) (-322.011) (-309.714) [-304.293] * [-317.276] (-315.828) (-313.033) (-305.219) -- 0:02:12
8000 -- (-300.376) [-314.136] (-312.196) (-312.093) * [-309.575] (-313.850) (-304.738) (-308.814) -- 0:02:04
8500 -- [-300.953] (-305.431) (-307.626) (-320.561) * (-317.433) (-313.190) [-302.329] (-309.268) -- 0:01:56
9000 -- [-303.131] (-313.846) (-309.737) (-308.215) * (-313.284) [-310.316] (-302.793) (-317.713) -- 0:01:50
9500 -- [-301.728] (-318.602) (-316.228) (-311.406) * (-303.844) (-316.401) [-304.012] (-312.079) -- 0:01:44
10000 -- (-299.055) (-317.573) [-309.038] (-312.135) * (-311.227) [-317.677] (-305.105) (-318.294) -- 0:01:39
Average standard deviation of split frequencies: 0.082362
10500 -- [-299.966] (-309.435) (-312.887) (-304.583) * (-307.919) (-311.635) (-299.780) [-305.038] -- 0:01:34
11000 -- (-301.952) [-304.806] (-314.759) (-308.593) * (-308.284) (-314.419) (-304.693) [-316.390] -- 0:01:29
11500 -- (-299.437) (-310.389) (-314.727) [-310.255] * (-309.649) (-316.669) (-302.006) [-307.857] -- 0:01:25
12000 -- (-299.351) (-313.710) (-317.400) [-313.687] * (-312.755) (-308.212) (-300.374) [-308.999] -- 0:01:22
12500 -- [-305.442] (-308.818) (-315.221) (-308.375) * [-315.872] (-318.884) (-300.867) (-317.503) -- 0:01:19
13000 -- (-301.020) [-309.973] (-299.944) (-310.736) * [-316.704] (-308.538) (-302.633) (-306.083) -- 0:01:15
13500 -- (-300.845) [-308.352] (-303.910) (-317.151) * (-311.723) (-310.901) (-299.229) [-306.674] -- 0:01:13
14000 -- [-299.113] (-312.789) (-306.368) (-311.860) * (-308.185) (-321.259) [-300.881] (-307.440) -- 0:01:10
14500 -- (-299.786) (-306.198) (-299.427) [-309.410] * (-311.018) (-308.128) [-299.361] (-305.709) -- 0:01:07
15000 -- (-303.006) (-325.549) [-299.104] (-311.651) * (-311.545) (-329.317) [-299.568] (-307.834) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- [-299.416] (-311.443) (-300.545) (-307.625) * (-302.986) (-318.892) [-299.893] (-312.891) -- 0:01:03
16000 -- (-301.533) (-310.856) (-301.511) [-309.387] * (-309.540) (-321.412) (-298.795) [-312.212] -- 0:01:01
16500 -- [-300.026] (-308.175) (-299.033) (-312.607) * (-311.856) (-308.407) [-298.347] (-312.073) -- 0:00:59
17000 -- (-299.808) (-313.578) (-299.565) [-305.196] * (-305.775) [-299.700] (-299.129) (-317.360) -- 0:01:55
17500 -- (-306.740) (-316.571) (-299.090) [-314.051] * (-311.215) (-300.736) [-301.337] (-315.530) -- 0:01:52
18000 -- [-303.357] (-310.750) (-302.057) (-304.626) * (-312.754) (-299.418) (-298.679) [-312.687] -- 0:01:49
18500 -- (-301.768) [-313.824] (-299.100) (-320.899) * (-319.779) [-302.542] (-299.460) (-317.470) -- 0:01:46
19000 -- (-298.703) [-311.115] (-300.982) (-309.697) * (-308.650) (-303.458) [-302.431] (-309.373) -- 0:01:43
19500 -- [-298.912] (-304.109) (-302.940) (-312.591) * (-322.822) (-299.155) [-300.832] (-306.961) -- 0:01:40
20000 -- [-301.479] (-310.011) (-300.385) (-305.865) * (-308.045) (-298.958) [-307.022] (-304.745) -- 0:01:38
Average standard deviation of split frequencies: 0.051956
20500 -- (-300.926) [-309.146] (-300.088) (-307.184) * (-301.072) (-300.999) (-300.844) [-308.753] -- 0:01:35
21000 -- [-304.065] (-310.107) (-299.156) (-306.114) * (-298.372) (-299.425) (-301.252) [-310.096] -- 0:01:33
21500 -- (-298.875) [-309.814] (-303.862) (-311.409) * (-299.866) (-299.150) [-301.262] (-312.201) -- 0:01:31
22000 -- (-305.651) (-315.236) (-301.722) [-306.954] * [-298.979] (-299.339) (-300.513) (-312.473) -- 0:01:28
22500 -- [-299.883] (-314.417) (-305.525) (-318.067) * [-301.159] (-298.899) (-298.890) (-307.531) -- 0:01:26
23000 -- [-302.665] (-311.010) (-299.294) (-306.504) * [-299.412] (-298.939) (-298.746) (-322.940) -- 0:01:24
23500 -- (-299.432) [-302.865] (-299.357) (-308.487) * (-304.284) [-299.173] (-299.505) (-311.239) -- 0:01:23
24000 -- (-301.317) (-305.598) [-298.697] (-319.291) * (-300.274) (-299.326) [-299.118] (-304.830) -- 0:01:21
24500 -- (-299.816) (-310.255) [-301.531] (-318.348) * (-298.520) [-299.059] (-299.292) (-317.906) -- 0:01:19
25000 -- [-298.980] (-309.747) (-299.381) (-311.404) * (-301.520) [-302.414] (-298.853) (-306.789) -- 0:01:18
Average standard deviation of split frequencies: 0.038075
25500 -- [-300.716] (-309.990) (-298.319) (-314.143) * [-299.222] (-302.501) (-299.016) (-313.521) -- 0:01:16
26000 -- (-299.855) (-309.782) (-302.271) [-312.232] * (-300.459) (-308.232) [-299.190] (-308.975) -- 0:01:14
26500 -- (-303.016) (-306.558) [-301.218] (-318.506) * (-305.459) (-307.002) [-298.458] (-312.181) -- 0:01:13
27000 -- (-299.246) (-314.407) (-302.770) [-308.400] * (-304.045) [-303.173] (-301.676) (-309.450) -- 0:01:12
27500 -- (-301.973) [-305.487] (-300.048) (-322.264) * (-302.636) [-301.454] (-301.514) (-310.561) -- 0:01:10
28000 -- (-298.019) (-307.363) (-300.718) [-309.732] * (-300.725) (-298.944) [-299.570] (-308.047) -- 0:01:09
28500 -- (-299.675) [-308.092] (-299.551) (-302.608) * (-300.557) [-300.689] (-299.640) (-310.497) -- 0:01:08
29000 -- (-300.022) (-303.450) [-300.572] (-307.341) * (-304.440) (-299.620) (-302.338) [-304.682] -- 0:01:06
29500 -- [-298.332] (-311.574) (-301.076) (-313.379) * (-300.436) (-302.009) [-301.297] (-307.703) -- 0:01:05
30000 -- (-299.381) [-305.603] (-299.219) (-309.009) * (-299.381) [-299.303] (-301.357) (-309.240) -- 0:01:04
Average standard deviation of split frequencies: 0.038025
30500 -- (-299.985) [-310.294] (-300.086) (-311.214) * [-299.753] (-299.933) (-299.141) (-311.662) -- 0:01:03
31000 -- (-302.340) (-308.103) (-298.707) [-311.640] * (-302.623) (-299.966) [-299.749] (-307.237) -- 0:01:02
31500 -- (-299.559) (-318.920) [-299.604] (-310.484) * (-299.922) (-299.611) (-302.783) [-310.946] -- 0:01:01
32000 -- (-298.624) (-314.182) [-299.195] (-307.884) * [-303.803] (-299.677) (-302.012) (-313.943) -- 0:01:00
32500 -- (-298.898) [-309.242] (-301.394) (-317.936) * (-301.145) (-299.857) (-300.173) [-317.199] -- 0:00:59
33000 -- (-300.137) (-311.550) (-300.519) [-305.885] * (-299.920) [-299.236] (-301.336) (-312.220) -- 0:01:27
33500 -- (-299.737) (-311.900) (-302.530) [-307.989] * (-300.502) (-299.435) (-300.743) [-313.994] -- 0:01:26
34000 -- (-298.830) (-317.420) [-300.297] (-306.034) * (-299.520) [-300.108] (-300.843) (-307.578) -- 0:01:25
34500 -- (-298.996) (-322.505) [-300.119] (-310.504) * (-303.981) [-298.983] (-300.258) (-325.106) -- 0:01:23
35000 -- (-298.709) (-309.175) (-303.758) [-307.108] * [-301.710] (-298.399) (-302.990) (-312.624) -- 0:01:22
Average standard deviation of split frequencies: 0.048013
35500 -- (-299.837) (-309.894) [-302.922] (-306.690) * (-298.602) [-300.959] (-298.636) (-300.317) -- 0:01:21
36000 -- (-298.244) (-307.332) (-306.665) [-308.018] * (-298.591) (-302.700) [-298.271] (-301.803) -- 0:01:20
36500 -- (-299.184) (-308.570) (-303.650) [-314.537] * (-299.254) (-300.870) (-301.010) [-299.760] -- 0:01:19
37000 -- (-299.680) (-298.967) (-300.100) [-308.574] * (-300.427) (-307.376) [-299.644] (-302.692) -- 0:01:18
37500 -- (-299.930) (-300.584) (-299.381) [-309.336] * (-300.727) [-300.251] (-302.131) (-303.023) -- 0:01:17
38000 -- (-302.925) (-298.486) [-303.225] (-324.596) * (-301.360) (-300.122) (-303.020) [-299.801] -- 0:01:15
38500 -- [-300.067] (-300.006) (-302.468) (-310.315) * (-301.773) (-298.931) (-301.758) [-304.285] -- 0:01:14
39000 -- [-301.795] (-302.959) (-303.633) (-318.876) * (-300.499) [-300.122] (-302.620) (-301.904) -- 0:01:13
39500 -- (-300.381) (-302.751) [-298.816] (-328.805) * [-299.924] (-299.968) (-301.991) (-300.045) -- 0:01:12
40000 -- (-305.080) [-300.074] (-299.351) (-324.483) * (-298.796) (-299.766) (-300.106) [-301.247] -- 0:01:12
Average standard deviation of split frequencies: 0.046368
40500 -- [-301.408] (-301.944) (-299.882) (-318.419) * [-298.806] (-299.181) (-299.757) (-299.411) -- 0:01:11
41000 -- (-302.632) (-300.975) [-299.555] (-312.288) * (-299.454) (-300.682) [-300.507] (-299.500) -- 0:01:10
41500 -- (-301.194) (-302.730) [-304.488] (-308.557) * (-299.167) (-298.280) (-299.657) [-299.795] -- 0:01:09
42000 -- (-299.987) (-302.612) (-301.576) [-302.886] * (-300.659) (-298.960) [-299.067] (-299.543) -- 0:01:08
42500 -- (-300.592) (-299.119) (-300.765) [-298.735] * (-301.007) [-300.624] (-299.368) (-299.856) -- 0:01:07
43000 -- (-300.122) (-302.093) (-300.541) [-301.875] * [-299.640] (-300.189) (-305.895) (-302.095) -- 0:01:06
43500 -- (-304.389) (-302.486) (-301.046) [-300.833] * (-300.595) [-301.406] (-300.722) (-306.807) -- 0:01:05
44000 -- [-299.067] (-301.314) (-299.327) (-301.055) * (-302.186) (-305.903) (-298.623) [-304.164] -- 0:01:05
44500 -- (-299.439) [-300.166] (-299.776) (-299.660) * (-306.542) (-304.749) (-301.892) [-298.991] -- 0:01:04
45000 -- [-300.668] (-299.945) (-301.002) (-300.294) * [-300.782] (-299.824) (-300.901) (-299.858) -- 0:01:03
Average standard deviation of split frequencies: 0.031823
45500 -- [-298.926] (-305.292) (-301.324) (-299.363) * (-304.034) (-299.791) (-299.984) [-301.593] -- 0:01:02
46000 -- [-304.441] (-303.032) (-299.841) (-299.642) * (-301.107) [-300.792] (-299.999) (-309.186) -- 0:01:02
46500 -- (-301.746) (-301.828) [-300.293] (-299.800) * [-299.708] (-301.136) (-302.173) (-310.179) -- 0:01:01
47000 -- (-304.014) (-303.186) [-300.688] (-300.203) * (-298.639) (-302.826) [-303.769] (-307.981) -- 0:01:00
47500 -- (-302.860) [-303.010] (-298.548) (-309.267) * (-302.586) (-300.801) (-304.978) [-304.527] -- 0:01:00
48000 -- (-301.890) [-302.319] (-306.763) (-299.755) * (-301.786) (-298.678) [-299.691] (-298.776) -- 0:00:59
48500 -- (-303.460) (-302.596) [-302.636] (-299.952) * (-300.302) (-301.516) (-299.662) [-299.947] -- 0:00:58
49000 -- (-300.950) [-304.051] (-301.335) (-299.450) * (-300.271) (-302.350) [-301.547] (-301.273) -- 0:00:58
49500 -- (-299.637) [-299.417] (-301.170) (-298.942) * (-299.706) (-299.856) [-300.275] (-302.211) -- 0:01:16
50000 -- (-301.890) [-299.902] (-299.417) (-301.044) * (-299.272) (-299.705) (-299.450) [-299.908] -- 0:01:16
Average standard deviation of split frequencies: 0.034480
50500 -- [-298.437] (-300.074) (-300.011) (-301.473) * [-299.446] (-302.014) (-303.786) (-298.773) -- 0:01:15
51000 -- [-298.310] (-299.040) (-301.779) (-302.373) * (-299.911) (-302.360) (-299.911) [-298.764] -- 0:01:14
51500 -- (-301.111) (-298.702) [-301.226] (-299.169) * (-300.278) (-301.211) (-302.264) [-299.165] -- 0:01:13
52000 -- (-301.071) [-298.657] (-299.624) (-302.641) * (-298.756) [-299.970] (-298.956) (-300.993) -- 0:01:12
52500 -- (-301.968) [-300.587] (-300.151) (-302.047) * (-299.829) [-299.947] (-300.968) (-299.399) -- 0:01:12
53000 -- (-300.425) [-301.128] (-299.750) (-301.737) * [-299.127] (-299.258) (-304.500) (-302.748) -- 0:01:11
53500 -- (-299.340) [-302.182] (-303.177) (-299.984) * (-302.372) (-300.824) [-302.484] (-300.158) -- 0:01:10
54000 -- [-301.373] (-299.597) (-299.769) (-301.420) * (-298.756) (-300.054) [-299.527] (-300.823) -- 0:01:10
54500 -- (-300.231) (-300.566) (-298.397) [-300.400] * [-300.338] (-300.906) (-302.536) (-299.537) -- 0:01:09
55000 -- [-298.644] (-299.498) (-299.952) (-299.770) * [-304.909] (-301.402) (-301.753) (-300.329) -- 0:01:08
Average standard deviation of split frequencies: 0.034139
55500 -- (-300.471) (-300.706) (-303.140) [-299.648] * [-300.180] (-299.950) (-300.239) (-299.521) -- 0:01:08
56000 -- (-300.167) [-298.951] (-300.449) (-301.247) * (-300.183) [-299.438] (-302.717) (-299.706) -- 0:01:07
56500 -- [-300.411] (-299.249) (-298.759) (-306.857) * (-300.744) [-301.088] (-301.792) (-300.930) -- 0:01:06
57000 -- [-300.116] (-300.639) (-299.474) (-305.246) * (-299.921) (-301.011) [-298.179] (-299.011) -- 0:01:06
57500 -- (-306.609) (-303.639) (-299.773) [-302.496] * [-300.144] (-299.161) (-300.859) (-299.676) -- 0:01:05
58000 -- (-301.202) (-300.441) [-300.207] (-302.231) * (-301.615) (-300.182) [-299.417] (-303.857) -- 0:01:04
58500 -- (-302.342) (-300.151) (-300.406) [-301.969] * [-298.914] (-299.137) (-302.452) (-301.089) -- 0:01:04
59000 -- (-304.571) (-300.487) [-300.096] (-302.331) * [-298.885] (-299.411) (-305.152) (-299.750) -- 0:01:03
59500 -- (-299.571) (-302.981) (-302.701) [-300.124] * (-299.328) [-300.627] (-309.535) (-302.950) -- 0:01:03
60000 -- (-300.440) (-299.701) (-299.081) [-299.091] * (-299.052) [-302.776] (-300.370) (-308.862) -- 0:01:02
Average standard deviation of split frequencies: 0.028060
60500 -- (-301.634) (-301.975) [-300.547] (-300.692) * (-299.345) [-302.232] (-299.161) (-302.046) -- 0:01:02
61000 -- (-300.176) (-304.793) (-305.024) [-300.191] * (-300.986) (-299.223) [-299.577] (-301.552) -- 0:01:01
61500 -- (-300.514) (-298.491) [-299.833] (-302.379) * (-298.821) (-298.512) [-300.553] (-302.840) -- 0:01:01
62000 -- (-301.063) (-299.224) [-298.637] (-303.038) * (-302.493) (-304.488) [-304.385] (-300.624) -- 0:01:00
62500 -- (-300.388) [-299.812] (-299.422) (-300.731) * (-300.482) (-304.041) [-299.101] (-301.567) -- 0:01:00
63000 -- [-301.976] (-301.500) (-300.804) (-301.799) * (-299.345) (-298.822) [-299.700] (-303.198) -- 0:00:59
63500 -- (-299.201) [-301.905] (-298.918) (-303.341) * (-301.826) [-299.174] (-302.352) (-303.054) -- 0:00:58
64000 -- (-298.754) [-300.613] (-300.456) (-299.830) * (-299.982) (-299.781) (-300.909) [-304.000] -- 0:00:58
64500 -- [-299.159] (-303.067) (-299.533) (-298.657) * (-300.515) (-302.828) (-301.275) [-299.614] -- 0:00:58
65000 -- (-300.227) [-303.811] (-301.338) (-299.341) * (-301.301) (-301.338) (-302.137) [-299.251] -- 0:00:57
Average standard deviation of split frequencies: 0.026070
65500 -- (-298.608) [-303.681] (-300.374) (-299.166) * (-299.709) [-300.295] (-300.881) (-301.138) -- 0:00:57
66000 -- [-299.340] (-302.795) (-303.231) (-299.073) * (-300.713) [-299.635] (-302.763) (-300.027) -- 0:01:10
66500 -- [-299.596] (-307.265) (-300.667) (-302.701) * [-302.505] (-298.769) (-304.608) (-300.811) -- 0:01:10
67000 -- (-301.776) (-299.494) (-299.659) [-298.369] * [-302.975] (-298.676) (-302.601) (-303.287) -- 0:01:09
67500 -- (-298.688) [-299.806] (-299.738) (-299.608) * (-299.256) [-299.565] (-304.329) (-298.749) -- 0:01:09
68000 -- [-299.896] (-300.722) (-298.871) (-298.313) * [-299.557] (-302.590) (-301.763) (-298.711) -- 0:01:08
68500 -- [-299.385] (-298.552) (-299.538) (-299.203) * (-302.216) (-305.999) [-300.370] (-299.767) -- 0:01:07
69000 -- (-301.677) [-300.668] (-302.287) (-299.521) * (-302.553) (-302.751) [-299.698] (-300.369) -- 0:01:07
69500 -- [-303.174] (-302.227) (-300.421) (-300.315) * [-303.835] (-300.252) (-302.823) (-299.574) -- 0:01:06
70000 -- (-301.740) [-302.092] (-300.911) (-302.459) * (-299.654) (-299.389) [-300.952] (-303.557) -- 0:01:06
Average standard deviation of split frequencies: 0.022821
70500 -- (-306.555) (-307.206) (-301.709) [-300.934] * (-298.981) [-299.126] (-299.372) (-301.533) -- 0:01:05
71000 -- (-305.431) [-302.395] (-301.855) (-298.304) * (-300.839) (-302.257) [-301.617] (-304.625) -- 0:01:05
71500 -- (-301.972) (-300.080) (-299.007) [-300.402] * (-300.259) (-299.642) [-298.966] (-302.785) -- 0:01:04
72000 -- [-300.660] (-298.973) (-299.146) (-300.803) * (-300.098) (-298.631) (-300.026) [-301.083] -- 0:01:04
72500 -- (-301.476) (-302.484) [-300.465] (-299.229) * (-299.243) (-298.962) [-300.320] (-305.991) -- 0:01:03
73000 -- (-301.021) (-300.808) (-298.966) [-298.247] * (-300.764) (-299.890) [-299.745] (-302.664) -- 0:01:03
73500 -- (-300.547) [-299.953] (-302.261) (-299.437) * (-299.646) (-301.744) [-301.434] (-302.605) -- 0:01:03
74000 -- (-299.819) [-298.485] (-301.880) (-301.602) * (-298.888) (-302.064) [-300.660] (-298.494) -- 0:01:02
74500 -- [-301.721] (-298.966) (-309.421) (-301.427) * (-299.137) (-301.528) [-298.623] (-301.192) -- 0:01:02
75000 -- [-299.030] (-299.515) (-304.385) (-299.279) * [-299.803] (-298.794) (-298.580) (-300.263) -- 0:01:01
Average standard deviation of split frequencies: 0.022526
75500 -- [-300.125] (-302.660) (-302.153) (-301.402) * (-300.681) (-299.929) [-300.960] (-301.621) -- 0:01:01
76000 -- (-300.974) (-300.279) (-298.664) [-300.075] * (-302.036) (-298.861) [-299.962] (-305.965) -- 0:01:00
76500 -- [-299.264] (-300.926) (-298.669) (-298.803) * (-300.830) [-298.956] (-300.036) (-300.784) -- 0:01:00
77000 -- [-300.832] (-300.327) (-298.699) (-302.461) * [-300.025] (-299.513) (-302.635) (-301.161) -- 0:00:59
77500 -- [-299.220] (-300.670) (-300.661) (-300.679) * [-298.571] (-300.572) (-300.331) (-302.431) -- 0:00:59
78000 -- (-302.439) (-301.245) (-300.778) [-302.095] * (-300.172) (-299.166) [-299.834] (-300.421) -- 0:00:59
78500 -- (-299.145) (-299.947) [-299.628] (-303.346) * (-299.759) [-300.681] (-299.913) (-299.039) -- 0:00:58
79000 -- (-303.013) [-299.069] (-301.339) (-298.646) * [-301.215] (-303.645) (-299.963) (-299.373) -- 0:00:58
79500 -- [-303.514] (-299.496) (-302.952) (-307.111) * (-302.004) [-300.098] (-300.852) (-303.613) -- 0:00:57
80000 -- (-301.420) (-298.843) (-299.092) [-304.448] * (-303.619) (-300.667) (-302.974) [-301.680] -- 0:00:57
Average standard deviation of split frequencies: 0.018627
80500 -- (-301.156) [-301.115] (-299.201) (-304.397) * (-299.531) (-299.600) [-299.877] (-302.027) -- 0:00:57
81000 -- (-301.322) [-300.285] (-300.110) (-300.974) * (-300.997) (-299.692) (-299.322) [-302.831] -- 0:00:56
81500 -- (-299.146) (-300.222) (-302.736) [-298.955] * (-302.317) (-300.726) [-300.218] (-300.623) -- 0:00:56
82000 -- [-302.520] (-300.286) (-299.776) (-299.436) * [-298.715] (-298.322) (-302.112) (-298.419) -- 0:00:55
82500 -- (-302.870) (-299.741) (-300.602) [-299.052] * (-302.523) (-300.913) (-302.132) [-298.776] -- 0:00:55
83000 -- [-301.261] (-300.338) (-299.951) (-298.904) * (-302.778) [-299.927] (-299.706) (-302.911) -- 0:01:06
83500 -- (-300.162) (-302.265) (-301.713) [-299.315] * (-302.282) (-303.794) [-298.390] (-301.387) -- 0:01:05
84000 -- (-301.956) [-301.027] (-300.116) (-301.513) * (-300.020) (-301.856) [-302.189] (-300.316) -- 0:01:05
84500 -- (-305.491) (-299.223) (-304.701) [-298.320] * [-300.971] (-301.923) (-300.136) (-300.196) -- 0:01:05
85000 -- (-299.639) [-300.517] (-302.631) (-305.798) * (-301.868) [-301.032] (-305.546) (-300.757) -- 0:01:04
Average standard deviation of split frequencies: 0.017734
85500 -- (-299.410) [-299.936] (-298.114) (-299.891) * (-300.835) [-300.013] (-301.901) (-304.348) -- 0:01:04
86000 -- [-298.244] (-303.882) (-300.241) (-300.394) * [-301.641] (-302.169) (-300.732) (-305.064) -- 0:01:03
86500 -- (-298.370) [-302.603] (-309.723) (-299.904) * [-301.248] (-298.789) (-301.429) (-302.778) -- 0:01:03
87000 -- [-300.568] (-303.512) (-299.126) (-300.504) * (-299.378) (-302.823) (-302.714) [-299.839] -- 0:01:02
87500 -- (-301.115) (-301.015) (-302.154) [-305.059] * (-302.121) [-299.629] (-301.515) (-298.624) -- 0:01:02
88000 -- (-302.196) [-299.277] (-300.810) (-304.985) * [-299.587] (-303.021) (-302.909) (-299.003) -- 0:01:02
88500 -- (-303.025) (-302.136) (-299.374) [-300.534] * (-304.216) (-299.614) (-299.474) [-298.766] -- 0:01:01
89000 -- (-299.677) (-299.619) (-299.271) [-300.383] * (-306.726) [-298.736] (-300.108) (-301.475) -- 0:01:01
89500 -- [-302.292] (-300.852) (-298.980) (-300.399) * (-301.226) (-302.391) (-299.879) [-301.393] -- 0:01:01
90000 -- (-299.916) (-302.276) (-299.873) [-299.161] * (-301.824) [-300.993] (-300.883) (-304.553) -- 0:01:00
Average standard deviation of split frequencies: 0.020186
90500 -- [-299.503] (-301.165) (-302.017) (-299.768) * (-304.481) [-300.991] (-298.872) (-300.418) -- 0:01:00
91000 -- (-299.799) [-299.665] (-303.349) (-298.749) * (-302.529) [-300.765] (-298.331) (-299.589) -- 0:00:59
91500 -- (-301.680) (-300.592) (-305.381) [-298.818] * (-301.510) (-302.187) (-301.650) [-300.802] -- 0:00:59
92000 -- [-300.591] (-300.514) (-301.614) (-298.709) * (-300.377) [-300.851] (-302.236) (-301.160) -- 0:00:59
92500 -- [-300.621] (-300.769) (-302.313) (-298.512) * (-299.218) (-301.641) (-300.832) [-299.160] -- 0:00:58
93000 -- [-303.149] (-299.180) (-300.117) (-299.143) * (-299.072) [-299.217] (-302.446) (-299.780) -- 0:00:58
93500 -- (-301.146) (-301.121) (-298.537) [-299.211] * [-300.184] (-300.358) (-300.309) (-300.216) -- 0:00:58
94000 -- (-302.742) [-300.639] (-299.266) (-300.088) * (-299.265) [-299.842] (-302.107) (-298.548) -- 0:00:57
94500 -- [-302.813] (-298.717) (-300.575) (-299.897) * [-300.463] (-305.139) (-301.149) (-303.463) -- 0:00:57
95000 -- (-300.069) (-298.733) [-299.489] (-301.911) * (-299.122) [-304.433] (-309.224) (-300.859) -- 0:00:57
Average standard deviation of split frequencies: 0.021790
95500 -- [-298.950] (-299.473) (-307.182) (-299.239) * (-302.916) (-300.406) [-300.787] (-301.583) -- 0:00:56
96000 -- (-300.085) [-299.231] (-299.714) (-300.369) * (-301.262) (-300.822) (-300.768) [-300.057] -- 0:00:56
96500 -- (-299.553) (-301.579) [-300.068] (-301.753) * [-299.129] (-300.415) (-299.613) (-300.077) -- 0:00:56
97000 -- [-299.472] (-301.738) (-300.825) (-300.342) * [-299.681] (-302.479) (-302.190) (-299.769) -- 0:00:55
97500 -- [-299.565] (-301.120) (-300.834) (-300.754) * (-302.989) (-300.349) (-299.530) [-299.159] -- 0:00:55
98000 -- [-303.679] (-299.782) (-304.144) (-303.509) * (-299.204) (-302.306) (-299.991) [-301.198] -- 0:00:55
98500 -- (-300.419) (-301.108) [-302.921] (-300.657) * [-299.292] (-300.918) (-299.724) (-298.652) -- 0:00:54
99000 -- [-299.195] (-302.994) (-299.686) (-299.185) * (-303.861) (-300.130) (-299.103) [-299.231] -- 0:00:54
99500 -- (-299.794) (-300.356) [-298.925] (-299.158) * (-301.902) (-300.703) (-299.728) [-298.376] -- 0:00:54
100000 -- (-302.203) (-299.601) [-300.254] (-299.711) * (-300.218) (-300.512) (-298.480) [-298.378] -- 0:00:54
Average standard deviation of split frequencies: 0.020109
100500 -- [-303.429] (-302.065) (-300.443) (-303.254) * (-300.536) (-298.946) (-300.544) [-298.716] -- 0:01:02
101000 -- (-303.898) [-302.085] (-300.758) (-305.386) * (-299.026) (-300.022) (-302.739) [-300.948] -- 0:01:02
101500 -- (-300.230) (-299.020) [-300.066] (-299.147) * [-300.098] (-302.014) (-303.758) (-302.909) -- 0:01:01
102000 -- (-304.535) [-298.195] (-300.186) (-298.748) * (-304.064) (-300.390) (-300.784) [-302.431] -- 0:01:01
102500 -- (-301.097) [-299.930] (-299.230) (-300.738) * [-300.093] (-299.285) (-299.732) (-299.757) -- 0:01:01
103000 -- (-302.304) (-299.441) [-298.533] (-303.303) * (-300.223) (-300.159) [-301.337] (-298.287) -- 0:01:00
103500 -- (-304.905) (-300.836) (-298.966) [-298.807] * (-299.741) (-301.453) (-300.115) [-301.963] -- 0:01:00
104000 -- (-303.371) [-303.531] (-299.745) (-300.200) * [-298.614] (-299.385) (-300.720) (-306.864) -- 0:01:00
104500 -- (-301.187) [-302.047] (-299.928) (-302.789) * [-300.329] (-301.656) (-300.862) (-304.187) -- 0:00:59
105000 -- (-301.141) [-300.031] (-300.603) (-301.083) * (-301.641) [-301.743] (-299.511) (-302.133) -- 0:00:59
Average standard deviation of split frequencies: 0.017542
105500 -- (-299.850) [-300.803] (-299.574) (-299.487) * (-301.247) (-299.470) (-302.949) [-302.894] -- 0:00:59
106000 -- (-300.900) [-303.763] (-299.075) (-300.923) * (-300.160) (-299.544) (-300.315) [-301.313] -- 0:00:59
106500 -- (-301.558) (-302.168) (-300.639) [-299.495] * (-299.094) (-304.785) [-302.385] (-299.402) -- 0:00:58
107000 -- [-301.014] (-300.983) (-300.100) (-299.097) * (-305.594) (-301.546) [-301.278] (-300.443) -- 0:00:58
107500 -- [-303.435] (-300.108) (-303.428) (-300.850) * (-301.542) (-301.864) (-300.478) [-303.683] -- 0:00:58
108000 -- (-301.354) [-301.397] (-301.037) (-305.543) * [-302.706] (-305.229) (-300.437) (-299.006) -- 0:00:57
108500 -- (-299.543) [-300.178] (-298.724) (-306.938) * (-302.959) [-299.364] (-300.404) (-301.313) -- 0:00:57
109000 -- [-300.907] (-302.076) (-300.251) (-301.195) * (-301.707) (-301.143) [-302.909] (-300.209) -- 0:00:57
109500 -- (-298.458) (-300.234) (-301.729) [-301.188] * (-303.043) (-302.767) [-299.733] (-302.501) -- 0:00:56
110000 -- (-300.258) [-299.647] (-301.041) (-300.335) * (-305.701) [-299.643] (-300.884) (-298.805) -- 0:00:56
Average standard deviation of split frequencies: 0.016092
110500 -- [-300.503] (-298.811) (-301.657) (-301.167) * (-299.210) (-303.419) (-301.167) [-300.741] -- 0:00:56
111000 -- [-299.860] (-301.544) (-302.273) (-301.024) * (-299.519) (-300.454) (-299.389) [-299.451] -- 0:00:56
111500 -- (-299.428) (-302.208) (-299.862) [-298.783] * (-300.209) (-301.622) (-300.730) [-299.633] -- 0:00:55
112000 -- [-299.676] (-301.996) (-303.437) (-299.398) * (-300.717) (-299.209) [-300.161] (-303.112) -- 0:00:55
112500 -- [-300.553] (-299.077) (-302.672) (-306.375) * (-298.821) (-299.184) [-301.193] (-304.524) -- 0:00:55
113000 -- (-298.764) [-299.545] (-301.685) (-298.249) * [-301.497] (-300.241) (-300.367) (-299.054) -- 0:00:54
113500 -- [-300.731] (-300.865) (-300.320) (-302.849) * (-298.532) (-299.050) [-299.699] (-302.519) -- 0:00:54
114000 -- (-298.282) [-299.125] (-300.631) (-305.059) * [-299.166] (-299.925) (-300.137) (-302.799) -- 0:00:54
114500 -- (-304.925) (-302.113) (-301.895) [-303.848] * (-300.973) (-300.371) (-302.052) [-300.580] -- 0:00:54
115000 -- (-303.006) [-302.453] (-299.357) (-303.678) * [-302.866] (-300.484) (-299.978) (-298.249) -- 0:00:53
Average standard deviation of split frequencies: 0.015299
115500 -- (-299.540) [-298.194] (-300.265) (-303.561) * (-299.935) (-303.216) (-301.291) [-299.453] -- 0:00:53
116000 -- (-302.443) (-299.974) (-302.341) [-300.867] * [-298.241] (-301.946) (-300.094) (-298.715) -- 0:00:53
116500 -- [-299.457] (-304.183) (-303.763) (-299.306) * (-300.358) (-304.090) (-300.287) [-301.080] -- 0:00:53
117000 -- [-299.561] (-298.638) (-300.093) (-300.252) * (-300.863) (-300.404) [-302.038] (-300.051) -- 0:00:52
117500 -- (-301.317) (-302.083) [-302.649] (-303.811) * (-301.068) [-300.192] (-300.351) (-300.348) -- 0:01:00
118000 -- (-302.160) (-302.394) [-300.180] (-300.839) * [-298.927] (-302.941) (-298.390) (-299.421) -- 0:00:59
118500 -- [-298.333] (-302.935) (-299.773) (-301.324) * (-303.556) (-299.539) (-299.393) [-300.454] -- 0:00:59
119000 -- (-298.514) (-304.308) [-302.170] (-300.776) * [-305.695] (-299.110) (-299.484) (-300.035) -- 0:00:59
119500 -- [-299.009] (-299.405) (-300.038) (-300.204) * (-300.002) [-299.665] (-299.654) (-299.343) -- 0:00:58
120000 -- (-299.917) [-301.696] (-299.975) (-300.015) * [-299.281] (-299.274) (-301.023) (-298.851) -- 0:00:58
Average standard deviation of split frequencies: 0.013558
120500 -- (-301.416) [-298.495] (-306.189) (-302.257) * (-301.350) (-300.827) (-300.026) [-299.919] -- 0:00:58
121000 -- [-298.884] (-299.649) (-303.545) (-300.037) * [-299.500] (-309.572) (-299.688) (-300.872) -- 0:00:58
121500 -- [-299.834] (-299.806) (-305.613) (-303.618) * (-300.228) (-301.885) [-298.625] (-301.959) -- 0:00:57
122000 -- (-301.755) (-300.086) (-301.044) [-302.208] * [-299.791] (-302.520) (-298.765) (-301.816) -- 0:00:57
122500 -- (-299.256) (-298.313) [-298.828] (-302.506) * (-303.040) [-305.176] (-299.819) (-301.961) -- 0:00:57
123000 -- [-301.292] (-298.622) (-298.599) (-299.569) * (-301.185) (-301.137) [-300.505] (-299.416) -- 0:00:57
123500 -- (-299.919) [-298.529] (-303.416) (-301.466) * (-301.287) [-299.531] (-299.974) (-303.836) -- 0:00:56
124000 -- (-301.772) (-299.968) [-300.840] (-298.715) * [-299.037] (-299.291) (-300.789) (-300.627) -- 0:00:56
124500 -- (-299.119) (-298.325) (-298.579) [-299.618] * (-302.883) [-300.503] (-301.455) (-302.977) -- 0:00:56
125000 -- (-299.385) (-298.354) (-300.168) [-300.533] * (-303.545) [-298.442] (-305.281) (-304.235) -- 0:00:56
Average standard deviation of split frequencies: 0.010344
125500 -- (-299.453) (-298.634) (-302.348) [-301.715] * (-299.695) [-299.574] (-301.717) (-299.122) -- 0:00:55
126000 -- (-301.691) (-300.040) (-305.204) [-303.176] * (-299.148) (-300.590) (-299.985) [-299.864] -- 0:00:55
126500 -- (-303.773) [-299.205] (-300.685) (-298.445) * [-300.285] (-301.023) (-298.745) (-298.526) -- 0:00:55
127000 -- (-302.297) (-302.827) [-299.410] (-301.258) * [-299.167] (-308.555) (-299.431) (-298.484) -- 0:00:54
127500 -- (-299.677) [-300.404] (-299.674) (-299.784) * (-301.823) (-307.171) [-301.590] (-299.735) -- 0:00:54
128000 -- (-300.017) (-300.146) (-301.387) [-299.166] * (-300.114) [-299.439] (-301.440) (-303.150) -- 0:00:54
128500 -- (-299.233) (-301.335) (-299.977) [-300.394] * [-298.826] (-301.711) (-302.542) (-300.324) -- 0:00:54
129000 -- (-303.035) [-299.293] (-301.726) (-301.264) * (-301.968) (-303.253) (-302.668) [-298.937] -- 0:00:54
129500 -- [-299.960] (-300.436) (-300.789) (-302.624) * (-300.926) (-299.530) [-299.391] (-299.019) -- 0:00:53
130000 -- (-300.991) [-300.787] (-304.735) (-299.609) * [-299.293] (-300.610) (-300.315) (-299.667) -- 0:00:53
Average standard deviation of split frequencies: 0.012096
130500 -- (-300.735) (-302.739) [-298.694] (-301.588) * (-301.652) [-299.554] (-300.708) (-302.816) -- 0:00:53
131000 -- (-299.282) (-300.152) (-299.043) [-300.846] * (-300.188) [-298.789] (-301.385) (-298.595) -- 0:00:53
131500 -- [-299.406] (-306.482) (-301.139) (-299.824) * (-299.835) [-299.639] (-298.794) (-300.550) -- 0:00:52
132000 -- (-300.527) (-298.162) (-302.780) [-299.856] * (-299.612) [-301.783] (-302.995) (-302.043) -- 0:00:52
132500 -- [-302.071] (-299.673) (-300.589) (-301.086) * (-298.761) [-300.287] (-302.369) (-301.956) -- 0:00:52
133000 -- (-303.611) (-299.565) [-301.167] (-300.328) * (-299.293) (-298.967) [-300.529] (-299.835) -- 0:00:52
133500 -- (-302.669) (-301.321) [-301.669] (-303.552) * [-299.314] (-299.507) (-301.406) (-300.960) -- 0:00:51
134000 -- (-299.879) (-299.736) [-299.779] (-301.834) * (-301.059) [-298.472] (-300.900) (-300.857) -- 0:00:51
134500 -- [-301.421] (-300.006) (-299.421) (-300.092) * (-300.718) (-300.207) [-300.277] (-299.560) -- 0:00:51
135000 -- (-301.743) [-304.734] (-302.116) (-300.786) * (-300.782) [-300.057] (-299.859) (-298.174) -- 0:00:57
Average standard deviation of split frequencies: 0.011622
135500 -- (-298.468) (-302.511) [-302.301] (-300.756) * [-299.628] (-301.387) (-304.792) (-300.011) -- 0:00:57
136000 -- (-300.222) [-300.859] (-301.251) (-303.476) * (-299.613) [-299.135] (-302.684) (-300.756) -- 0:00:57
136500 -- (-300.676) (-299.232) (-300.787) [-300.225] * (-300.890) [-301.985] (-299.204) (-299.976) -- 0:00:56
137000 -- (-299.300) [-300.224] (-300.105) (-302.788) * [-299.838] (-299.222) (-302.572) (-300.885) -- 0:00:56
137500 -- (-298.733) (-298.899) (-302.811) [-301.049] * [-301.052] (-301.283) (-298.467) (-301.115) -- 0:00:56
138000 -- (-298.490) (-298.259) (-300.539) [-302.383] * [-299.540] (-300.935) (-299.075) (-304.535) -- 0:00:56
138500 -- (-301.457) (-300.544) (-300.478) [-301.237] * (-299.611) (-302.807) [-300.526] (-300.994) -- 0:00:55
139000 -- [-299.880] (-299.796) (-302.099) (-300.969) * [-299.521] (-302.452) (-302.954) (-301.059) -- 0:00:55
139500 -- [-299.484] (-301.997) (-298.970) (-303.330) * (-300.881) (-301.556) (-301.103) [-301.179] -- 0:00:55
140000 -- (-300.109) (-299.733) (-302.655) [-298.437] * [-301.114] (-300.941) (-302.101) (-302.940) -- 0:00:55
Average standard deviation of split frequencies: 0.015499
140500 -- (-300.260) (-299.189) [-301.979] (-301.104) * [-301.308] (-299.839) (-298.630) (-302.603) -- 0:00:55
141000 -- (-300.245) (-301.033) (-301.333) [-299.208] * (-301.211) (-299.323) [-298.698] (-303.242) -- 0:00:54
141500 -- (-301.202) [-300.443] (-305.252) (-298.745) * [-301.478] (-300.845) (-306.444) (-302.161) -- 0:00:54
142000 -- [-298.494] (-298.470) (-306.681) (-300.867) * (-300.323) [-300.716] (-302.277) (-298.538) -- 0:00:54
142500 -- (-299.310) [-299.533] (-299.005) (-302.646) * [-299.409] (-303.652) (-298.833) (-300.214) -- 0:00:54
143000 -- (-298.779) (-301.793) (-301.977) [-299.587] * (-298.213) (-301.699) (-303.624) [-301.009] -- 0:00:53
143500 -- (-299.953) (-301.230) [-301.471] (-300.746) * [-298.452] (-300.788) (-303.109) (-300.949) -- 0:00:53
144000 -- (-302.528) [-301.202] (-300.148) (-300.663) * (-300.383) (-299.354) [-299.011] (-302.300) -- 0:00:53
144500 -- (-299.876) [-299.949] (-300.012) (-303.352) * (-302.828) (-305.145) [-298.955] (-303.906) -- 0:00:53
145000 -- (-299.520) (-301.044) [-299.876] (-302.259) * (-301.851) (-300.844) (-302.470) [-302.716] -- 0:00:53
Average standard deviation of split frequencies: 0.014435
145500 -- (-300.497) (-299.632) (-299.166) [-298.414] * (-305.487) [-302.929] (-299.410) (-300.686) -- 0:00:52
146000 -- [-299.509] (-299.895) (-300.058) (-299.281) * [-298.538] (-303.062) (-301.659) (-304.165) -- 0:00:52
146500 -- (-299.457) (-300.224) (-302.035) [-300.149] * [-301.108] (-305.958) (-300.399) (-299.276) -- 0:00:52
147000 -- [-301.436] (-299.393) (-301.541) (-301.186) * (-300.289) (-301.511) (-299.689) [-301.970] -- 0:00:52
147500 -- (-301.080) (-299.862) (-300.940) [-301.478] * (-301.349) [-300.598] (-302.950) (-306.463) -- 0:00:52
148000 -- (-298.907) (-299.293) [-298.414] (-302.171) * [-299.477] (-300.631) (-301.238) (-299.970) -- 0:00:51
148500 -- [-302.143] (-304.040) (-299.408) (-300.549) * (-298.342) (-300.357) [-299.981] (-299.185) -- 0:00:51
149000 -- (-301.531) (-299.690) (-299.083) [-298.993] * (-298.586) (-301.579) [-299.243] (-298.615) -- 0:00:51
149500 -- (-304.404) (-299.953) (-300.009) [-304.128] * (-300.216) [-306.671] (-305.806) (-299.265) -- 0:00:51
150000 -- (-303.030) (-299.031) [-298.904] (-305.631) * (-300.573) (-301.165) (-302.210) [-300.630] -- 0:00:51
Average standard deviation of split frequencies: 0.014908
150500 -- (-304.107) (-301.549) [-301.003] (-304.341) * (-299.437) [-304.460] (-298.515) (-300.787) -- 0:00:50
151000 -- [-300.333] (-299.700) (-302.737) (-302.295) * (-301.180) (-299.490) (-298.766) [-302.081] -- 0:00:50
151500 -- (-298.921) (-299.872) (-301.763) [-299.134] * (-298.762) [-302.666] (-300.962) (-304.460) -- 0:00:50
152000 -- [-300.075] (-300.345) (-300.659) (-299.493) * (-303.826) [-299.166] (-299.997) (-299.909) -- 0:00:55
152500 -- (-299.566) (-298.960) (-302.050) [-300.749] * (-300.615) [-302.112] (-302.650) (-300.279) -- 0:00:55
153000 -- [-302.504] (-300.980) (-301.386) (-299.997) * (-302.217) (-299.263) [-301.424] (-301.806) -- 0:00:55
153500 -- [-301.063] (-301.080) (-303.159) (-302.688) * (-306.074) [-299.506] (-304.580) (-300.980) -- 0:00:55
154000 -- (-300.650) [-300.804] (-303.707) (-298.642) * (-301.209) [-299.349] (-299.748) (-302.378) -- 0:00:54
154500 -- (-302.665) [-299.185] (-301.863) (-300.187) * [-298.987] (-303.039) (-300.222) (-302.178) -- 0:00:54
155000 -- (-306.869) (-301.953) [-305.165] (-301.184) * (-299.561) [-304.690] (-299.821) (-300.124) -- 0:00:54
Average standard deviation of split frequencies: 0.011919
155500 -- [-301.593] (-299.871) (-299.528) (-299.086) * [-298.856] (-303.016) (-302.525) (-300.452) -- 0:00:54
156000 -- (-300.750) [-298.497] (-298.852) (-300.964) * (-300.193) (-301.750) [-298.840] (-300.089) -- 0:00:54
156500 -- (-299.255) (-299.294) (-301.660) [-298.662] * (-299.389) (-299.246) [-299.216] (-302.160) -- 0:00:53
157000 -- (-299.318) [-300.850] (-299.957) (-302.294) * (-301.702) (-300.816) (-307.799) [-298.766] -- 0:00:53
157500 -- [-304.637] (-300.588) (-300.130) (-300.120) * (-299.769) [-302.061] (-304.120) (-300.198) -- 0:00:53
158000 -- (-305.936) (-301.389) [-298.919] (-299.757) * (-298.762) [-301.590] (-301.763) (-301.180) -- 0:00:53
158500 -- (-299.349) [-302.093] (-299.093) (-299.491) * (-299.753) (-303.566) [-301.248] (-300.203) -- 0:00:53
159000 -- (-301.281) (-301.908) [-302.159] (-302.485) * (-301.808) (-306.728) [-299.715] (-299.775) -- 0:00:52
159500 -- (-302.989) [-301.772] (-299.537) (-299.444) * (-299.878) [-301.243] (-300.420) (-298.682) -- 0:00:52
160000 -- (-300.044) [-299.713] (-299.078) (-300.117) * (-301.569) (-301.852) (-299.954) [-300.849] -- 0:00:52
Average standard deviation of split frequencies: 0.012388
160500 -- (-300.406) (-298.861) (-307.965) [-298.309] * (-302.532) (-299.683) (-301.280) [-301.572] -- 0:00:52
161000 -- (-301.500) (-298.956) [-301.525] (-300.897) * (-299.688) [-300.884] (-300.035) (-305.317) -- 0:00:52
161500 -- (-301.174) (-298.245) (-298.977) [-299.721] * (-299.705) (-299.784) [-299.498] (-300.453) -- 0:00:51
162000 -- (-298.659) (-299.853) [-298.603] (-302.950) * (-299.592) (-299.493) [-299.166] (-301.116) -- 0:00:51
162500 -- [-299.560] (-302.002) (-298.529) (-301.196) * [-298.543] (-302.050) (-304.037) (-299.808) -- 0:00:51
163000 -- (-302.976) (-300.522) (-301.680) [-302.813] * (-299.604) [-300.200] (-300.311) (-301.730) -- 0:00:51
163500 -- (-300.587) (-301.441) [-302.011] (-301.462) * (-302.626) (-301.692) (-304.204) [-300.844] -- 0:00:51
164000 -- (-301.068) [-299.891] (-303.065) (-300.047) * (-301.847) (-300.449) [-303.203] (-298.859) -- 0:00:50
164500 -- (-300.845) [-300.397] (-299.446) (-299.419) * (-302.216) [-300.767] (-300.859) (-299.895) -- 0:00:50
165000 -- [-298.393] (-300.780) (-303.903) (-302.145) * (-298.965) (-300.402) [-299.486] (-300.469) -- 0:00:50
Average standard deviation of split frequencies: 0.013489
165500 -- [-299.532] (-302.399) (-302.331) (-299.097) * [-298.657] (-301.687) (-300.139) (-299.756) -- 0:00:50
166000 -- (-299.200) [-299.780] (-301.410) (-303.036) * [-299.462] (-298.184) (-305.265) (-299.843) -- 0:00:50
166500 -- (-301.960) [-299.441] (-301.730) (-304.221) * [-301.211] (-302.496) (-306.304) (-298.396) -- 0:00:50
167000 -- (-299.030) (-300.149) (-300.194) [-300.720] * [-299.114] (-300.852) (-299.567) (-302.230) -- 0:00:49
167500 -- (-302.660) (-301.119) [-300.204] (-300.089) * (-301.132) (-301.069) [-302.643] (-303.211) -- 0:00:49
168000 -- (-300.895) (-306.766) [-299.869] (-298.253) * (-299.501) (-299.393) [-300.058] (-304.640) -- 0:00:49
168500 -- (-298.498) (-301.909) [-301.237] (-302.653) * (-300.405) [-300.438] (-300.531) (-303.012) -- 0:00:49
169000 -- (-301.789) (-301.715) [-298.899] (-299.988) * [-298.756] (-300.382) (-299.285) (-299.874) -- 0:00:49
169500 -- (-301.169) (-300.233) (-299.339) [-300.399] * (-299.857) (-299.954) (-298.723) [-298.848] -- 0:00:53
170000 -- (-303.131) (-299.405) [-300.130] (-301.420) * [-304.221] (-299.681) (-301.488) (-300.505) -- 0:00:53
Average standard deviation of split frequencies: 0.010013
170500 -- [-306.191] (-300.348) (-305.151) (-298.929) * [-299.424] (-299.628) (-299.013) (-302.958) -- 0:00:53
171000 -- (-308.800) (-302.345) (-301.461) [-300.384] * (-298.660) [-298.586] (-302.091) (-305.014) -- 0:00:53
171500 -- (-302.398) [-298.206] (-304.433) (-299.857) * (-302.051) (-299.355) [-299.662] (-302.402) -- 0:00:53
172000 -- (-302.139) [-298.829] (-306.812) (-299.115) * [-302.896] (-298.811) (-300.047) (-302.495) -- 0:00:52
172500 -- (-302.213) (-302.711) (-304.871) [-298.841] * (-299.045) (-298.840) (-299.822) [-299.974] -- 0:00:52
173000 -- (-300.249) (-300.318) (-301.676) [-299.088] * (-301.537) (-299.212) (-301.319) [-300.716] -- 0:00:52
173500 -- (-299.973) [-298.981] (-300.499) (-302.670) * (-299.808) (-300.195) [-306.112] (-299.708) -- 0:00:52
174000 -- (-299.611) [-299.543] (-299.224) (-301.288) * (-300.416) [-300.104] (-302.808) (-299.469) -- 0:00:52
174500 -- (-300.990) (-302.135) (-304.051) [-300.674] * (-300.836) (-299.741) (-300.749) [-300.382] -- 0:00:52
175000 -- (-300.740) (-298.094) (-299.264) [-299.626] * [-299.625] (-302.411) (-302.734) (-299.337) -- 0:00:51
Average standard deviation of split frequencies: 0.011186
175500 -- (-302.718) (-299.899) [-300.736] (-299.730) * (-299.067) [-299.027] (-300.403) (-299.533) -- 0:00:51
176000 -- (-299.159) (-300.868) (-298.794) [-298.625] * [-299.089] (-298.103) (-303.548) (-300.998) -- 0:00:51
176500 -- [-299.373] (-300.566) (-305.136) (-300.054) * [-298.549] (-303.748) (-300.567) (-299.981) -- 0:00:51
177000 -- [-300.469] (-300.137) (-304.010) (-298.909) * (-303.231) [-300.450] (-303.078) (-302.945) -- 0:00:51
177500 -- (-301.852) (-301.244) (-304.473) [-301.197] * [-302.306] (-300.239) (-302.118) (-303.715) -- 0:00:50
178000 -- (-299.652) (-299.030) [-298.770] (-299.969) * (-299.606) [-301.699] (-299.814) (-303.830) -- 0:00:50
178500 -- (-301.943) (-303.537) (-301.184) [-302.230] * (-303.594) (-300.257) (-298.701) [-305.585] -- 0:00:50
179000 -- [-301.373] (-298.808) (-299.189) (-299.186) * (-302.803) [-300.939] (-301.065) (-300.336) -- 0:00:50
179500 -- (-300.473) [-300.848] (-299.875) (-299.194) * (-304.628) [-298.605] (-299.483) (-301.352) -- 0:00:50
180000 -- (-300.706) (-299.454) [-302.709] (-299.728) * (-306.778) (-301.156) (-298.962) [-301.835] -- 0:00:50
Average standard deviation of split frequencies: 0.011358
180500 -- (-300.462) (-298.405) [-303.162] (-301.914) * [-300.747] (-301.452) (-298.725) (-300.811) -- 0:00:49
181000 -- (-299.087) [-299.724] (-303.364) (-303.767) * (-302.254) (-303.179) [-298.846] (-300.275) -- 0:00:49
181500 -- (-299.685) [-299.616] (-300.781) (-299.049) * (-299.380) [-300.674] (-300.500) (-300.464) -- 0:00:49
182000 -- (-300.360) [-303.468] (-299.190) (-299.133) * [-301.796] (-300.539) (-300.505) (-300.626) -- 0:00:49
182500 -- (-298.710) (-303.738) [-300.792] (-300.784) * [-299.072] (-300.930) (-299.258) (-301.478) -- 0:00:49
183000 -- (-300.533) (-303.006) (-301.472) [-298.974] * [-299.773] (-300.798) (-300.993) (-300.023) -- 0:00:49
183500 -- (-304.025) [-302.701] (-308.250) (-299.380) * (-300.860) (-299.861) (-299.518) [-300.665] -- 0:00:48
184000 -- (-299.705) [-299.555] (-307.536) (-300.605) * [-298.966] (-300.588) (-298.563) (-301.318) -- 0:00:48
184500 -- (-298.758) (-299.246) [-303.421] (-299.163) * (-299.710) [-300.074] (-301.756) (-301.011) -- 0:00:48
185000 -- (-305.388) [-300.538] (-299.637) (-298.506) * [-299.694] (-298.837) (-303.891) (-299.219) -- 0:00:48
Average standard deviation of split frequencies: 0.011181
185500 -- (-300.436) [-300.345] (-301.159) (-302.008) * (-302.583) [-299.348] (-300.269) (-302.264) -- 0:00:48
186000 -- (-300.330) (-301.055) [-301.053] (-300.629) * (-300.204) (-299.458) [-298.726] (-308.406) -- 0:00:48
186500 -- (-298.615) (-299.035) (-301.225) [-300.026] * (-302.373) [-299.538] (-301.845) (-300.607) -- 0:00:52
187000 -- [-299.454] (-299.219) (-301.199) (-300.143) * (-299.013) [-301.826] (-299.997) (-300.597) -- 0:00:52
187500 -- [-301.580] (-301.081) (-301.386) (-301.230) * (-299.441) (-299.626) (-301.503) [-300.939] -- 0:00:52
188000 -- [-302.334] (-299.148) (-302.021) (-299.595) * [-299.773] (-299.584) (-300.711) (-304.506) -- 0:00:51
188500 -- (-303.042) (-299.014) [-301.402] (-298.743) * [-300.726] (-298.982) (-302.903) (-308.055) -- 0:00:51
189000 -- (-303.273) (-299.971) (-301.636) [-300.561] * [-299.077] (-299.109) (-299.059) (-300.821) -- 0:00:51
189500 -- (-300.534) (-300.077) (-298.999) [-299.480] * [-298.489] (-299.134) (-299.516) (-301.661) -- 0:00:51
190000 -- (-298.985) [-299.788] (-304.702) (-301.520) * (-299.193) (-303.913) [-301.622] (-311.734) -- 0:00:51
Average standard deviation of split frequencies: 0.011344
190500 -- (-304.982) [-301.950] (-301.731) (-300.444) * (-300.601) [-307.150] (-301.470) (-307.284) -- 0:00:50
191000 -- (-300.428) [-299.095] (-299.884) (-300.418) * (-308.098) (-304.330) (-301.025) [-300.191] -- 0:00:50
191500 -- [-300.140] (-303.686) (-298.998) (-303.742) * (-299.427) [-302.040] (-302.219) (-299.528) -- 0:00:50
192000 -- (-299.752) (-300.636) [-300.937] (-301.475) * (-301.508) (-300.238) [-298.440] (-298.953) -- 0:00:50
192500 -- (-300.191) (-305.370) (-299.890) [-300.785] * (-302.423) (-302.802) [-298.579] (-299.305) -- 0:00:50
193000 -- (-301.155) [-301.588] (-300.302) (-303.934) * [-300.528] (-302.718) (-300.612) (-300.762) -- 0:00:50
193500 -- (-300.931) (-299.020) [-300.140] (-300.787) * (-299.169) (-301.839) [-301.119] (-299.307) -- 0:00:50
194000 -- (-301.489) [-299.483] (-300.946) (-300.540) * (-304.323) (-299.895) [-304.634] (-300.953) -- 0:00:49
194500 -- (-301.945) (-303.159) [-299.177] (-301.208) * (-299.049) (-300.075) (-302.643) [-301.713] -- 0:00:49
195000 -- (-300.000) (-300.078) (-300.883) [-299.997] * (-302.649) (-298.750) [-298.734] (-301.007) -- 0:00:49
Average standard deviation of split frequencies: 0.012293
195500 -- (-304.561) (-299.303) [-300.585] (-301.147) * (-301.066) (-299.383) (-300.711) [-300.268] -- 0:00:49
196000 -- (-302.486) [-300.422] (-298.998) (-299.247) * [-303.518] (-302.529) (-298.731) (-304.667) -- 0:00:49
196500 -- (-304.976) (-301.825) (-301.023) [-298.690] * (-301.242) (-302.376) (-307.091) [-300.090] -- 0:00:49
197000 -- [-300.450] (-300.454) (-301.127) (-299.156) * [-299.236] (-300.541) (-299.419) (-299.770) -- 0:00:48
197500 -- [-299.321] (-299.797) (-300.584) (-300.536) * (-299.261) [-299.199] (-298.366) (-300.898) -- 0:00:48
198000 -- (-298.145) (-300.137) (-301.623) [-300.768] * [-300.427] (-298.651) (-300.320) (-302.353) -- 0:00:48
198500 -- (-299.266) [-298.895] (-305.635) (-299.465) * (-299.140) [-299.112] (-303.220) (-304.481) -- 0:00:48
199000 -- (-301.558) [-301.643] (-300.971) (-299.746) * [-298.412] (-299.359) (-299.713) (-303.084) -- 0:00:48
199500 -- (-303.290) (-301.157) [-299.005] (-301.075) * [-299.727] (-300.598) (-301.824) (-300.559) -- 0:00:48
200000 -- (-304.440) (-301.598) [-300.109] (-300.251) * (-303.173) [-299.356] (-300.674) (-300.894) -- 0:00:48
Average standard deviation of split frequencies: 0.011870
200500 -- (-300.403) (-300.703) (-306.330) [-299.478] * (-298.751) [-300.986] (-301.102) (-300.321) -- 0:00:47
201000 -- [-300.792] (-298.983) (-300.582) (-301.241) * (-305.413) (-299.069) (-302.948) [-301.897] -- 0:00:47
201500 -- (-299.951) (-299.229) [-298.492] (-301.176) * (-304.051) (-299.632) (-298.617) [-301.315] -- 0:00:47
202000 -- (-301.799) [-299.210] (-300.641) (-305.723) * (-303.856) [-300.060] (-301.751) (-304.296) -- 0:00:47
202500 -- (-299.143) (-300.102) [-301.610] (-307.283) * [-305.367] (-299.214) (-299.074) (-300.736) -- 0:00:47
203000 -- [-298.341] (-298.577) (-299.684) (-299.942) * (-302.060) (-303.637) (-302.659) [-302.375] -- 0:00:47
203500 -- (-299.826) [-298.483] (-304.779) (-299.417) * (-301.302) [-303.390] (-302.144) (-303.593) -- 0:00:50
204000 -- [-300.287] (-298.816) (-302.273) (-300.044) * [-299.863] (-299.697) (-299.615) (-303.068) -- 0:00:50
204500 -- (-302.895) (-298.796) (-299.225) [-299.523] * (-301.099) [-299.629] (-301.257) (-303.167) -- 0:00:50
205000 -- [-301.475] (-300.715) (-303.667) (-300.231) * [-300.833] (-303.072) (-299.688) (-298.710) -- 0:00:50
Average standard deviation of split frequencies: 0.013008
205500 -- (-300.685) [-298.775] (-299.583) (-298.796) * (-299.983) [-298.846] (-303.464) (-301.205) -- 0:00:50
206000 -- (-299.401) [-304.694] (-302.221) (-302.535) * (-304.437) (-301.870) (-299.548) [-301.533] -- 0:00:50
206500 -- (-300.326) [-303.430] (-299.724) (-300.899) * (-299.104) (-302.365) (-299.604) [-299.094] -- 0:00:49
207000 -- (-299.672) [-300.075] (-301.201) (-300.215) * (-301.595) [-298.977] (-302.539) (-299.894) -- 0:00:49
207500 -- (-303.567) (-298.941) [-299.676] (-300.907) * (-304.141) (-300.709) [-299.473] (-300.906) -- 0:00:49
208000 -- [-300.441] (-301.655) (-304.189) (-303.220) * (-299.608) [-298.810] (-300.472) (-300.412) -- 0:00:49
208500 -- (-299.437) (-299.196) [-298.942] (-299.057) * (-299.960) (-300.256) [-301.956] (-299.923) -- 0:00:49
209000 -- (-301.856) (-305.025) [-299.411] (-299.309) * (-301.870) [-299.906] (-300.933) (-303.095) -- 0:00:49
209500 -- (-299.247) (-305.946) [-301.416] (-299.938) * (-300.048) [-299.614] (-300.729) (-299.784) -- 0:00:49
210000 -- (-302.792) (-303.702) [-303.337] (-305.519) * (-301.158) (-304.238) (-300.261) [-304.689] -- 0:00:48
Average standard deviation of split frequencies: 0.013308
210500 -- (-298.802) [-298.717] (-299.636) (-298.581) * [-301.938] (-298.719) (-299.767) (-305.727) -- 0:00:48
211000 -- [-302.363] (-303.821) (-301.230) (-304.698) * (-299.636) (-305.180) (-304.901) [-299.394] -- 0:00:48
211500 -- (-298.745) [-298.511] (-300.194) (-300.957) * (-300.589) (-301.696) [-300.923] (-300.467) -- 0:00:48
212000 -- (-299.432) [-299.660] (-299.040) (-302.998) * (-299.243) [-299.993] (-302.020) (-299.687) -- 0:00:48
212500 -- (-298.943) (-298.859) (-300.170) [-299.011] * (-301.957) (-299.399) [-299.443] (-299.882) -- 0:00:48
213000 -- (-303.843) [-300.175] (-299.273) (-299.401) * [-302.883] (-300.233) (-299.771) (-298.312) -- 0:00:48
213500 -- (-305.624) [-299.115] (-300.770) (-298.850) * (-300.425) (-301.832) (-304.648) [-299.690] -- 0:00:47
214000 -- (-300.101) (-298.973) [-298.382] (-299.590) * (-299.068) [-298.911] (-303.100) (-300.793) -- 0:00:47
214500 -- (-298.198) [-299.003] (-304.188) (-299.224) * (-301.185) (-298.914) [-299.952] (-299.873) -- 0:00:47
215000 -- (-299.339) [-299.386] (-302.066) (-299.966) * (-300.765) (-298.856) [-298.839] (-301.397) -- 0:00:47
Average standard deviation of split frequencies: 0.011882
215500 -- (-301.091) (-298.456) [-302.043] (-299.978) * (-299.058) (-299.710) (-301.705) [-299.876] -- 0:00:47
216000 -- (-300.118) (-304.025) [-301.114] (-300.619) * [-299.432] (-298.430) (-300.032) (-302.937) -- 0:00:47
216500 -- [-300.227] (-301.183) (-298.861) (-298.354) * (-301.126) (-301.149) [-300.136] (-301.776) -- 0:00:47
217000 -- (-298.308) (-300.742) [-302.581] (-306.062) * (-304.797) (-300.746) (-301.718) [-302.308] -- 0:00:46
217500 -- [-298.739] (-301.349) (-301.724) (-301.011) * (-300.789) [-301.141] (-299.629) (-303.237) -- 0:00:46
218000 -- (-298.514) (-305.878) [-300.857] (-299.547) * (-300.716) (-305.362) [-300.143] (-304.258) -- 0:00:46
218500 -- (-298.606) (-300.123) [-300.147] (-305.321) * (-300.026) (-299.680) (-300.894) [-300.480] -- 0:00:46
219000 -- (-300.738) [-300.017] (-298.588) (-298.928) * (-307.820) [-301.225] (-299.390) (-301.867) -- 0:00:46
219500 -- (-301.176) [-300.893] (-299.809) (-301.085) * [-299.124] (-301.138) (-299.298) (-301.349) -- 0:00:46
220000 -- (-303.729) (-301.928) (-301.340) [-301.558] * [-299.140] (-304.475) (-298.462) (-299.373) -- 0:00:46
Average standard deviation of split frequencies: 0.011310
220500 -- (-303.300) (-298.569) (-299.156) [-300.479] * [-304.894] (-303.525) (-300.074) (-301.414) -- 0:00:45
221000 -- (-300.507) (-300.934) [-301.622] (-301.581) * (-298.098) (-300.867) (-299.436) [-299.308] -- 0:00:49
221500 -- (-298.711) (-301.358) [-298.735] (-300.491) * [-299.510] (-300.452) (-301.152) (-298.486) -- 0:00:49
222000 -- (-305.686) (-301.861) [-300.605] (-301.046) * (-300.333) [-301.306] (-301.338) (-298.914) -- 0:00:49
222500 -- (-300.475) (-299.048) (-300.042) [-299.300] * (-302.711) [-300.316] (-305.979) (-299.012) -- 0:00:48
223000 -- (-301.031) (-302.489) (-301.356) [-300.648] * (-302.151) (-302.809) [-301.805] (-299.271) -- 0:00:48
223500 -- [-300.621] (-301.736) (-305.473) (-303.157) * (-302.655) (-304.577) (-300.074) [-299.658] -- 0:00:48
224000 -- [-303.237] (-301.833) (-299.385) (-300.125) * (-303.424) (-300.974) (-300.344) [-300.808] -- 0:00:48
224500 -- (-299.178) (-300.416) (-300.113) [-301.284] * [-299.809] (-302.161) (-301.901) (-300.904) -- 0:00:48
225000 -- (-300.158) (-299.099) [-299.744] (-300.791) * [-299.899] (-301.078) (-300.778) (-300.907) -- 0:00:48
Average standard deviation of split frequencies: 0.011820
225500 -- (-299.345) (-299.302) [-298.982] (-299.023) * (-301.164) (-303.463) (-302.449) [-300.869] -- 0:00:48
226000 -- [-299.621] (-312.438) (-300.686) (-300.530) * (-301.050) (-298.833) [-300.808] (-300.240) -- 0:00:47
226500 -- (-300.001) (-311.735) (-300.595) [-302.351] * (-299.470) (-299.129) [-299.328] (-300.832) -- 0:00:47
227000 -- [-299.007] (-303.505) (-299.543) (-304.475) * [-302.382] (-299.686) (-298.207) (-299.399) -- 0:00:47
227500 -- [-298.845] (-302.387) (-300.838) (-301.815) * [-299.860] (-300.590) (-298.956) (-298.751) -- 0:00:47
228000 -- [-299.796] (-301.971) (-304.357) (-304.321) * (-300.443) (-303.572) (-299.644) [-299.188] -- 0:00:47
228500 -- (-299.487) (-300.270) [-300.469] (-300.437) * [-299.872] (-300.947) (-299.920) (-301.826) -- 0:00:47
229000 -- (-301.479) (-300.625) (-301.052) [-299.880] * (-300.939) (-298.718) (-300.096) [-303.197] -- 0:00:47
229500 -- (-300.962) [-299.375] (-300.372) (-302.710) * (-298.352) (-299.014) [-300.479] (-300.478) -- 0:00:47
230000 -- (-300.389) [-302.454] (-299.075) (-298.766) * [-298.783] (-298.944) (-299.645) (-299.486) -- 0:00:46
Average standard deviation of split frequencies: 0.012603
230500 -- (-300.874) [-301.572] (-303.522) (-301.096) * (-298.185) [-303.418] (-300.620) (-299.095) -- 0:00:46
231000 -- [-299.452] (-299.529) (-300.450) (-300.706) * [-301.298] (-300.741) (-302.397) (-301.396) -- 0:00:46
231500 -- (-300.231) (-298.254) [-299.273] (-300.190) * (-300.656) [-300.589] (-302.031) (-301.023) -- 0:00:46
232000 -- [-299.047] (-299.031) (-300.584) (-300.331) * (-302.027) [-299.310] (-299.300) (-301.775) -- 0:00:46
232500 -- (-298.894) (-302.733) [-299.782] (-298.774) * (-299.631) (-301.356) (-300.617) [-301.070] -- 0:00:46
233000 -- [-299.604] (-302.544) (-300.472) (-301.224) * (-300.239) (-299.334) (-305.351) [-299.377] -- 0:00:46
233500 -- (-305.121) (-299.085) (-301.753) [-299.578] * (-299.248) (-302.080) [-300.060] (-300.723) -- 0:00:45
234000 -- (-299.740) (-298.630) (-303.951) [-298.625] * [-303.961] (-301.699) (-300.978) (-299.692) -- 0:00:45
234500 -- (-299.649) (-298.302) (-303.035) [-300.738] * (-300.094) (-301.129) [-299.801] (-299.537) -- 0:00:45
235000 -- [-302.052] (-298.881) (-300.516) (-303.388) * (-303.171) [-300.865] (-301.041) (-298.438) -- 0:00:45
Average standard deviation of split frequencies: 0.011236
235500 -- (-301.990) (-301.646) (-299.187) [-301.605] * (-300.161) (-301.486) [-299.246] (-298.320) -- 0:00:45
236000 -- (-302.960) [-301.112] (-298.621) (-301.916) * (-300.695) [-299.014] (-303.932) (-299.092) -- 0:00:45
236500 -- (-305.095) (-301.457) (-299.132) [-300.511] * (-299.378) (-301.144) [-301.726] (-299.488) -- 0:00:45
237000 -- (-301.495) (-302.195) [-299.401] (-299.832) * (-303.854) (-299.607) [-300.277] (-305.778) -- 0:00:45
237500 -- (-304.200) (-300.912) [-298.467] (-298.778) * (-301.061) (-299.725) [-303.211] (-299.880) -- 0:00:44
238000 -- [-302.643] (-300.816) (-301.604) (-300.139) * (-298.242) (-300.544) [-300.176] (-301.271) -- 0:00:48
238500 -- (-298.361) (-298.634) [-298.752] (-299.550) * [-298.992] (-300.032) (-298.520) (-300.172) -- 0:00:47
239000 -- (-302.705) (-301.150) (-300.576) [-300.299] * (-305.939) [-302.707] (-301.224) (-300.329) -- 0:00:47
239500 -- (-300.765) [-299.136] (-305.033) (-299.966) * [-301.187] (-300.575) (-301.644) (-301.555) -- 0:00:47
240000 -- (-298.848) (-299.950) [-302.254] (-305.124) * [-300.640] (-301.171) (-299.024) (-300.257) -- 0:00:47
Average standard deviation of split frequencies: 0.010773
240500 -- [-300.811] (-304.225) (-304.384) (-299.512) * (-301.342) (-300.160) (-301.235) [-301.521] -- 0:00:47
241000 -- [-298.811] (-299.296) (-304.994) (-307.099) * [-300.277] (-299.711) (-301.747) (-301.463) -- 0:00:47
241500 -- [-301.717] (-298.867) (-304.572) (-307.102) * (-299.711) [-300.318] (-303.460) (-301.490) -- 0:00:47
242000 -- [-301.312] (-299.277) (-302.022) (-302.843) * (-299.389) (-301.909) [-299.796] (-301.361) -- 0:00:46
242500 -- [-302.676] (-304.107) (-303.762) (-300.399) * [-300.234] (-301.069) (-300.048) (-303.853) -- 0:00:46
243000 -- [-303.679] (-298.785) (-299.524) (-300.746) * (-305.729) (-301.137) (-299.247) [-301.440] -- 0:00:46
243500 -- [-299.847] (-299.610) (-299.705) (-302.344) * (-301.016) [-299.644] (-301.785) (-300.459) -- 0:00:46
244000 -- (-302.584) (-302.490) (-299.878) [-299.654] * (-300.198) [-299.781] (-298.608) (-300.230) -- 0:00:46
244500 -- [-303.275] (-300.032) (-300.449) (-299.511) * (-299.703) [-299.207] (-298.960) (-302.128) -- 0:00:46
245000 -- [-299.328] (-299.187) (-301.074) (-302.652) * (-303.380) [-299.398] (-301.261) (-301.457) -- 0:00:46
Average standard deviation of split frequencies: 0.011610
245500 -- (-298.484) (-299.595) [-305.838] (-301.851) * [-302.115] (-300.170) (-303.048) (-301.222) -- 0:00:46
246000 -- [-298.953] (-301.163) (-298.453) (-301.732) * [-301.121] (-299.239) (-300.637) (-304.041) -- 0:00:45
246500 -- [-302.394] (-300.912) (-303.792) (-302.417) * [-299.946] (-301.304) (-299.573) (-300.645) -- 0:00:45
247000 -- (-301.381) (-301.607) (-298.611) [-300.064] * (-298.280) (-298.531) [-300.959] (-300.852) -- 0:00:45
247500 -- (-301.317) (-306.707) [-299.836] (-299.443) * (-299.088) [-300.593] (-301.908) (-301.192) -- 0:00:45
248000 -- (-301.657) [-300.397] (-300.450) (-298.920) * (-299.405) (-301.494) [-302.231] (-301.981) -- 0:00:45
248500 -- [-301.511] (-301.781) (-302.796) (-304.517) * (-299.982) [-299.990] (-302.007) (-299.934) -- 0:00:45
249000 -- (-302.932) (-305.516) [-300.035] (-304.862) * (-298.437) [-300.386] (-304.311) (-299.819) -- 0:00:45
249500 -- (-301.958) [-305.951] (-300.969) (-301.022) * (-301.427) (-302.957) (-301.923) [-298.299] -- 0:00:45
250000 -- (-304.399) (-300.808) (-299.171) [-299.746] * (-300.081) (-299.202) (-300.106) [-300.790] -- 0:00:45
Average standard deviation of split frequencies: 0.013687
250500 -- [-304.794] (-302.062) (-299.545) (-300.399) * (-302.818) (-298.787) (-301.634) [-299.499] -- 0:00:44
251000 -- (-298.270) (-299.705) (-299.830) [-303.295] * (-305.935) (-299.946) (-299.044) [-301.162] -- 0:00:44
251500 -- (-298.512) (-303.399) [-301.024] (-299.047) * [-301.105] (-300.814) (-303.856) (-299.877) -- 0:00:44
252000 -- [-299.133] (-302.051) (-302.085) (-301.369) * (-301.185) (-301.875) (-298.460) [-299.318] -- 0:00:44
252500 -- [-300.116] (-300.685) (-299.429) (-300.639) * (-302.207) [-299.623] (-299.122) (-304.228) -- 0:00:44
253000 -- (-300.122) (-301.896) [-302.031] (-300.717) * [-299.589] (-299.102) (-299.083) (-299.192) -- 0:00:44
253500 -- (-299.934) [-299.908] (-300.691) (-300.978) * (-301.069) [-300.801] (-299.259) (-298.590) -- 0:00:44
254000 -- (-302.932) [-299.869] (-300.909) (-300.884) * (-303.214) [-300.227] (-299.925) (-299.658) -- 0:00:44
254500 -- (-302.948) (-299.732) (-298.671) [-299.980] * (-305.680) (-300.371) (-300.196) [-302.719] -- 0:00:43
255000 -- [-303.546] (-299.558) (-299.746) (-304.182) * (-305.811) [-299.536] (-299.341) (-301.971) -- 0:00:43
Average standard deviation of split frequencies: 0.013504
255500 -- (-304.005) [-300.134] (-300.926) (-304.533) * (-301.751) (-298.552) [-299.679] (-300.146) -- 0:00:46
256000 -- (-298.466) (-306.606) (-303.032) [-299.472] * (-299.758) (-300.950) (-299.833) [-300.642] -- 0:00:46
256500 -- [-300.220] (-302.400) (-303.349) (-299.246) * [-299.409] (-302.348) (-302.829) (-299.013) -- 0:00:46
257000 -- (-299.790) (-298.902) [-299.073] (-300.006) * (-298.312) (-299.395) [-298.662] (-299.328) -- 0:00:46
257500 -- [-301.459] (-304.973) (-302.002) (-300.068) * (-306.215) (-303.111) (-300.060) [-299.773] -- 0:00:46
258000 -- [-300.147] (-301.508) (-298.412) (-301.979) * [-300.365] (-304.551) (-299.982) (-301.583) -- 0:00:46
258500 -- (-300.837) (-303.637) (-300.837) [-301.436] * [-298.618] (-301.834) (-299.824) (-300.790) -- 0:00:45
259000 -- [-304.227] (-304.732) (-301.395) (-301.389) * [-303.480] (-301.852) (-300.400) (-299.780) -- 0:00:45
259500 -- [-300.223] (-302.212) (-302.335) (-303.471) * [-298.772] (-299.524) (-299.267) (-299.899) -- 0:00:45
260000 -- (-301.604) [-300.396] (-298.619) (-299.844) * (-299.177) [-300.634] (-300.920) (-300.297) -- 0:00:45
Average standard deviation of split frequencies: 0.012780
260500 -- (-299.714) (-298.841) (-299.363) [-299.589] * (-298.709) [-300.378] (-300.222) (-301.327) -- 0:00:45
261000 -- [-299.371] (-300.299) (-298.829) (-299.326) * (-300.989) [-298.998] (-303.548) (-300.823) -- 0:00:45
261500 -- (-298.935) (-298.767) [-302.116] (-300.072) * [-299.093] (-301.245) (-301.073) (-301.593) -- 0:00:45
262000 -- (-300.707) (-299.754) (-300.451) [-299.467] * [-300.397] (-299.035) (-301.395) (-306.126) -- 0:00:45
262500 -- (-299.161) (-302.594) [-299.534] (-302.503) * (-299.344) (-301.394) [-299.262] (-305.879) -- 0:00:44
263000 -- [-299.339] (-302.435) (-301.567) (-302.428) * [-299.687] (-304.620) (-300.063) (-300.313) -- 0:00:44
263500 -- (-302.385) [-300.152] (-299.990) (-298.083) * [-303.641] (-298.413) (-300.398) (-298.974) -- 0:00:44
264000 -- (-300.527) (-302.051) (-299.639) [-300.271] * (-299.731) (-300.763) [-300.188] (-299.533) -- 0:00:44
264500 -- (-301.025) [-299.607] (-301.034) (-301.115) * (-305.113) (-301.256) [-298.369] (-299.223) -- 0:00:44
265000 -- (-299.432) [-299.800] (-300.596) (-300.863) * (-301.862) [-301.872] (-299.450) (-301.324) -- 0:00:44
Average standard deviation of split frequencies: 0.013291
265500 -- (-299.143) [-298.950] (-301.904) (-299.133) * (-300.349) [-304.531] (-302.725) (-298.866) -- 0:00:44
266000 -- (-298.346) (-303.209) [-299.108] (-305.083) * (-299.495) (-305.015) (-298.457) [-299.135] -- 0:00:44
266500 -- (-300.296) (-301.068) (-298.930) [-301.015] * (-300.912) (-301.666) (-303.277) [-299.332] -- 0:00:44
267000 -- (-299.675) [-300.008] (-301.402) (-300.224) * (-299.794) (-302.196) [-300.060] (-300.008) -- 0:00:43
267500 -- (-298.990) (-301.264) (-302.222) [-300.246] * (-301.646) (-305.498) [-301.174] (-300.583) -- 0:00:43
268000 -- (-300.603) (-299.769) (-301.291) [-299.753] * [-299.670] (-301.927) (-299.160) (-300.650) -- 0:00:43
268500 -- (-298.818) [-301.942] (-305.139) (-304.397) * (-299.466) (-300.212) [-300.055] (-300.189) -- 0:00:43
269000 -- [-301.703] (-300.330) (-301.826) (-300.864) * [-299.757] (-299.054) (-303.872) (-303.277) -- 0:00:43
269500 -- (-300.481) [-298.502] (-299.870) (-300.514) * (-300.070) (-299.557) (-298.864) [-303.710] -- 0:00:43
270000 -- [-300.989] (-301.805) (-302.271) (-301.133) * (-303.441) [-299.909] (-303.449) (-303.276) -- 0:00:43
Average standard deviation of split frequencies: 0.012579
270500 -- [-300.022] (-300.268) (-299.832) (-299.547) * (-303.747) [-300.343] (-301.756) (-302.247) -- 0:00:43
271000 -- [-300.221] (-299.966) (-299.137) (-298.964) * (-299.547) [-300.403] (-303.335) (-300.241) -- 0:00:43
271500 -- [-301.556] (-300.584) (-300.399) (-298.440) * (-298.771) (-300.466) [-298.400] (-300.263) -- 0:00:42
272000 -- [-299.545] (-299.584) (-301.264) (-298.588) * (-301.769) (-301.664) [-299.605] (-303.198) -- 0:00:42
272500 -- (-301.343) (-303.143) (-299.859) [-300.113] * (-301.402) [-300.221] (-299.145) (-301.794) -- 0:00:45
273000 -- [-301.979] (-301.705) (-302.487) (-302.405) * (-300.109) (-305.884) [-299.824] (-299.827) -- 0:00:45
273500 -- [-298.706] (-302.183) (-299.056) (-301.068) * (-301.540) (-307.074) [-299.047] (-303.976) -- 0:00:45
274000 -- (-298.671) (-299.044) [-303.693] (-302.374) * (-300.781) (-298.880) [-302.623] (-298.857) -- 0:00:45
274500 -- (-300.690) [-300.981] (-300.513) (-301.494) * (-300.637) (-299.113) [-299.246] (-301.395) -- 0:00:44
275000 -- [-299.589] (-300.882) (-300.668) (-299.382) * (-303.987) (-298.976) [-299.496] (-300.098) -- 0:00:44
Average standard deviation of split frequencies: 0.012458
275500 -- [-301.194] (-299.273) (-299.659) (-298.656) * (-299.604) (-299.955) (-299.139) [-302.074] -- 0:00:44
276000 -- [-298.715] (-299.421) (-304.106) (-299.461) * [-300.712] (-304.903) (-299.962) (-299.802) -- 0:00:44
276500 -- [-299.472] (-300.112) (-299.689) (-300.629) * (-300.490) (-302.775) (-301.960) [-299.724] -- 0:00:44
277000 -- [-304.819] (-298.666) (-298.621) (-298.668) * [-301.276] (-302.867) (-299.833) (-299.969) -- 0:00:44
277500 -- (-301.539) [-301.166] (-300.946) (-300.333) * (-303.558) (-301.899) (-302.519) [-298.662] -- 0:00:44
278000 -- (-303.285) (-300.270) (-300.765) [-298.530] * [-299.889] (-303.095) (-304.750) (-300.128) -- 0:00:44
278500 -- (-299.052) [-298.536] (-302.306) (-300.159) * (-300.303) (-302.999) (-301.453) [-299.147] -- 0:00:44
279000 -- [-300.073] (-299.906) (-306.136) (-302.748) * [-299.758] (-300.956) (-300.372) (-302.390) -- 0:00:43
279500 -- (-299.631) [-299.939] (-301.031) (-300.323) * (-301.124) (-300.623) [-302.904] (-301.670) -- 0:00:43
280000 -- (-301.540) (-302.698) (-298.820) [-298.761] * (-298.667) (-302.113) [-300.068] (-300.463) -- 0:00:43
Average standard deviation of split frequencies: 0.012912
280500 -- (-307.141) (-301.554) [-300.640] (-299.515) * [-298.874] (-302.672) (-302.694) (-304.730) -- 0:00:43
281000 -- (-301.221) (-299.400) [-299.551] (-301.313) * (-299.898) (-299.207) [-299.626] (-305.895) -- 0:00:43
281500 -- (-301.770) [-299.870] (-301.298) (-302.105) * (-299.428) (-300.856) (-299.453) [-301.769] -- 0:00:43
282000 -- (-302.239) (-303.107) (-301.982) [-299.381] * (-301.288) (-303.316) (-300.076) [-301.364] -- 0:00:43
282500 -- [-301.651] (-299.224) (-300.174) (-300.943) * (-303.302) (-303.424) (-303.458) [-300.448] -- 0:00:43
283000 -- (-299.109) [-299.286] (-298.847) (-305.075) * [-302.821] (-300.609) (-299.809) (-301.894) -- 0:00:43
283500 -- (-302.719) (-301.463) (-301.781) [-299.696] * (-302.704) [-300.601] (-301.156) (-301.064) -- 0:00:42
284000 -- (-298.341) (-300.786) [-300.284] (-298.519) * (-301.939) [-299.480] (-303.127) (-301.224) -- 0:00:42
284500 -- (-300.456) (-299.285) (-299.180) [-300.212] * [-301.854] (-305.583) (-301.762) (-303.076) -- 0:00:42
285000 -- (-299.236) [-301.249] (-299.926) (-302.488) * (-300.988) [-302.190] (-300.423) (-300.553) -- 0:00:42
Average standard deviation of split frequencies: 0.011053
285500 -- (-302.787) (-301.716) (-302.232) [-302.279] * (-302.972) [-299.417] (-300.110) (-299.139) -- 0:00:42
286000 -- (-304.653) (-300.289) (-302.806) [-300.165] * [-302.265] (-299.273) (-302.476) (-300.517) -- 0:00:42
286500 -- [-299.119] (-300.840) (-300.557) (-300.417) * (-305.363) (-299.705) (-300.004) [-303.954] -- 0:00:42
287000 -- (-304.534) (-301.102) [-304.036] (-299.741) * (-299.464) (-300.125) [-299.965] (-299.480) -- 0:00:42
287500 -- (-304.472) (-299.243) (-305.276) [-300.876] * [-301.892] (-300.587) (-300.938) (-301.035) -- 0:00:42
288000 -- [-301.267] (-299.238) (-301.657) (-301.005) * (-299.325) (-304.352) (-299.829) [-301.098] -- 0:00:42
288500 -- (-301.182) [-298.888] (-303.188) (-301.529) * [-303.105] (-298.273) (-298.832) (-302.842) -- 0:00:41
289000 -- (-299.742) (-302.908) [-302.673] (-299.793) * (-301.326) (-299.620) (-299.398) [-300.528] -- 0:00:41
289500 -- (-300.753) [-300.976] (-301.715) (-303.068) * [-301.471] (-299.438) (-303.749) (-298.879) -- 0:00:44
290000 -- (-299.530) (-300.181) [-301.145] (-301.787) * (-302.323) (-305.082) (-300.884) [-301.590] -- 0:00:44
Average standard deviation of split frequencies: 0.010494
290500 -- (-299.248) (-301.884) (-300.933) [-300.888] * (-304.204) (-298.963) (-301.122) [-298.538] -- 0:00:43
291000 -- [-298.870] (-300.580) (-301.171) (-308.626) * (-300.583) (-300.495) (-299.629) [-299.067] -- 0:00:43
291500 -- (-300.559) (-301.733) [-299.011] (-303.535) * [-299.321] (-300.413) (-300.843) (-301.554) -- 0:00:43
292000 -- (-299.109) (-299.344) [-300.336] (-299.500) * [-298.979] (-299.394) (-300.657) (-299.743) -- 0:00:43
292500 -- (-301.278) (-304.199) [-298.930] (-299.205) * (-300.163) (-300.113) [-302.575] (-304.108) -- 0:00:43
293000 -- (-300.501) (-299.688) (-304.656) [-300.491] * (-300.177) (-304.180) (-300.361) [-299.491] -- 0:00:43
293500 -- (-299.552) (-299.443) [-301.361] (-299.813) * (-300.521) (-301.796) [-301.702] (-301.975) -- 0:00:43
294000 -- (-302.211) (-304.815) (-302.621) [-301.573] * (-301.133) (-300.342) [-303.449] (-301.662) -- 0:00:43
294500 -- (-304.045) (-298.383) [-303.001] (-299.850) * (-299.189) [-303.169] (-299.021) (-300.363) -- 0:00:43
295000 -- (-306.583) (-298.801) (-299.733) [-299.107] * (-299.627) [-301.255] (-301.556) (-303.803) -- 0:00:43
Average standard deviation of split frequencies: 0.009644
295500 -- [-301.869] (-299.589) (-299.816) (-299.043) * (-300.383) [-299.185] (-302.909) (-301.361) -- 0:00:42
296000 -- (-302.051) [-299.578] (-299.152) (-298.983) * (-299.245) (-302.796) (-306.053) [-301.841] -- 0:00:42
296500 -- (-302.340) (-300.967) [-302.714] (-300.214) * [-299.874] (-299.136) (-309.427) (-300.489) -- 0:00:42
297000 -- (-301.088) (-304.140) (-301.739) [-300.540] * [-300.091] (-301.184) (-303.456) (-299.557) -- 0:00:42
297500 -- [-305.035] (-302.780) (-299.187) (-298.524) * (-301.516) (-298.802) [-300.183] (-300.512) -- 0:00:42
298000 -- [-300.617] (-304.609) (-300.413) (-298.979) * (-299.407) (-299.004) [-302.977] (-304.165) -- 0:00:42
298500 -- (-303.309) (-302.580) [-304.668] (-298.640) * (-303.065) [-299.918] (-301.453) (-302.007) -- 0:00:42
299000 -- (-302.230) [-299.546] (-300.667) (-302.001) * (-298.654) [-301.447] (-299.080) (-300.220) -- 0:00:42
299500 -- (-299.508) [-300.775] (-300.677) (-302.578) * (-300.046) [-299.497] (-298.532) (-301.238) -- 0:00:42
300000 -- (-301.023) (-301.952) [-300.510] (-303.938) * [-299.283] (-299.492) (-299.336) (-301.355) -- 0:00:42
Average standard deviation of split frequencies: 0.009211
300500 -- (-299.269) (-298.555) [-301.378] (-302.505) * (-299.013) (-299.086) [-300.873] (-302.621) -- 0:00:41
301000 -- (-301.199) (-299.839) (-308.043) [-299.795] * [-301.905] (-299.461) (-298.900) (-300.885) -- 0:00:41
301500 -- [-308.161] (-298.460) (-299.943) (-300.798) * (-301.269) (-303.000) (-300.082) [-302.646] -- 0:00:41
302000 -- (-300.749) [-299.129] (-301.653) (-299.483) * (-300.417) (-302.080) (-300.863) [-298.108] -- 0:00:41
302500 -- (-309.153) (-298.884) (-302.634) [-300.754] * [-300.475] (-299.443) (-300.551) (-306.544) -- 0:00:41
303000 -- (-298.631) (-301.550) [-300.573] (-299.580) * (-304.385) (-298.524) (-299.877) [-298.705] -- 0:00:41
303500 -- (-299.839) (-304.358) (-300.765) [-304.039] * (-299.803) (-299.088) [-303.830] (-299.899) -- 0:00:41
304000 -- (-299.065) (-306.318) (-300.507) [-300.807] * (-300.709) [-303.411] (-300.257) (-300.291) -- 0:00:41
304500 -- (-300.432) (-299.600) [-300.275] (-299.212) * (-300.157) (-300.390) [-301.318] (-300.608) -- 0:00:41
305000 -- (-299.238) [-300.256] (-300.023) (-301.042) * [-300.542] (-301.115) (-299.125) (-302.175) -- 0:00:41
Average standard deviation of split frequencies: 0.008518
305500 -- (-298.693) [-300.647] (-299.553) (-299.961) * [-298.501] (-299.843) (-301.646) (-301.478) -- 0:00:40
306000 -- (-299.321) (-302.016) [-300.023] (-299.349) * (-299.434) [-303.209] (-300.787) (-302.759) -- 0:00:40
306500 -- (-300.692) [-301.167] (-303.800) (-299.487) * (-300.223) [-302.751] (-298.469) (-301.000) -- 0:00:42
307000 -- (-301.217) [-304.794] (-299.576) (-301.729) * (-300.332) [-301.282] (-300.046) (-302.154) -- 0:00:42
307500 -- (-304.886) (-300.588) [-304.465] (-300.367) * (-301.910) (-300.953) [-303.366] (-301.687) -- 0:00:42
308000 -- [-303.353] (-300.958) (-300.500) (-304.350) * [-306.078] (-298.544) (-300.902) (-299.044) -- 0:00:42
308500 -- (-298.260) (-301.857) (-299.617) [-300.324] * (-300.947) [-300.561] (-301.834) (-298.997) -- 0:00:42
309000 -- (-299.762) (-301.396) [-299.423] (-301.664) * (-298.564) [-299.209] (-301.187) (-302.787) -- 0:00:42
309500 -- (-298.841) (-301.138) (-301.108) [-300.037] * (-302.590) (-300.773) (-298.662) [-299.295] -- 0:00:42
310000 -- (-299.273) (-299.232) [-299.065] (-300.971) * (-300.327) (-301.254) (-303.073) [-299.999] -- 0:00:42
Average standard deviation of split frequencies: 0.008301
310500 -- (-298.453) (-299.515) [-300.051] (-301.581) * (-300.659) (-302.221) (-299.539) [-298.627] -- 0:00:42
311000 -- [-299.810] (-304.521) (-299.613) (-301.063) * (-299.099) (-298.973) [-299.336] (-299.369) -- 0:00:42
311500 -- (-300.248) (-308.599) (-301.918) [-299.384] * [-303.445] (-304.216) (-302.214) (-301.296) -- 0:00:41
312000 -- (-301.104) [-303.109] (-303.124) (-302.641) * (-300.487) (-301.026) (-300.075) [-300.803] -- 0:00:41
312500 -- [-299.268] (-299.543) (-300.270) (-305.277) * (-300.769) (-300.915) (-299.532) [-300.016] -- 0:00:41
313000 -- (-300.391) (-299.432) [-303.729] (-303.750) * (-299.967) [-302.783] (-301.182) (-300.258) -- 0:00:41
313500 -- (-299.931) (-299.867) (-300.372) [-299.845] * (-299.890) [-306.415] (-302.663) (-299.403) -- 0:00:41
314000 -- (-301.977) (-298.979) [-299.909] (-300.856) * (-298.419) (-304.053) [-301.213] (-300.148) -- 0:00:41
314500 -- (-304.833) [-299.837] (-300.232) (-299.272) * (-300.328) (-299.784) (-302.493) [-298.325] -- 0:00:41
315000 -- [-302.543] (-299.714) (-303.337) (-301.123) * [-299.757] (-298.611) (-302.605) (-301.205) -- 0:00:41
Average standard deviation of split frequencies: 0.008453
315500 -- [-300.371] (-300.866) (-301.987) (-299.053) * (-308.397) (-299.000) (-300.891) [-299.652] -- 0:00:41
316000 -- (-302.590) (-298.501) (-301.667) [-300.113] * [-302.999] (-299.549) (-304.501) (-302.079) -- 0:00:41
316500 -- (-300.700) (-299.052) (-299.963) [-299.168] * [-298.933] (-302.142) (-299.019) (-299.530) -- 0:00:41
317000 -- (-299.144) (-299.071) (-304.222) [-304.284] * (-299.931) [-300.904] (-301.517) (-301.591) -- 0:00:40
317500 -- (-298.448) (-303.631) [-300.771] (-302.673) * [-299.325] (-299.506) (-300.444) (-303.478) -- 0:00:40
318000 -- [-298.233] (-301.040) (-299.714) (-301.893) * [-299.398] (-299.806) (-299.936) (-300.117) -- 0:00:40
318500 -- (-299.631) (-299.907) (-298.520) [-299.522] * (-299.104) [-298.790] (-300.236) (-298.790) -- 0:00:40
319000 -- (-300.713) (-298.792) [-298.199] (-305.972) * (-300.983) [-299.760] (-304.327) (-302.327) -- 0:00:40
319500 -- (-301.538) (-302.361) [-299.249] (-298.234) * (-302.122) [-298.849] (-300.041) (-300.817) -- 0:00:40
320000 -- (-299.576) [-299.435] (-300.206) (-300.830) * [-302.242] (-300.609) (-303.899) (-302.295) -- 0:00:40
Average standard deviation of split frequencies: 0.008453
320500 -- (-299.697) [-298.719] (-300.644) (-299.140) * (-300.578) (-300.631) [-298.597] (-299.937) -- 0:00:40
321000 -- (-300.054) (-299.531) [-299.985] (-300.119) * (-301.120) [-305.467] (-299.915) (-301.452) -- 0:00:40
321500 -- (-300.168) (-300.368) [-299.791] (-301.081) * (-304.914) (-300.318) [-298.259] (-301.975) -- 0:00:40
322000 -- (-306.420) (-300.620) [-300.175] (-299.693) * (-299.516) (-299.719) [-298.627] (-299.901) -- 0:00:40
322500 -- (-300.888) [-299.278] (-299.762) (-299.697) * [-298.954] (-300.595) (-300.467) (-298.741) -- 0:00:39
323000 -- [-303.311] (-299.504) (-300.892) (-304.432) * (-300.033) (-300.014) [-300.059] (-299.978) -- 0:00:39
323500 -- (-300.853) [-299.954] (-300.940) (-300.328) * (-304.920) [-299.701] (-300.185) (-301.369) -- 0:00:39
324000 -- [-298.931] (-299.603) (-299.773) (-303.090) * [-300.446] (-302.487) (-302.160) (-303.380) -- 0:00:41
324500 -- (-299.431) (-301.869) (-301.325) [-299.317] * (-300.625) (-301.307) [-299.818] (-306.275) -- 0:00:41
325000 -- (-300.497) [-300.578] (-298.192) (-302.587) * (-304.093) (-299.852) (-300.125) [-303.153] -- 0:00:41
Average standard deviation of split frequencies: 0.010377
325500 -- (-300.425) [-301.506] (-300.829) (-305.667) * (-299.139) [-299.166] (-301.159) (-304.001) -- 0:00:41
326000 -- (-301.940) [-298.808] (-300.332) (-302.147) * [-302.230] (-299.778) (-303.108) (-299.707) -- 0:00:41
326500 -- (-300.449) (-302.938) (-299.748) [-303.205] * [-299.389] (-302.936) (-301.422) (-299.921) -- 0:00:41
327000 -- (-301.435) (-300.598) [-300.329] (-298.534) * [-298.669] (-300.286) (-302.060) (-300.341) -- 0:00:41
327500 -- (-299.639) (-300.211) (-302.538) [-303.671] * [-299.462] (-298.898) (-302.698) (-300.713) -- 0:00:41
328000 -- (-301.216) (-299.228) [-299.838] (-299.907) * (-301.506) (-299.819) (-301.930) [-300.956] -- 0:00:40
328500 -- (-300.872) (-299.588) [-299.553] (-298.575) * (-301.070) (-300.649) (-298.310) [-301.968] -- 0:00:40
329000 -- (-303.093) (-299.108) (-300.811) [-304.628] * (-298.945) [-301.172] (-299.313) (-303.930) -- 0:00:40
329500 -- (-310.148) [-299.832] (-300.315) (-302.721) * (-299.432) (-302.387) [-299.485] (-301.626) -- 0:00:40
330000 -- (-303.252) (-300.483) (-299.001) [-301.710] * (-299.713) (-303.737) [-300.527] (-299.548) -- 0:00:40
Average standard deviation of split frequencies: 0.010247
330500 -- [-301.616] (-303.418) (-298.453) (-301.374) * [-299.703] (-299.509) (-301.393) (-300.304) -- 0:00:40
331000 -- (-300.388) (-302.092) [-298.730] (-299.103) * (-299.897) (-298.620) (-301.393) [-304.956] -- 0:00:40
331500 -- (-299.771) (-300.321) [-302.528] (-298.873) * (-298.966) [-301.970] (-299.552) (-303.843) -- 0:00:40
332000 -- (-300.361) (-300.880) (-301.018) [-300.320] * (-299.625) (-301.201) (-299.721) [-300.564] -- 0:00:40
332500 -- (-301.177) (-304.791) [-300.374] (-301.845) * [-298.733] (-299.560) (-300.039) (-303.448) -- 0:00:40
333000 -- (-305.091) (-300.363) [-300.583] (-299.655) * (-302.204) (-300.487) (-300.398) [-299.794] -- 0:00:40
333500 -- [-301.628] (-301.283) (-302.351) (-298.477) * [-299.815] (-298.671) (-305.544) (-298.671) -- 0:00:39
334000 -- (-299.993) (-301.757) (-299.018) [-300.971] * (-305.745) (-300.780) (-305.027) [-298.868] -- 0:00:39
334500 -- (-299.680) [-299.884] (-300.016) (-299.911) * (-303.784) [-299.899] (-301.353) (-298.600) -- 0:00:39
335000 -- [-299.764] (-299.167) (-304.418) (-300.800) * (-302.970) (-300.919) [-299.595] (-298.754) -- 0:00:39
Average standard deviation of split frequencies: 0.010522
335500 -- (-301.813) (-300.673) (-302.113) [-298.868] * [-305.177] (-303.074) (-302.180) (-298.338) -- 0:00:39
336000 -- (-298.327) (-302.867) (-308.531) [-300.790] * (-304.316) (-302.854) (-298.818) [-299.454] -- 0:00:39
336500 -- [-299.252] (-303.352) (-303.928) (-300.475) * [-301.862] (-303.622) (-300.231) (-299.607) -- 0:00:39
337000 -- (-300.108) (-299.529) [-298.892] (-301.257) * (-300.431) (-299.323) [-299.388] (-299.796) -- 0:00:39
337500 -- (-300.388) (-299.448) (-299.681) [-300.693] * (-301.843) [-301.441] (-299.288) (-298.739) -- 0:00:39
338000 -- (-305.284) [-299.569] (-300.893) (-300.133) * (-304.579) (-300.824) (-300.611) [-300.103] -- 0:00:39
338500 -- (-299.985) (-299.642) (-307.051) [-300.811] * [-300.359] (-303.087) (-300.821) (-299.228) -- 0:00:39
339000 -- [-299.962] (-301.760) (-309.454) (-300.694) * (-299.523) (-301.830) (-298.771) [-302.864] -- 0:00:38
339500 -- (-303.110) (-300.696) (-304.875) [-300.280] * (-299.557) (-301.839) (-300.719) [-299.420] -- 0:00:38
340000 -- (-301.393) (-301.485) (-302.489) [-299.834] * (-299.258) (-298.953) [-299.173] (-302.005) -- 0:00:38
Average standard deviation of split frequencies: 0.010500
340500 -- (-302.167) [-300.069] (-299.036) (-299.790) * (-300.711) (-298.756) [-299.055] (-300.742) -- 0:00:38
341000 -- (-298.644) (-298.434) [-298.548] (-299.320) * (-298.764) (-299.171) (-299.903) [-300.095] -- 0:00:40
341500 -- [-299.348] (-300.588) (-300.504) (-301.624) * (-298.927) (-299.603) [-299.529] (-305.318) -- 0:00:40
342000 -- [-298.990] (-301.505) (-300.564) (-303.723) * (-300.807) [-299.301] (-301.576) (-304.106) -- 0:00:40
342500 -- [-301.041] (-299.685) (-300.591) (-305.215) * (-301.552) (-300.506) (-301.663) [-302.710] -- 0:00:40
343000 -- (-299.455) (-298.879) [-301.633] (-301.470) * (-301.337) (-300.484) (-299.873) [-298.559] -- 0:00:40
343500 -- (-299.620) (-302.014) [-300.761] (-301.637) * (-302.443) [-299.845] (-300.479) (-300.507) -- 0:00:40
344000 -- (-298.430) [-300.843] (-304.419) (-300.455) * [-299.292] (-300.807) (-302.763) (-302.196) -- 0:00:40
344500 -- [-300.238] (-301.264) (-300.049) (-298.711) * (-301.004) (-302.893) (-300.699) [-304.205] -- 0:00:39
345000 -- (-302.052) [-298.815] (-299.090) (-299.161) * (-298.996) (-305.459) (-302.918) [-305.396] -- 0:00:39
Average standard deviation of split frequencies: 0.009007
345500 -- (-300.488) [-299.269] (-299.933) (-301.077) * [-298.280] (-298.804) (-301.727) (-300.565) -- 0:00:39
346000 -- [-301.243] (-303.185) (-299.391) (-299.973) * (-299.125) (-306.418) [-301.182] (-298.822) -- 0:00:39
346500 -- [-301.945] (-302.454) (-298.594) (-300.308) * [-299.441] (-299.838) (-301.685) (-303.476) -- 0:00:39
347000 -- [-301.674] (-300.351) (-298.538) (-298.170) * (-299.199) (-300.274) [-300.618] (-301.131) -- 0:00:39
347500 -- [-300.914] (-301.791) (-300.930) (-301.666) * [-298.984] (-300.038) (-302.946) (-298.923) -- 0:00:39
348000 -- [-300.738] (-300.826) (-299.007) (-301.086) * [-299.823] (-301.438) (-299.985) (-299.778) -- 0:00:39
348500 -- (-298.772) (-300.112) (-299.048) [-299.055] * [-301.123] (-300.088) (-298.977) (-302.692) -- 0:00:39
349000 -- [-303.223] (-301.672) (-300.936) (-299.519) * (-298.673) (-303.272) [-299.738] (-299.355) -- 0:00:39
349500 -- (-301.674) (-302.426) [-302.239] (-299.326) * (-300.038) [-299.792] (-298.462) (-299.564) -- 0:00:39
350000 -- (-305.207) [-301.346] (-302.524) (-301.226) * [-303.006] (-300.957) (-299.334) (-301.732) -- 0:00:39
Average standard deviation of split frequencies: 0.008619
350500 -- [-302.842] (-304.285) (-298.618) (-298.919) * [-298.970] (-302.737) (-301.225) (-302.423) -- 0:00:38
351000 -- (-301.534) (-299.766) [-299.425] (-299.476) * (-299.477) (-304.756) (-306.937) [-298.754] -- 0:00:38
351500 -- [-300.638] (-303.114) (-300.289) (-299.184) * (-299.011) (-304.923) [-306.115] (-299.588) -- 0:00:38
352000 -- (-303.946) (-302.408) (-300.764) [-299.904] * [-304.113] (-303.018) (-299.313) (-299.917) -- 0:00:38
352500 -- [-305.962] (-302.334) (-300.796) (-301.517) * (-299.692) (-299.017) (-300.473) [-298.939] -- 0:00:38
353000 -- (-303.005) (-301.151) [-301.380] (-302.766) * (-304.636) (-301.065) (-300.468) [-301.286] -- 0:00:38
353500 -- (-302.401) (-299.461) (-299.020) [-302.443] * [-301.853] (-299.584) (-299.402) (-302.147) -- 0:00:38
354000 -- (-303.541) (-301.365) [-299.945] (-299.679) * (-300.560) (-299.588) (-299.948) [-304.653] -- 0:00:38
354500 -- (-302.763) (-301.195) [-300.616] (-303.102) * (-303.320) (-302.331) (-298.885) [-302.054] -- 0:00:38
355000 -- (-301.233) [-303.185] (-299.658) (-302.680) * (-305.624) [-300.982] (-299.287) (-298.899) -- 0:00:38
Average standard deviation of split frequencies: 0.007867
355500 -- (-305.147) [-304.442] (-306.406) (-298.788) * (-305.832) (-299.765) [-301.727] (-298.777) -- 0:00:38
356000 -- (-304.810) (-304.269) (-299.603) [-298.761] * (-302.724) (-301.255) [-299.003] (-300.200) -- 0:00:37
356500 -- (-298.939) [-300.170] (-299.659) (-299.844) * (-300.839) [-302.458] (-301.787) (-298.924) -- 0:00:37
357000 -- (-303.430) (-305.733) [-300.256] (-299.264) * (-299.911) (-299.032) (-300.942) [-299.107] -- 0:00:37
357500 -- (-300.677) (-301.059) [-299.406] (-304.697) * (-304.953) (-303.284) (-301.430) [-301.556] -- 0:00:37
358000 -- (-301.943) (-298.715) [-304.881] (-301.660) * (-299.680) [-302.732] (-298.920) (-299.888) -- 0:00:39
358500 -- (-299.775) [-299.503] (-300.301) (-301.702) * (-301.426) (-301.269) (-300.336) [-302.649] -- 0:00:39
359000 -- (-303.199) (-299.159) (-301.964) [-298.259] * (-301.427) (-301.489) (-299.895) [-302.844] -- 0:00:39
359500 -- (-299.420) (-300.309) (-298.961) [-298.415] * [-300.860] (-300.913) (-302.255) (-301.740) -- 0:00:39
360000 -- (-300.936) [-299.170] (-300.679) (-299.357) * (-301.134) (-300.776) (-300.618) [-302.690] -- 0:00:39
Average standard deviation of split frequencies: 0.007612
360500 -- (-299.390) [-300.953] (-301.762) (-303.931) * (-301.971) [-298.888] (-302.429) (-302.687) -- 0:00:39
361000 -- (-298.757) (-302.301) (-300.837) [-298.595] * (-301.832) [-298.582] (-300.158) (-301.640) -- 0:00:38
361500 -- (-303.401) (-298.571) [-299.285] (-298.789) * [-299.366] (-300.763) (-303.424) (-301.328) -- 0:00:38
362000 -- (-300.474) (-302.874) (-299.207) [-298.260] * (-299.948) (-299.458) [-304.367] (-298.904) -- 0:00:38
362500 -- (-302.570) (-299.304) [-299.204] (-300.032) * [-299.538] (-300.027) (-305.048) (-301.129) -- 0:00:38
363000 -- (-300.856) [-300.539] (-301.930) (-301.275) * (-299.270) (-298.876) [-301.787] (-299.400) -- 0:00:38
363500 -- [-299.355] (-302.385) (-304.708) (-300.454) * (-300.999) (-301.309) [-300.767] (-301.796) -- 0:00:38
364000 -- (-301.067) (-301.043) [-302.412] (-298.431) * [-304.115] (-300.641) (-300.007) (-300.275) -- 0:00:38
364500 -- (-300.094) (-301.380) (-298.886) [-299.150] * (-302.816) (-298.758) [-301.778] (-301.397) -- 0:00:38
365000 -- (-299.555) (-300.821) [-300.358] (-302.142) * [-299.395] (-299.039) (-300.008) (-300.187) -- 0:00:38
Average standard deviation of split frequencies: 0.007442
365500 -- (-298.833) (-303.762) [-302.426] (-302.135) * [-300.155] (-298.869) (-301.852) (-302.803) -- 0:00:38
366000 -- [-303.112] (-306.653) (-299.009) (-300.874) * [-299.081] (-301.459) (-302.658) (-299.779) -- 0:00:38
366500 -- (-303.860) (-300.442) [-300.761] (-300.054) * (-300.317) [-301.255] (-301.416) (-301.940) -- 0:00:38
367000 -- (-302.314) (-299.648) [-300.344] (-299.451) * (-301.317) (-301.910) (-302.246) [-299.526] -- 0:00:37
367500 -- (-300.579) (-299.833) [-300.081] (-301.256) * (-300.327) (-299.235) (-301.753) [-300.552] -- 0:00:37
368000 -- (-299.444) [-300.281] (-299.288) (-302.722) * (-299.121) (-299.115) [-298.627] (-299.052) -- 0:00:37
368500 -- (-303.852) (-299.303) [-303.238] (-304.222) * (-298.966) [-301.204] (-300.149) (-298.854) -- 0:00:37
369000 -- (-303.308) (-301.881) [-303.652] (-302.775) * (-298.966) (-304.414) [-304.528] (-299.189) -- 0:00:37
369500 -- [-300.805] (-303.923) (-301.915) (-300.339) * (-299.418) (-298.838) (-304.729) [-299.259] -- 0:00:37
370000 -- [-302.655] (-299.724) (-304.282) (-301.609) * (-299.400) [-299.318] (-300.716) (-302.902) -- 0:00:37
Average standard deviation of split frequencies: 0.007631
370500 -- [-299.902] (-299.088) (-300.108) (-300.687) * [-298.945] (-299.847) (-298.519) (-301.045) -- 0:00:37
371000 -- (-300.163) (-300.583) (-304.188) [-300.391] * (-303.534) [-299.327] (-300.587) (-300.379) -- 0:00:37
371500 -- [-299.718] (-298.498) (-302.227) (-299.815) * [-300.989] (-298.818) (-301.055) (-300.104) -- 0:00:37
372000 -- [-299.509] (-298.969) (-300.007) (-298.863) * (-300.383) [-300.005] (-299.303) (-301.091) -- 0:00:37
372500 -- [-300.905] (-300.419) (-299.644) (-298.982) * (-299.510) (-299.865) (-299.908) [-302.033] -- 0:00:37
373000 -- (-298.775) (-301.954) [-299.048] (-298.289) * [-302.376] (-301.281) (-300.201) (-301.083) -- 0:00:36
373500 -- (-302.591) (-301.753) [-298.782] (-298.934) * (-301.362) [-301.584] (-303.494) (-300.595) -- 0:00:36
374000 -- (-299.885) (-300.739) (-301.158) [-303.358] * (-300.599) (-300.073) [-299.713] (-299.658) -- 0:00:36
374500 -- (-301.299) (-298.364) [-300.332] (-304.992) * [-299.305] (-300.012) (-299.181) (-308.594) -- 0:00:36
375000 -- (-298.978) (-298.818) (-300.649) [-301.363] * (-304.554) (-302.224) [-298.632] (-300.388) -- 0:00:36
Average standard deviation of split frequencies: 0.007227
375500 -- (-302.600) (-300.988) [-299.984] (-301.356) * [-302.435] (-301.960) (-298.674) (-302.083) -- 0:00:38
376000 -- (-302.376) (-300.140) [-301.253] (-302.152) * (-299.819) (-298.477) (-301.106) [-299.037] -- 0:00:38
376500 -- (-302.926) [-300.006] (-302.219) (-302.398) * (-301.567) (-301.993) (-302.516) [-300.512] -- 0:00:38
377000 -- (-299.206) (-299.734) (-302.678) [-304.657] * [-298.811] (-299.382) (-309.888) (-299.956) -- 0:00:38
377500 -- (-298.310) [-303.444] (-301.336) (-300.074) * (-299.432) [-299.569] (-301.498) (-302.041) -- 0:00:37
378000 -- (-303.726) (-302.336) [-299.486] (-298.852) * (-301.682) [-298.847] (-301.504) (-303.476) -- 0:00:37
378500 -- (-304.013) (-301.042) [-301.393] (-302.109) * [-300.210] (-298.869) (-302.150) (-302.556) -- 0:00:37
379000 -- (-300.338) [-300.784] (-302.645) (-298.597) * (-299.550) (-300.665) [-301.114] (-298.693) -- 0:00:37
379500 -- (-303.648) (-304.759) [-300.756] (-299.489) * [-300.925] (-301.071) (-299.322) (-301.705) -- 0:00:37
380000 -- (-301.144) (-303.287) (-299.780) [-299.440] * [-300.664] (-302.153) (-302.136) (-299.060) -- 0:00:37
Average standard deviation of split frequencies: 0.006629
380500 -- (-298.893) (-300.029) [-300.453] (-303.344) * [-301.074] (-298.714) (-301.623) (-303.331) -- 0:00:37
381000 -- [-298.451] (-298.666) (-300.210) (-301.164) * [-301.661] (-301.743) (-303.071) (-301.230) -- 0:00:37
381500 -- (-299.990) (-302.840) [-299.888] (-299.997) * (-305.407) (-300.620) (-302.461) [-298.567] -- 0:00:37
382000 -- (-299.762) (-306.959) [-300.293] (-302.739) * (-300.926) [-300.643] (-302.802) (-300.498) -- 0:00:37
382500 -- [-300.149] (-311.741) (-301.499) (-300.307) * (-302.775) [-300.197] (-299.531) (-299.363) -- 0:00:37
383000 -- (-300.024) [-305.085] (-299.868) (-299.439) * (-303.198) (-298.822) [-299.580] (-299.085) -- 0:00:37
383500 -- [-300.015] (-301.707) (-302.339) (-302.501) * [-307.051] (-298.330) (-298.638) (-302.566) -- 0:00:36
384000 -- (-300.646) (-302.035) (-301.469) [-300.611] * [-302.936] (-299.937) (-300.219) (-300.940) -- 0:00:36
384500 -- [-299.614] (-302.996) (-298.475) (-299.715) * (-300.844) (-298.592) (-301.384) [-300.606] -- 0:00:36
385000 -- (-299.502) (-300.353) (-300.620) [-300.694] * (-303.481) (-302.375) (-298.583) [-302.445] -- 0:00:36
Average standard deviation of split frequencies: 0.006537
385500 -- [-298.692] (-299.693) (-302.360) (-305.065) * (-305.141) (-302.325) [-299.205] (-300.972) -- 0:00:36
386000 -- [-299.272] (-300.444) (-299.535) (-304.385) * (-299.779) [-299.788] (-301.824) (-301.221) -- 0:00:36
386500 -- (-299.727) [-301.859] (-300.985) (-305.983) * (-301.559) (-299.552) (-300.588) [-300.153] -- 0:00:36
387000 -- [-301.750] (-298.092) (-300.656) (-305.234) * [-300.630] (-302.269) (-303.451) (-305.680) -- 0:00:36
387500 -- (-301.596) [-298.571] (-300.440) (-300.663) * (-300.914) [-299.345] (-300.837) (-303.284) -- 0:00:36
388000 -- (-299.817) (-301.238) [-304.390] (-299.300) * (-298.634) (-300.484) [-301.487] (-301.499) -- 0:00:36
388500 -- (-300.955) [-304.265] (-300.383) (-303.315) * [-298.417] (-299.401) (-299.288) (-304.123) -- 0:00:36
389000 -- (-299.901) (-298.537) [-298.962] (-301.795) * [-303.988] (-299.738) (-299.805) (-301.005) -- 0:00:36
389500 -- (-299.414) (-299.766) [-301.523] (-301.189) * [-305.957] (-298.759) (-302.586) (-301.303) -- 0:00:36
390000 -- (-299.564) (-300.666) [-300.368] (-305.263) * (-302.954) (-302.852) [-300.299] (-299.936) -- 0:00:35
Average standard deviation of split frequencies: 0.006459
390500 -- (-299.596) (-299.743) [-301.411] (-299.462) * (-304.181) [-302.615] (-301.346) (-300.022) -- 0:00:35
391000 -- (-300.257) [-302.351] (-299.282) (-298.900) * (-301.525) [-302.860] (-301.524) (-300.243) -- 0:00:35
391500 -- (-298.721) (-303.815) [-299.008] (-299.848) * [-302.550] (-300.689) (-300.223) (-300.475) -- 0:00:35
392000 -- (-298.859) (-298.430) [-299.496] (-299.109) * [-303.397] (-300.330) (-300.608) (-300.551) -- 0:00:35
392500 -- [-301.220] (-301.923) (-301.807) (-301.150) * (-299.800) (-298.425) [-301.582] (-301.039) -- 0:00:37
393000 -- (-299.890) [-299.426] (-299.703) (-302.842) * [-298.685] (-299.401) (-300.786) (-302.773) -- 0:00:37
393500 -- (-301.259) [-299.463] (-300.574) (-298.297) * (-305.972) (-299.626) (-301.596) [-309.245] -- 0:00:36
394000 -- (-299.200) (-300.534) (-301.648) [-300.946] * (-305.219) (-306.689) [-299.073] (-302.890) -- 0:00:36
394500 -- (-298.277) (-301.909) [-298.651] (-301.882) * (-300.622) (-304.221) [-299.357] (-301.300) -- 0:00:36
395000 -- (-300.402) [-303.792] (-301.080) (-300.291) * [-301.418] (-300.752) (-299.434) (-300.079) -- 0:00:36
Average standard deviation of split frequencies: 0.007002
395500 -- (-300.052) (-305.346) (-300.312) [-300.690] * (-302.652) (-302.305) (-302.904) [-300.354] -- 0:00:36
396000 -- (-300.112) (-298.745) (-298.602) [-299.876] * [-299.274] (-298.938) (-301.808) (-301.147) -- 0:00:36
396500 -- (-300.770) [-300.422] (-301.124) (-299.583) * (-301.054) (-300.375) (-301.264) [-299.526] -- 0:00:36
397000 -- (-301.744) [-300.297] (-299.297) (-301.346) * (-301.048) (-305.896) (-303.501) [-300.260] -- 0:00:36
397500 -- (-302.004) (-302.078) [-301.448] (-299.088) * (-301.032) (-301.086) [-299.868] (-302.579) -- 0:00:36
398000 -- (-301.368) (-299.692) (-305.728) [-300.914] * (-301.369) (-299.692) [-298.434] (-302.665) -- 0:00:36
398500 -- (-301.636) [-301.792] (-300.991) (-300.907) * (-298.975) (-301.197) [-302.076] (-301.246) -- 0:00:36
399000 -- (-300.922) (-300.445) [-300.530] (-300.934) * (-302.183) (-301.834) (-300.056) [-300.152] -- 0:00:36
399500 -- (-302.643) [-300.039] (-301.088) (-303.087) * (-299.532) (-300.086) (-301.492) [-300.432] -- 0:00:36
400000 -- (-299.391) (-298.789) (-298.724) [-300.991] * [-300.885] (-299.134) (-304.781) (-300.466) -- 0:00:36
Average standard deviation of split frequencies: 0.006921
400500 -- (-298.446) (-299.860) [-298.523] (-301.753) * (-306.814) (-301.087) (-302.193) [-300.688] -- 0:00:35
401000 -- [-299.920] (-303.677) (-298.470) (-300.598) * [-303.693] (-300.092) (-302.233) (-299.300) -- 0:00:35
401500 -- (-301.536) [-304.956] (-299.310) (-299.537) * [-301.378] (-298.973) (-301.454) (-298.743) -- 0:00:35
402000 -- (-298.692) (-301.262) (-298.787) [-299.545] * (-299.938) (-300.118) (-299.655) [-300.525] -- 0:00:35
402500 -- (-300.299) [-298.777] (-300.251) (-300.814) * (-305.833) (-299.902) (-300.121) [-300.793] -- 0:00:35
403000 -- (-299.451) [-298.993] (-299.977) (-300.450) * (-299.109) (-301.763) [-301.673] (-298.849) -- 0:00:35
403500 -- (-301.127) (-300.382) [-300.692] (-303.195) * (-305.955) (-301.579) [-298.359] (-301.196) -- 0:00:35
404000 -- (-301.502) (-300.285) [-299.959] (-301.253) * [-298.408] (-303.642) (-301.707) (-299.534) -- 0:00:35
404500 -- (-301.821) [-298.479] (-300.869) (-304.913) * [-299.857] (-299.030) (-299.736) (-302.903) -- 0:00:35
405000 -- (-301.048) (-298.884) (-301.131) [-298.986] * (-301.844) (-300.639) [-300.947] (-299.480) -- 0:00:35
Average standard deviation of split frequencies: 0.007240
405500 -- (-298.170) (-299.223) (-299.426) [-298.543] * (-299.547) (-298.670) (-300.786) [-302.560] -- 0:00:35
406000 -- (-302.572) [-300.070] (-299.086) (-299.865) * (-307.107) (-301.717) [-302.663] (-300.022) -- 0:00:35
406500 -- (-301.265) (-301.348) (-301.104) [-300.714] * (-301.266) [-300.492] (-301.848) (-300.452) -- 0:00:35
407000 -- (-301.199) (-301.540) [-303.402] (-302.722) * (-299.117) [-298.811] (-300.802) (-299.651) -- 0:00:36
407500 -- [-300.962] (-299.901) (-299.958) (-302.359) * [-299.271] (-306.215) (-301.293) (-307.613) -- 0:00:36
408000 -- (-299.380) [-299.168] (-300.655) (-298.105) * (-302.987) [-300.205] (-299.701) (-299.921) -- 0:00:36
408500 -- (-300.061) (-302.444) (-301.782) [-301.610] * (-304.128) (-299.328) (-299.909) [-300.264] -- 0:00:36
409000 -- [-299.977] (-301.002) (-300.450) (-303.834) * (-306.093) [-301.728] (-298.634) (-298.956) -- 0:00:36
409500 -- (-300.016) [-301.403] (-301.296) (-302.850) * (-306.458) (-301.005) [-299.311] (-303.990) -- 0:00:36
410000 -- (-300.149) (-298.438) (-300.493) [-301.581] * [-301.143] (-300.551) (-300.429) (-300.597) -- 0:00:35
Average standard deviation of split frequencies: 0.006415
410500 -- (-305.259) (-299.426) [-301.586] (-299.641) * (-299.709) (-300.544) [-302.017] (-300.831) -- 0:00:35
411000 -- [-305.394] (-303.033) (-299.526) (-299.083) * (-300.633) (-299.359) (-302.027) [-301.388] -- 0:00:35
411500 -- (-301.964) (-299.827) (-300.578) [-299.101] * (-299.997) [-302.132] (-299.632) (-300.891) -- 0:00:35
412000 -- (-300.692) (-301.058) [-300.134] (-299.389) * [-301.831] (-298.574) (-300.868) (-299.146) -- 0:00:35
412500 -- (-298.911) [-299.744] (-305.762) (-299.133) * (-302.459) [-298.971] (-303.380) (-301.242) -- 0:00:35
413000 -- [-300.054] (-301.139) (-300.380) (-304.932) * (-303.958) [-301.049] (-301.279) (-301.113) -- 0:00:35
413500 -- (-300.554) [-298.812] (-298.726) (-299.600) * (-299.409) [-301.003] (-304.246) (-301.543) -- 0:00:35
414000 -- (-300.695) [-298.626] (-301.875) (-301.544) * [-299.324] (-300.254) (-303.155) (-299.799) -- 0:00:35
414500 -- (-299.268) [-298.665] (-300.214) (-303.152) * (-299.149) (-299.873) (-300.591) [-299.778] -- 0:00:35
415000 -- (-299.801) (-299.136) (-299.526) [-302.836] * (-298.816) (-301.707) (-299.989) [-298.684] -- 0:00:35
Average standard deviation of split frequencies: 0.006732
415500 -- (-303.504) (-300.029) (-301.395) [-299.697] * (-299.632) [-299.220] (-299.716) (-299.220) -- 0:00:35
416000 -- [-299.951] (-300.538) (-300.844) (-299.836) * (-305.930) (-298.944) [-298.740] (-301.030) -- 0:00:35
416500 -- (-301.384) [-302.693] (-301.829) (-301.045) * (-304.968) [-300.566] (-300.024) (-300.309) -- 0:00:35
417000 -- [-299.321] (-304.102) (-298.801) (-300.907) * [-301.047] (-298.768) (-301.367) (-299.924) -- 0:00:34
417500 -- (-304.488) (-301.005) (-300.814) [-301.849] * (-298.896) (-300.512) [-298.842] (-300.600) -- 0:00:34
418000 -- [-299.099] (-300.325) (-301.330) (-299.515) * (-299.267) (-303.506) [-300.331] (-300.007) -- 0:00:34
418500 -- (-301.945) [-300.357] (-298.462) (-301.113) * [-301.461] (-299.152) (-303.133) (-300.344) -- 0:00:34
419000 -- (-301.033) (-299.492) [-299.658] (-298.130) * (-299.363) (-299.898) (-299.768) [-300.414] -- 0:00:34
419500 -- (-301.770) (-301.677) (-302.855) [-300.784] * (-298.695) (-300.070) (-301.118) [-304.957] -- 0:00:34
420000 -- (-301.829) (-302.914) [-300.900] (-301.494) * [-299.355] (-301.359) (-299.685) (-299.166) -- 0:00:34
Average standard deviation of split frequencies: 0.007317
420500 -- (-301.445) (-299.349) [-298.430] (-301.904) * [-300.087] (-301.457) (-298.857) (-301.119) -- 0:00:34
421000 -- (-299.912) [-299.221] (-299.577) (-299.913) * [-302.177] (-306.235) (-299.351) (-298.322) -- 0:00:34
421500 -- (-299.498) (-301.668) [-299.190] (-302.513) * (-299.818) (-302.538) [-299.861] (-298.702) -- 0:00:35
422000 -- (-304.473) (-302.394) [-299.613] (-301.263) * [-300.690] (-306.279) (-301.145) (-298.968) -- 0:00:35
422500 -- (-301.193) (-300.695) (-299.484) [-299.419] * (-299.274) (-302.348) (-300.034) [-299.414] -- 0:00:35
423000 -- (-300.718) (-303.063) (-302.231) [-300.659] * (-300.269) (-301.500) [-300.977] (-299.166) -- 0:00:35
423500 -- (-302.130) (-303.747) [-300.935] (-299.277) * [-301.671] (-300.445) (-301.280) (-301.295) -- 0:00:35
424000 -- (-301.669) (-302.081) [-300.346] (-305.736) * (-300.746) (-298.586) [-299.975] (-300.314) -- 0:00:35
424500 -- (-306.140) (-300.244) [-301.407] (-304.143) * [-300.906] (-301.391) (-299.497) (-301.095) -- 0:00:35
425000 -- (-299.970) (-298.473) (-301.986) [-298.828] * (-300.006) [-300.429] (-299.481) (-299.633) -- 0:00:35
Average standard deviation of split frequencies: 0.008006
425500 -- [-299.286] (-299.978) (-298.814) (-302.432) * (-298.222) [-298.481] (-300.961) (-299.773) -- 0:00:35
426000 -- [-298.700] (-299.485) (-300.418) (-303.837) * [-298.958] (-299.622) (-299.923) (-299.258) -- 0:00:35
426500 -- (-299.136) [-302.519] (-303.871) (-301.291) * (-301.911) [-301.192] (-301.234) (-303.659) -- 0:00:34
427000 -- [-301.914] (-300.037) (-298.781) (-302.977) * (-301.201) (-300.582) (-302.189) [-298.823] -- 0:00:34
427500 -- (-299.485) (-301.405) [-299.031] (-299.738) * [-299.111] (-299.481) (-305.653) (-301.990) -- 0:00:34
428000 -- (-300.752) (-305.688) (-298.561) [-298.363] * (-301.528) (-301.163) (-301.041) [-301.127] -- 0:00:34
428500 -- (-300.359) (-299.069) [-300.844] (-298.440) * (-299.276) (-300.899) (-300.278) [-298.818] -- 0:00:34
429000 -- [-299.932] (-301.696) (-302.008) (-302.513) * (-299.945) (-310.178) [-301.911] (-298.567) -- 0:00:34
429500 -- (-300.622) (-300.925) (-302.395) [-301.366] * [-299.903] (-305.272) (-300.900) (-300.671) -- 0:00:34
430000 -- (-299.034) [-299.958] (-299.400) (-298.716) * [-302.048] (-303.438) (-300.698) (-302.123) -- 0:00:34
Average standard deviation of split frequencies: 0.007984
430500 -- (-299.982) [-299.634] (-302.061) (-300.907) * (-302.043) (-301.791) (-298.807) [-298.911] -- 0:00:34
431000 -- [-298.220] (-303.617) (-301.313) (-301.504) * [-302.361] (-299.363) (-299.223) (-299.305) -- 0:00:34
431500 -- [-300.920] (-305.174) (-301.971) (-298.771) * (-298.454) (-301.681) [-301.138] (-301.360) -- 0:00:34
432000 -- (-299.709) (-298.395) [-301.861] (-301.366) * (-300.704) (-300.212) (-302.666) [-299.098] -- 0:00:34
432500 -- (-300.947) (-301.092) [-300.398] (-299.981) * [-299.055] (-299.590) (-302.525) (-299.699) -- 0:00:34
433000 -- (-299.913) [-301.327] (-301.495) (-300.731) * (-300.714) (-300.969) (-305.350) [-299.389] -- 0:00:34
433500 -- [-299.813] (-301.443) (-301.938) (-301.585) * (-301.099) (-300.272) (-301.536) [-299.474] -- 0:00:33
434000 -- (-306.069) (-299.358) [-300.100] (-298.873) * [-301.099] (-300.060) (-302.313) (-300.065) -- 0:00:33
434500 -- (-303.086) [-300.448] (-300.732) (-303.439) * (-300.106) [-300.657] (-300.615) (-300.795) -- 0:00:33
435000 -- (-298.451) (-299.873) (-298.909) [-302.169] * (-301.986) (-303.761) [-302.015] (-300.174) -- 0:00:33
Average standard deviation of split frequencies: 0.008332
435500 -- (-298.438) (-301.025) [-298.407] (-304.921) * (-302.012) (-300.832) [-300.485] (-304.567) -- 0:00:33
436000 -- [-299.508] (-300.180) (-298.775) (-301.241) * (-305.776) (-299.427) [-301.037] (-302.793) -- 0:00:33
436500 -- (-300.751) [-301.420] (-298.784) (-301.846) * (-300.135) [-299.723] (-300.269) (-305.416) -- 0:00:33
437000 -- [-298.546] (-304.822) (-300.316) (-302.038) * [-301.405] (-299.191) (-303.128) (-299.056) -- 0:00:33
437500 -- (-298.804) [-298.939] (-298.567) (-304.021) * [-301.816] (-299.798) (-312.342) (-301.485) -- 0:00:33
438000 -- (-299.259) [-300.438] (-301.173) (-307.111) * (-300.783) (-298.920) (-302.812) [-299.208] -- 0:00:33
438500 -- (-301.121) (-299.931) [-299.813] (-300.526) * (-300.087) (-298.998) [-300.255] (-301.098) -- 0:00:33
439000 -- (-298.358) [-301.574] (-300.172) (-302.006) * (-299.839) (-300.362) (-299.673) [-300.190] -- 0:00:34
439500 -- (-299.450) [-299.209] (-300.957) (-301.442) * (-301.712) (-300.604) (-299.855) [-302.467] -- 0:00:34
440000 -- (-304.786) [-300.779] (-300.539) (-301.122) * (-308.902) (-298.912) [-299.230] (-300.907) -- 0:00:34
Average standard deviation of split frequencies: 0.008055
440500 -- [-301.500] (-300.279) (-300.111) (-300.633) * [-301.608] (-299.367) (-302.370) (-301.126) -- 0:00:34
441000 -- (-298.779) [-302.700] (-306.789) (-300.821) * [-303.992] (-299.203) (-299.568) (-300.284) -- 0:00:34
441500 -- (-303.773) [-299.488] (-301.139) (-301.512) * (-307.832) (-298.679) [-299.041] (-299.653) -- 0:00:34
442000 -- (-298.688) (-302.818) [-300.848] (-301.068) * [-299.074] (-299.699) (-301.577) (-301.044) -- 0:00:34
442500 -- (-300.300) (-302.074) [-301.005] (-299.971) * (-301.201) (-300.493) [-300.830] (-300.228) -- 0:00:34
443000 -- (-299.743) [-301.462] (-302.143) (-300.263) * (-300.273) (-303.350) (-298.855) [-301.518] -- 0:00:33
443500 -- (-300.835) [-303.738] (-300.004) (-300.455) * [-300.504] (-301.333) (-302.565) (-301.221) -- 0:00:33
444000 -- [-301.342] (-300.671) (-301.190) (-302.830) * (-299.357) (-298.776) [-300.700] (-302.581) -- 0:00:33
444500 -- [-300.490] (-301.502) (-303.789) (-302.511) * [-300.609] (-301.200) (-299.312) (-298.140) -- 0:00:33
445000 -- (-299.387) (-299.248) [-299.652] (-300.964) * (-300.180) [-302.236] (-307.558) (-300.956) -- 0:00:33
Average standard deviation of split frequencies: 0.008020
445500 -- [-301.294] (-300.236) (-300.287) (-302.626) * (-302.334) (-299.694) (-301.580) [-299.475] -- 0:00:33
446000 -- (-300.692) (-305.455) (-302.661) [-299.458] * (-301.722) (-300.694) (-299.283) [-302.214] -- 0:00:33
446500 -- (-303.915) (-302.583) (-299.569) [-299.764] * (-301.826) (-299.224) (-299.096) [-299.303] -- 0:00:33
447000 -- (-303.352) [-301.155] (-300.150) (-300.578) * (-301.945) (-299.567) [-298.695] (-302.329) -- 0:00:33
447500 -- (-298.842) (-303.044) (-302.052) [-300.121] * (-299.361) [-301.717] (-299.337) (-299.863) -- 0:00:33
448000 -- (-300.297) (-299.898) [-299.758] (-300.904) * (-304.371) (-306.981) [-299.391] (-300.866) -- 0:00:33
448500 -- (-299.318) (-302.429) [-299.497] (-299.880) * (-298.366) (-299.674) [-300.586] (-301.232) -- 0:00:33
449000 -- (-298.583) (-299.120) [-298.443] (-299.954) * (-298.638) (-300.560) [-299.271] (-300.662) -- 0:00:33
449500 -- (-299.562) [-299.624] (-300.798) (-304.185) * (-299.352) (-298.435) (-303.731) [-299.020] -- 0:00:33
450000 -- (-300.767) (-303.823) (-298.994) [-304.421] * [-298.832] (-299.051) (-303.454) (-299.199) -- 0:00:33
Average standard deviation of split frequencies: 0.008245
450500 -- (-300.436) (-301.884) (-300.084) [-300.586] * [-300.818] (-298.780) (-303.373) (-300.174) -- 0:00:32
451000 -- (-300.439) [-299.518] (-304.190) (-299.954) * (-299.611) (-303.228) [-303.114] (-305.431) -- 0:00:32
451500 -- (-300.471) (-300.816) (-301.708) [-306.537] * (-300.162) [-299.049] (-301.561) (-303.900) -- 0:00:32
452000 -- (-303.665) (-300.939) (-301.730) [-301.249] * (-299.731) [-300.460] (-300.444) (-299.400) -- 0:00:32
452500 -- (-300.433) [-300.029] (-300.704) (-299.794) * (-302.846) [-302.453] (-301.617) (-299.389) -- 0:00:32
453000 -- (-301.327) [-300.057] (-301.675) (-305.200) * [-299.718] (-299.114) (-300.680) (-299.027) -- 0:00:32
453500 -- (-306.047) (-300.490) [-302.197] (-305.174) * (-300.594) [-300.810] (-301.726) (-298.640) -- 0:00:32
454000 -- [-299.764] (-300.311) (-300.243) (-303.966) * (-299.154) [-298.276] (-298.700) (-299.097) -- 0:00:32
454500 -- (-300.671) (-299.554) (-301.140) [-302.507] * [-299.723] (-298.930) (-303.068) (-301.225) -- 0:00:32
455000 -- (-301.639) (-300.943) [-299.066] (-304.621) * (-300.885) [-299.599] (-298.519) (-300.139) -- 0:00:32
Average standard deviation of split frequencies: 0.008027
455500 -- (-299.083) (-299.153) (-298.564) [-303.337] * (-304.523) [-299.670] (-301.755) (-301.184) -- 0:00:32
456000 -- [-301.129] (-299.514) (-299.933) (-302.033) * (-299.520) (-299.700) [-299.099] (-299.988) -- 0:00:32
456500 -- [-298.941] (-299.381) (-302.771) (-300.518) * (-301.999) (-301.263) [-300.595] (-300.921) -- 0:00:33
457000 -- [-307.578] (-300.638) (-298.764) (-300.993) * (-300.920) [-300.507] (-310.004) (-300.023) -- 0:00:33
457500 -- (-303.184) [-302.084] (-301.605) (-299.725) * (-299.647) (-302.091) (-305.571) [-300.620] -- 0:00:33
458000 -- (-299.111) (-300.070) (-299.446) [-303.616] * (-300.122) (-302.450) (-303.539) [-299.683] -- 0:00:33
458500 -- (-300.078) (-303.872) [-305.514] (-299.606) * (-300.871) (-301.912) [-299.030] (-303.406) -- 0:00:33
459000 -- (-298.675) (-301.898) [-298.487] (-299.494) * (-302.114) (-300.699) [-300.056] (-301.379) -- 0:00:33
459500 -- (-300.449) (-300.755) [-298.925] (-305.284) * (-301.826) [-302.360] (-303.496) (-299.242) -- 0:00:32
460000 -- [-298.446] (-300.164) (-301.556) (-301.820) * (-299.551) (-300.156) (-304.128) [-301.538] -- 0:00:32
Average standard deviation of split frequencies: 0.008307
460500 -- (-298.761) (-299.669) (-300.522) [-299.299] * (-298.570) (-299.594) [-299.980] (-300.821) -- 0:00:32
461000 -- (-301.485) [-300.091] (-299.910) (-300.403) * (-299.998) (-301.895) [-299.618] (-298.920) -- 0:00:32
461500 -- (-302.390) (-301.869) [-301.715] (-302.563) * (-301.072) [-298.447] (-299.110) (-298.910) -- 0:00:32
462000 -- (-300.385) (-301.157) [-299.053] (-300.567) * (-299.481) [-299.187] (-299.509) (-299.929) -- 0:00:32
462500 -- (-301.827) [-301.937] (-301.500) (-300.321) * [-298.888] (-303.760) (-299.760) (-303.739) -- 0:00:32
463000 -- [-302.311] (-309.596) (-300.263) (-299.711) * (-298.796) (-302.749) [-299.890] (-305.607) -- 0:00:32
463500 -- (-301.887) [-304.584] (-299.865) (-300.379) * (-300.640) (-299.157) [-298.715] (-303.702) -- 0:00:32
464000 -- (-299.488) (-303.542) (-305.348) [-298.969] * (-301.353) [-300.578] (-302.495) (-305.139) -- 0:00:32
464500 -- (-300.057) (-301.660) (-302.987) [-301.333] * (-304.350) (-298.679) [-300.822] (-301.283) -- 0:00:32
465000 -- (-300.969) (-300.786) (-301.252) [-300.470] * (-300.771) (-301.897) (-299.963) [-304.372] -- 0:00:32
Average standard deviation of split frequencies: 0.008033
465500 -- [-300.376] (-299.894) (-302.137) (-300.211) * (-298.419) (-305.268) (-299.521) [-300.884] -- 0:00:32
466000 -- [-301.196] (-298.960) (-301.503) (-301.732) * (-299.391) [-299.138] (-300.294) (-301.612) -- 0:00:32
466500 -- (-301.256) (-300.579) (-299.972) [-301.420] * (-299.084) (-300.857) (-302.988) [-298.500] -- 0:00:32
467000 -- (-303.218) (-302.431) (-302.107) [-299.953] * [-300.769] (-300.315) (-300.650) (-298.568) -- 0:00:31
467500 -- (-304.338) (-300.439) [-300.779] (-299.786) * (-300.539) (-299.808) (-301.389) [-298.589] -- 0:00:31
468000 -- (-301.859) (-300.628) (-301.108) [-298.931] * [-300.109] (-299.760) (-302.402) (-300.988) -- 0:00:31
468500 -- (-300.015) [-299.383] (-301.440) (-298.846) * (-300.452) (-300.018) (-302.614) [-299.899] -- 0:00:31
469000 -- (-300.734) [-298.306] (-300.660) (-301.438) * (-304.691) (-300.081) (-300.977) [-300.886] -- 0:00:31
469500 -- (-300.493) (-301.569) [-300.548] (-303.424) * (-302.360) (-300.862) (-298.605) [-298.937] -- 0:00:31
470000 -- [-301.853] (-303.812) (-300.189) (-302.230) * (-301.105) (-301.227) [-299.953] (-299.753) -- 0:00:31
Average standard deviation of split frequencies: 0.008013
470500 -- (-302.039) (-303.212) [-299.911] (-306.701) * (-299.711) (-303.434) [-300.367] (-300.875) -- 0:00:31
471000 -- (-299.605) (-299.439) (-301.807) [-299.711] * (-301.976) (-299.473) (-301.048) [-298.334] -- 0:00:31
471500 -- [-302.757] (-301.803) (-300.720) (-300.775) * (-300.456) (-299.817) [-300.764] (-300.932) -- 0:00:31
472000 -- (-298.870) [-301.232] (-299.092) (-299.665) * (-301.563) [-300.090] (-303.781) (-301.740) -- 0:00:31
472500 -- (-299.435) [-298.749] (-299.767) (-300.187) * [-298.647] (-299.475) (-300.482) (-299.626) -- 0:00:31
473000 -- (-301.926) (-304.657) [-299.476] (-298.558) * (-299.614) (-300.792) [-300.512] (-298.936) -- 0:00:31
473500 -- (-299.143) (-304.139) [-300.213] (-302.892) * [-299.669] (-301.417) (-299.004) (-300.268) -- 0:00:31
474000 -- (-299.603) [-301.504] (-299.640) (-303.581) * (-302.066) [-300.576] (-300.317) (-303.021) -- 0:00:32
474500 -- (-302.317) (-301.081) (-298.722) [-299.100] * (-304.449) (-301.315) [-298.425] (-299.096) -- 0:00:32
475000 -- (-301.345) [-298.594] (-300.835) (-300.187) * (-302.363) (-302.490) (-300.183) [-301.388] -- 0:00:32
Average standard deviation of split frequencies: 0.007981
475500 -- (-302.981) (-304.962) (-299.433) [-300.263] * [-301.266] (-300.029) (-302.381) (-299.208) -- 0:00:31
476000 -- [-300.021] (-300.134) (-300.529) (-301.250) * (-298.999) (-299.332) (-306.005) [-298.889] -- 0:00:31
476500 -- (-299.275) [-299.211] (-301.496) (-300.227) * (-301.937) (-301.560) (-300.396) [-299.673] -- 0:00:31
477000 -- (-298.889) (-299.715) (-300.454) [-299.915] * (-299.487) (-299.450) (-298.671) [-299.446] -- 0:00:31
477500 -- [-299.944] (-300.276) (-303.981) (-298.619) * (-303.361) (-299.425) (-299.258) [-305.095] -- 0:00:31
478000 -- (-299.313) (-299.426) (-303.993) [-299.034] * (-304.453) (-300.050) [-299.657] (-302.092) -- 0:00:31
478500 -- (-299.046) (-300.227) [-299.098] (-299.553) * (-300.860) (-304.126) (-303.320) [-300.504] -- 0:00:31
479000 -- [-299.362] (-301.649) (-301.010) (-299.820) * (-302.698) [-299.251] (-303.619) (-299.830) -- 0:00:31
479500 -- (-298.733) (-300.152) [-302.372] (-304.573) * (-303.131) (-298.979) (-302.039) [-301.742] -- 0:00:31
480000 -- [-299.124] (-300.335) (-299.931) (-298.954) * (-301.614) (-299.753) (-300.956) [-300.221] -- 0:00:31
Average standard deviation of split frequencies: 0.007730
480500 -- (-300.672) [-300.115] (-301.129) (-303.666) * (-298.485) (-299.630) (-307.841) [-300.900] -- 0:00:31
481000 -- (-300.335) [-298.914] (-300.013) (-302.842) * [-302.289] (-301.949) (-301.265) (-299.070) -- 0:00:31
481500 -- (-299.366) (-299.009) [-299.653] (-301.009) * (-301.500) (-299.315) [-299.856] (-298.521) -- 0:00:31
482000 -- (-300.188) [-300.816] (-299.440) (-301.296) * (-304.582) (-302.218) (-302.383) [-298.340] -- 0:00:31
482500 -- (-301.806) (-300.023) (-299.534) [-301.548] * (-300.407) (-305.471) (-300.739) [-299.153] -- 0:00:31
483000 -- [-299.125] (-302.406) (-299.067) (-300.991) * (-299.126) [-299.661] (-298.557) (-301.942) -- 0:00:31
483500 -- [-300.067] (-304.272) (-299.484) (-299.399) * (-304.644) (-299.640) (-300.991) [-300.128] -- 0:00:30
484000 -- (-300.404) [-301.150] (-300.117) (-303.003) * (-301.506) (-300.448) [-300.437] (-299.691) -- 0:00:30
484500 -- (-298.808) (-298.550) [-301.942] (-302.853) * (-300.316) [-299.891] (-299.062) (-301.014) -- 0:00:30
485000 -- [-299.087] (-301.673) (-301.020) (-300.119) * (-301.852) [-301.239] (-303.076) (-299.227) -- 0:00:30
Average standard deviation of split frequencies: 0.007417
485500 -- (-299.066) [-301.241] (-303.851) (-300.963) * (-298.182) [-298.699] (-302.301) (-298.603) -- 0:00:30
486000 -- [-302.449] (-300.195) (-300.652) (-302.378) * (-305.379) (-299.322) [-302.644] (-300.108) -- 0:00:30
486500 -- [-298.879] (-299.854) (-302.973) (-299.709) * [-300.574] (-299.563) (-298.724) (-300.498) -- 0:00:30
487000 -- (-303.959) (-302.481) (-301.046) [-299.945] * (-301.612) (-306.748) (-298.914) [-302.178] -- 0:00:30
487500 -- [-302.552] (-300.390) (-299.589) (-300.179) * (-299.616) (-299.157) [-301.324] (-301.642) -- 0:00:30
488000 -- (-302.681) (-299.522) (-300.222) [-300.513] * (-301.609) (-299.402) [-300.876] (-305.263) -- 0:00:30
488500 -- (-304.419) (-300.526) [-299.417] (-299.881) * (-299.989) (-303.476) (-299.008) [-300.830] -- 0:00:30
489000 -- [-299.658] (-300.714) (-304.115) (-302.048) * [-301.228] (-301.862) (-299.311) (-298.676) -- 0:00:30
489500 -- (-303.495) [-302.504] (-299.722) (-298.871) * (-299.670) (-299.053) [-302.001] (-301.434) -- 0:00:30
490000 -- (-300.494) [-305.647] (-300.330) (-302.688) * [-301.910] (-300.661) (-299.084) (-300.133) -- 0:00:30
Average standard deviation of split frequencies: 0.007290
490500 -- (-302.002) (-299.817) [-302.395] (-301.405) * (-301.696) (-302.835) [-301.131] (-298.164) -- 0:00:30
491000 -- (-300.849) [-299.611] (-300.239) (-305.136) * (-299.288) (-301.267) [-298.933] (-300.096) -- 0:00:30
491500 -- (-299.067) (-301.066) (-301.538) [-300.659] * (-298.571) (-305.725) (-298.540) [-298.580] -- 0:00:31
492000 -- [-299.133] (-300.974) (-299.783) (-300.047) * (-300.919) (-300.114) [-302.544] (-299.853) -- 0:00:30
492500 -- [-298.997] (-298.840) (-299.407) (-299.985) * [-301.113] (-299.230) (-301.311) (-300.252) -- 0:00:30
493000 -- (-299.206) [-300.423] (-302.890) (-299.453) * (-298.534) (-299.087) (-302.884) [-300.912] -- 0:00:30
493500 -- (-300.850) (-301.608) [-300.626] (-302.237) * (-301.396) (-299.352) (-300.219) [-300.805] -- 0:00:30
494000 -- (-300.236) [-304.855] (-302.279) (-299.472) * (-300.809) (-301.470) [-300.748] (-303.952) -- 0:00:30
494500 -- (-299.457) [-305.677] (-299.164) (-301.451) * (-299.188) (-299.844) (-298.946) [-299.376] -- 0:00:30
495000 -- (-300.539) (-305.050) [-298.548] (-302.139) * (-298.994) [-304.542] (-301.121) (-300.311) -- 0:00:30
Average standard deviation of split frequencies: 0.006653
495500 -- (-303.085) (-301.980) (-301.918) [-301.504] * (-299.455) (-302.319) [-301.448] (-299.241) -- 0:00:30
496000 -- (-303.037) (-306.372) [-300.598] (-301.640) * (-300.465) [-298.562] (-299.263) (-300.994) -- 0:00:30
496500 -- (-303.343) [-300.226] (-299.834) (-299.226) * (-304.428) (-303.331) [-300.802] (-299.040) -- 0:00:30
497000 -- [-298.736] (-301.343) (-301.429) (-298.802) * (-302.708) (-301.911) [-301.332] (-300.073) -- 0:00:30
497500 -- [-300.388] (-299.432) (-299.193) (-301.850) * (-302.232) (-300.399) [-299.280] (-301.993) -- 0:00:30
498000 -- (-300.524) (-301.611) [-299.599] (-303.030) * (-300.944) (-300.022) [-299.414] (-299.314) -- 0:00:30
498500 -- (-301.715) [-299.703] (-301.032) (-304.071) * (-299.510) (-299.725) [-299.081] (-301.810) -- 0:00:30
499000 -- (-302.485) (-301.050) (-298.849) [-303.008] * [-299.580] (-301.956) (-299.865) (-304.414) -- 0:00:30
499500 -- (-301.708) (-303.837) [-300.151] (-299.214) * (-300.960) (-300.415) [-299.961] (-300.869) -- 0:00:30
500000 -- (-300.398) (-303.472) [-303.695] (-300.006) * (-301.989) (-300.374) [-299.865] (-299.791) -- 0:00:30
Average standard deviation of split frequencies: 0.007588
500500 -- (-299.240) (-299.393) (-299.584) [-299.170] * (-301.846) [-303.335] (-301.841) (-299.654) -- 0:00:29
501000 -- (-299.981) (-301.020) [-299.985] (-302.974) * (-301.181) (-299.384) (-300.349) [-299.761] -- 0:00:29
501500 -- (-299.726) (-300.255) (-302.215) [-299.529] * [-302.459] (-300.228) (-300.222) (-299.184) -- 0:00:29
502000 -- (-299.846) (-298.771) [-308.529] (-301.128) * (-299.776) (-301.397) [-300.016] (-298.683) -- 0:00:29
502500 -- [-300.840] (-301.259) (-300.334) (-298.565) * (-300.858) (-304.578) [-301.635] (-304.310) -- 0:00:29
503000 -- (-299.876) [-300.018] (-300.476) (-298.628) * (-302.292) (-300.512) (-299.626) [-303.323] -- 0:00:29
503500 -- (-299.649) (-300.059) (-299.833) [-302.500] * (-299.523) (-299.239) (-298.867) [-303.350] -- 0:00:29
504000 -- (-300.959) (-300.210) (-299.403) [-301.627] * (-299.582) (-300.568) (-299.032) [-300.488] -- 0:00:29
504500 -- (-302.272) (-298.256) [-298.950] (-300.550) * (-300.957) [-299.166] (-301.080) (-299.803) -- 0:00:29
505000 -- (-302.115) (-301.812) [-300.422] (-299.626) * (-301.887) (-300.042) [-299.270] (-303.685) -- 0:00:29
Average standard deviation of split frequencies: 0.008056
505500 -- [-300.315] (-301.588) (-303.265) (-300.482) * [-299.166] (-299.431) (-299.507) (-304.733) -- 0:00:29
506000 -- [-299.405] (-299.814) (-300.174) (-300.255) * (-299.071) [-299.595] (-300.065) (-302.824) -- 0:00:29
506500 -- (-302.516) [-300.718] (-302.887) (-302.053) * (-298.897) [-299.539] (-301.297) (-299.243) -- 0:00:29
507000 -- (-300.767) [-304.778] (-302.350) (-302.314) * (-302.444) (-303.164) (-301.042) [-298.943] -- 0:00:29
507500 -- (-299.958) (-305.669) (-301.537) [-301.076] * [-301.199] (-303.894) (-300.759) (-299.709) -- 0:00:29
508000 -- [-299.259] (-300.910) (-301.895) (-300.344) * (-301.487) (-301.436) (-300.797) [-298.414] -- 0:00:29
508500 -- (-299.993) [-298.786] (-304.495) (-301.047) * (-300.510) (-302.047) (-299.378) [-300.823] -- 0:00:29
509000 -- (-299.742) (-299.458) [-303.979] (-304.685) * (-301.845) [-298.682] (-301.452) (-301.038) -- 0:00:29
509500 -- (-306.976) (-302.223) (-301.070) [-300.169] * [-301.884] (-302.457) (-300.012) (-299.655) -- 0:00:29
510000 -- [-298.603] (-301.626) (-299.913) (-300.671) * (-301.203) (-298.899) [-300.531] (-300.647) -- 0:00:29
Average standard deviation of split frequencies: 0.008960
510500 -- (-300.562) [-299.330] (-300.991) (-299.388) * (-299.585) (-303.237) (-302.905) [-298.935] -- 0:00:29
511000 -- (-300.702) (-302.799) [-300.869] (-303.223) * (-300.776) [-299.799] (-301.690) (-300.229) -- 0:00:29
511500 -- (-301.694) (-304.111) (-302.809) [-298.896] * (-299.855) (-302.466) (-298.752) [-300.116] -- 0:00:29
512000 -- (-300.787) [-303.127] (-303.431) (-300.694) * [-302.918] (-301.512) (-298.816) (-302.302) -- 0:00:29
512500 -- (-305.220) (-303.231) (-300.842) [-302.789] * (-299.343) (-301.481) (-298.856) [-305.536] -- 0:00:29
513000 -- [-301.193] (-301.863) (-301.370) (-302.152) * (-300.500) [-301.804] (-301.513) (-302.347) -- 0:00:29
513500 -- (-300.051) (-301.424) (-299.235) [-300.902] * [-299.972] (-300.378) (-299.803) (-300.292) -- 0:00:29
514000 -- (-300.361) (-301.109) (-302.359) [-300.031] * [-301.731] (-298.996) (-298.632) (-299.962) -- 0:00:29
514500 -- (-303.618) (-301.084) (-298.552) [-302.813] * (-299.637) (-303.128) [-299.061] (-300.269) -- 0:00:29
515000 -- (-299.014) (-301.443) [-299.117] (-299.990) * (-300.060) [-299.905] (-298.474) (-298.942) -- 0:00:29
Average standard deviation of split frequencies: 0.008115
515500 -- [-300.920] (-304.177) (-301.920) (-307.052) * (-299.265) (-298.996) [-300.048] (-299.585) -- 0:00:29
516000 -- [-301.569] (-299.613) (-298.681) (-298.808) * (-299.495) (-300.853) [-300.408] (-302.931) -- 0:00:29
516500 -- (-302.530) (-299.521) (-299.439) [-303.486] * [-299.337] (-300.495) (-299.528) (-302.699) -- 0:00:29
517000 -- (-301.273) (-299.255) [-300.347] (-300.881) * (-298.320) (-300.473) (-299.758) [-300.902] -- 0:00:28
517500 -- (-301.120) (-299.281) [-302.948] (-302.036) * (-299.011) (-302.608) (-301.700) [-298.903] -- 0:00:28
518000 -- (-300.002) (-298.748) (-300.025) [-299.200] * (-299.044) (-300.429) [-300.300] (-300.268) -- 0:00:28
518500 -- (-300.831) (-300.664) [-300.105] (-299.947) * [-300.687] (-301.767) (-300.885) (-300.483) -- 0:00:28
519000 -- (-300.655) [-300.250] (-299.677) (-300.711) * (-304.294) [-299.685] (-299.832) (-300.110) -- 0:00:28
519500 -- (-299.084) (-299.779) (-304.472) [-300.626] * (-304.475) (-302.005) [-299.793] (-300.068) -- 0:00:28
520000 -- (-301.283) [-300.051] (-300.056) (-298.471) * [-300.951] (-301.309) (-299.888) (-300.098) -- 0:00:28
Average standard deviation of split frequencies: 0.008308
520500 -- [-300.533] (-298.588) (-300.704) (-299.109) * (-301.192) [-301.142] (-299.239) (-301.225) -- 0:00:28
521000 -- (-298.971) [-298.737] (-300.164) (-302.198) * (-301.865) (-300.828) [-301.190] (-302.259) -- 0:00:28
521500 -- (-300.986) (-300.597) (-300.109) [-300.218] * [-302.176] (-300.159) (-300.175) (-299.714) -- 0:00:28
522000 -- (-300.427) (-299.783) [-299.660] (-299.137) * (-303.466) (-298.914) [-300.834] (-299.909) -- 0:00:28
522500 -- (-300.727) (-302.941) [-299.722] (-302.380) * (-307.658) (-298.927) (-298.573) [-298.579] -- 0:00:28
523000 -- [-301.652] (-299.286) (-301.807) (-300.937) * (-306.171) (-299.094) (-298.306) [-299.478] -- 0:00:28
523500 -- (-299.884) (-299.526) [-303.792] (-299.073) * (-299.622) [-298.616] (-300.713) (-298.503) -- 0:00:28
524000 -- [-298.403] (-303.728) (-302.010) (-303.193) * (-304.807) (-299.231) [-300.373] (-298.970) -- 0:00:28
524500 -- (-298.761) (-300.073) [-301.444] (-299.526) * (-301.109) [-302.996] (-301.113) (-298.046) -- 0:00:28
525000 -- (-299.390) (-299.246) [-301.090] (-300.060) * (-301.737) [-304.909] (-300.493) (-301.556) -- 0:00:28
Average standard deviation of split frequencies: 0.008122
525500 -- (-299.449) (-306.976) (-299.503) [-299.482] * [-300.322] (-301.214) (-303.126) (-298.760) -- 0:00:27
526000 -- (-298.863) (-299.747) [-299.891] (-300.261) * (-300.538) [-301.117] (-301.615) (-299.841) -- 0:00:28
526500 -- (-299.727) [-300.045] (-298.917) (-303.750) * [-299.556] (-300.065) (-302.382) (-299.076) -- 0:00:28
527000 -- (-299.252) (-300.646) [-299.134] (-300.825) * (-299.798) (-299.959) (-304.746) [-299.121] -- 0:00:28
527500 -- [-302.128] (-301.387) (-299.337) (-301.863) * (-303.704) [-298.848] (-300.134) (-300.448) -- 0:00:28
528000 -- (-301.613) [-300.610] (-298.949) (-300.896) * (-304.507) [-300.901] (-299.764) (-299.109) -- 0:00:28
528500 -- (-299.807) (-299.800) [-299.902] (-301.270) * (-300.059) (-303.214) (-300.213) [-299.778] -- 0:00:28
529000 -- (-299.334) (-298.527) [-300.007] (-300.450) * [-300.883] (-300.351) (-302.557) (-300.365) -- 0:00:28
529500 -- (-299.381) [-301.193] (-301.350) (-299.928) * (-299.321) (-301.305) (-302.706) [-301.809] -- 0:00:28
530000 -- (-298.577) (-300.202) (-300.288) [-300.317] * (-299.058) [-299.580] (-302.195) (-298.940) -- 0:00:28
Average standard deviation of split frequencies: 0.009354
530500 -- [-302.875] (-300.671) (-300.629) (-300.699) * (-298.869) (-302.123) (-302.733) [-299.994] -- 0:00:28
531000 -- (-300.310) (-299.242) (-300.594) [-302.715] * (-299.349) (-298.978) (-300.488) [-300.832] -- 0:00:28
531500 -- (-302.586) (-298.217) (-300.057) [-300.945] * (-299.454) [-300.188] (-299.093) (-299.711) -- 0:00:28
532000 -- [-298.366] (-301.815) (-301.117) (-299.893) * [-300.363] (-298.540) (-299.125) (-304.102) -- 0:00:28
532500 -- (-299.387) [-298.320] (-299.643) (-299.504) * (-301.101) (-300.329) [-300.087] (-300.902) -- 0:00:28
533000 -- (-300.078) (-301.053) [-299.979] (-298.975) * (-300.407) [-301.597] (-301.437) (-301.137) -- 0:00:28
533500 -- (-299.563) (-298.568) (-299.967) [-299.211] * [-300.464] (-300.641) (-303.052) (-299.840) -- 0:00:27
534000 -- (-306.521) (-298.992) [-298.868] (-299.511) * [-298.879] (-302.607) (-298.724) (-299.039) -- 0:00:27
534500 -- (-299.189) [-303.401] (-302.963) (-302.380) * [-302.110] (-303.202) (-305.585) (-301.676) -- 0:00:27
535000 -- (-299.822) (-300.116) (-300.273) [-303.669] * [-299.021] (-302.258) (-303.494) (-301.124) -- 0:00:27
Average standard deviation of split frequencies: 0.009519
535500 -- (-301.021) (-299.750) (-304.536) [-298.767] * [-301.190] (-302.791) (-301.796) (-298.668) -- 0:00:27
536000 -- (-300.494) [-299.365] (-300.378) (-299.616) * (-299.725) [-306.574] (-301.472) (-299.527) -- 0:00:27
536500 -- (-302.762) (-302.273) (-299.427) [-298.313] * (-301.801) (-299.863) (-301.416) [-301.030] -- 0:00:27
537000 -- (-299.637) [-299.441] (-298.981) (-298.460) * [-300.817] (-300.979) (-299.177) (-301.314) -- 0:00:27
537500 -- [-298.514] (-303.068) (-303.188) (-302.391) * [-299.933] (-300.445) (-299.416) (-299.698) -- 0:00:27
538000 -- [-299.798] (-298.137) (-299.990) (-300.457) * (-300.136) (-303.187) [-298.592] (-300.688) -- 0:00:27
538500 -- [-301.986] (-299.144) (-299.242) (-300.325) * (-301.955) (-299.302) [-302.488] (-300.319) -- 0:00:27
539000 -- [-300.474] (-298.131) (-298.944) (-300.310) * (-301.492) (-301.708) (-303.700) [-300.972] -- 0:00:27
539500 -- (-299.842) (-300.211) [-299.802] (-302.854) * (-300.128) (-298.554) [-299.833] (-298.628) -- 0:00:27
540000 -- (-298.931) (-301.575) (-299.176) [-301.196] * [-299.155] (-298.970) (-299.935) (-302.675) -- 0:00:27
Average standard deviation of split frequencies: 0.009693
540500 -- [-302.128] (-299.820) (-300.550) (-301.572) * (-301.491) [-301.442] (-301.248) (-301.398) -- 0:00:27
541000 -- (-299.611) (-300.334) (-301.501) [-298.241] * (-301.129) (-299.240) (-301.746) [-298.954] -- 0:00:27
541500 -- (-298.437) [-300.470] (-301.365) (-301.200) * (-305.527) [-298.874] (-302.854) (-305.352) -- 0:00:27
542000 -- (-298.898) [-298.370] (-298.340) (-299.427) * (-299.458) (-299.136) [-302.405] (-300.014) -- 0:00:27
542500 -- [-298.577] (-299.215) (-300.131) (-298.982) * (-302.875) (-299.937) (-298.978) [-300.477] -- 0:00:26
543000 -- (-299.974) (-299.523) [-299.826] (-299.644) * (-301.020) (-301.322) (-301.050) [-300.436] -- 0:00:27
543500 -- (-302.987) [-298.518] (-299.713) (-301.300) * (-301.181) (-304.943) (-298.372) [-298.810] -- 0:00:27
544000 -- [-300.666] (-299.303) (-299.448) (-298.339) * [-299.070] (-302.204) (-304.022) (-299.692) -- 0:00:27
544500 -- [-299.703] (-299.349) (-302.544) (-300.876) * [-301.189] (-299.550) (-299.505) (-299.001) -- 0:00:27
545000 -- (-298.475) [-300.050] (-299.607) (-298.500) * (-300.563) (-300.116) [-300.049] (-298.344) -- 0:00:27
Average standard deviation of split frequencies: 0.009700
545500 -- [-298.773] (-300.127) (-301.119) (-298.655) * [-298.909] (-300.175) (-302.866) (-301.389) -- 0:00:27
546000 -- [-299.102] (-299.139) (-305.245) (-299.220) * [-299.339] (-299.359) (-303.619) (-298.909) -- 0:00:27
546500 -- [-301.138] (-303.229) (-301.940) (-303.641) * (-301.998) (-302.455) (-299.003) [-299.050] -- 0:00:27
547000 -- (-301.894) (-304.054) [-303.037] (-302.693) * (-301.103) (-303.677) [-299.323] (-301.257) -- 0:00:27
547500 -- (-299.278) (-299.592) (-301.919) [-303.692] * (-303.006) [-301.033] (-299.899) (-299.050) -- 0:00:27
548000 -- (-301.067) (-301.522) [-299.674] (-301.821) * (-302.220) [-298.712] (-301.547) (-300.061) -- 0:00:27
548500 -- (-299.014) [-298.484] (-301.376) (-301.956) * [-301.670] (-298.819) (-299.481) (-299.299) -- 0:00:27
549000 -- (-301.163) (-300.215) [-298.935] (-300.006) * [-300.166] (-299.152) (-301.725) (-298.930) -- 0:00:27
549500 -- (-303.560) [-298.981] (-299.988) (-300.782) * (-298.896) (-300.257) (-301.728) [-299.195] -- 0:00:27
550000 -- (-302.174) (-301.410) (-299.098) [-300.638] * [-299.506] (-302.044) (-303.318) (-300.295) -- 0:00:27
Average standard deviation of split frequencies: 0.009316
550500 -- (-302.593) (-299.434) [-298.789] (-301.202) * (-301.859) [-299.884] (-299.256) (-301.675) -- 0:00:26
551000 -- (-300.740) [-298.841] (-302.425) (-301.178) * [-300.321] (-305.640) (-300.397) (-300.721) -- 0:00:26
551500 -- [-299.650] (-301.310) (-303.690) (-302.088) * (-299.575) [-299.596] (-298.439) (-302.059) -- 0:00:26
552000 -- (-301.449) [-301.202] (-303.106) (-302.941) * (-300.596) (-299.999) [-300.257] (-299.934) -- 0:00:26
552500 -- (-299.508) [-299.904] (-302.720) (-303.616) * [-299.227] (-299.389) (-300.981) (-301.280) -- 0:00:26
553000 -- (-301.530) (-299.065) [-298.715] (-300.264) * (-302.723) (-301.358) [-299.807] (-300.399) -- 0:00:26
553500 -- (-301.600) (-299.820) [-299.359] (-301.340) * [-302.649] (-298.864) (-305.071) (-300.716) -- 0:00:26
554000 -- (-299.257) [-298.223] (-300.527) (-298.608) * [-300.187] (-301.934) (-298.730) (-300.801) -- 0:00:26
554500 -- (-298.973) (-298.433) [-298.302] (-301.257) * (-302.149) (-299.826) [-298.467] (-301.615) -- 0:00:26
555000 -- (-300.449) [-298.335] (-300.304) (-302.782) * (-307.156) (-300.205) [-298.999] (-300.206) -- 0:00:26
Average standard deviation of split frequencies: 0.009177
555500 -- (-307.037) [-299.016] (-302.579) (-302.459) * (-301.310) [-301.507] (-300.163) (-300.380) -- 0:00:26
556000 -- [-301.371] (-299.620) (-300.046) (-300.251) * (-303.849) [-300.074] (-299.746) (-299.595) -- 0:00:26
556500 -- (-303.036) [-298.748] (-303.848) (-302.344) * (-301.412) (-299.211) (-299.142) [-301.541] -- 0:00:26
557000 -- (-305.924) (-302.594) [-300.813] (-300.838) * (-299.373) (-301.011) [-299.209] (-299.393) -- 0:00:26
557500 -- (-303.120) (-299.338) [-301.806] (-302.355) * (-298.443) (-303.711) (-300.186) [-299.515] -- 0:00:26
558000 -- [-301.422] (-300.977) (-300.980) (-301.552) * (-300.032) [-301.129] (-301.237) (-301.784) -- 0:00:26
558500 -- (-303.202) (-299.246) (-298.997) [-301.650] * (-300.004) (-298.687) (-301.499) [-304.000] -- 0:00:26
559000 -- (-300.872) [-298.631] (-299.975) (-301.306) * [-301.622] (-300.804) (-299.682) (-299.196) -- 0:00:26
559500 -- (-303.561) (-299.494) [-300.181] (-301.979) * [-298.546] (-299.486) (-301.522) (-302.393) -- 0:00:25
560000 -- [-301.253] (-303.930) (-299.706) (-302.176) * (-299.766) [-300.702] (-305.348) (-300.977) -- 0:00:26
Average standard deviation of split frequencies: 0.009298
560500 -- (-298.863) [-300.748] (-300.987) (-303.320) * (-302.786) [-306.537] (-301.037) (-298.758) -- 0:00:26
561000 -- (-301.409) (-299.917) (-306.020) [-301.122] * (-300.277) (-300.164) (-301.892) [-298.684] -- 0:00:26
561500 -- [-299.660] (-303.004) (-303.012) (-299.892) * (-300.966) (-301.719) [-299.615] (-298.908) -- 0:00:26
562000 -- (-302.662) (-301.084) [-301.343] (-302.080) * (-301.286) (-302.878) [-300.830] (-299.976) -- 0:00:26
562500 -- (-301.963) (-300.194) [-301.901] (-299.066) * (-301.154) (-299.186) [-300.981] (-298.657) -- 0:00:26
563000 -- (-299.909) [-302.993] (-300.096) (-298.795) * (-300.377) (-300.753) (-299.283) [-303.903] -- 0:00:26
563500 -- (-301.121) [-300.561] (-300.263) (-298.222) * (-301.612) (-300.009) (-300.622) [-299.242] -- 0:00:26
564000 -- (-298.526) (-299.146) (-299.215) [-298.771] * (-301.955) (-301.624) (-298.817) [-300.581] -- 0:00:26
564500 -- (-302.474) [-299.345] (-301.530) (-299.949) * (-302.852) (-299.806) [-299.073] (-298.873) -- 0:00:26
565000 -- (-303.353) (-300.201) [-301.527] (-301.936) * (-298.840) [-300.095] (-302.399) (-298.361) -- 0:00:26
Average standard deviation of split frequencies: 0.008623
565500 -- [-300.267] (-299.136) (-302.022) (-299.587) * (-300.309) [-299.720] (-302.329) (-299.867) -- 0:00:26
566000 -- [-300.279] (-299.969) (-298.778) (-302.225) * [-302.399] (-301.374) (-298.710) (-299.524) -- 0:00:26
566500 -- (-300.757) [-299.858] (-302.085) (-299.165) * (-300.415) [-300.865] (-301.561) (-299.678) -- 0:00:26
567000 -- (-300.036) (-300.861) (-303.273) [-299.667] * [-300.480] (-300.722) (-300.541) (-301.478) -- 0:00:25
567500 -- [-299.417] (-302.908) (-302.539) (-299.798) * [-300.519] (-303.179) (-300.489) (-299.152) -- 0:00:25
568000 -- (-303.529) (-302.199) (-300.447) [-299.445] * (-299.743) (-300.000) [-299.160] (-300.501) -- 0:00:25
568500 -- (-301.204) (-299.542) [-300.828] (-299.864) * (-304.171) (-301.303) [-300.304] (-298.945) -- 0:00:25
569000 -- (-300.315) (-302.763) [-299.126] (-300.683) * (-301.655) (-299.053) [-299.957] (-301.094) -- 0:00:25
569500 -- (-305.096) (-300.469) [-300.575] (-300.438) * [-299.621] (-299.041) (-303.675) (-299.116) -- 0:00:25
570000 -- (-303.358) [-300.087] (-303.318) (-300.072) * [-299.053] (-301.650) (-300.689) (-300.475) -- 0:00:25
Average standard deviation of split frequencies: 0.008066
570500 -- (-299.670) (-303.707) [-301.680] (-299.270) * (-298.605) (-303.066) [-301.047] (-302.218) -- 0:00:25
571000 -- (-301.857) [-300.850] (-302.049) (-300.238) * (-303.759) (-300.520) (-299.164) [-298.749] -- 0:00:25
571500 -- [-304.685] (-300.275) (-300.411) (-298.338) * [-302.640] (-301.644) (-303.957) (-299.336) -- 0:00:25
572000 -- (-300.688) (-303.008) (-302.389) [-298.552] * [-304.582] (-301.546) (-299.348) (-299.365) -- 0:00:25
572500 -- [-301.406] (-299.332) (-303.157) (-300.496) * [-299.300] (-303.377) (-300.527) (-299.568) -- 0:00:25
573000 -- (-301.647) (-299.152) [-302.348] (-301.019) * (-300.856) (-302.451) [-299.578] (-300.974) -- 0:00:25
573500 -- (-301.114) (-301.890) [-300.688] (-302.370) * (-301.067) [-304.107] (-303.476) (-300.882) -- 0:00:25
574000 -- (-301.780) (-300.848) [-298.895] (-300.784) * (-301.446) (-299.662) (-299.202) [-300.683] -- 0:00:25
574500 -- (-300.931) (-298.706) [-299.464] (-301.640) * (-303.959) [-302.306] (-299.430) (-299.644) -- 0:00:25
575000 -- (-298.627) (-298.146) [-298.671] (-300.846) * [-299.801] (-299.065) (-300.659) (-299.833) -- 0:00:25
Average standard deviation of split frequencies: 0.008329
575500 -- (-300.369) [-298.584] (-298.257) (-299.942) * (-298.946) (-302.381) [-300.426] (-302.011) -- 0:00:25
576000 -- [-300.334] (-298.277) (-298.290) (-298.257) * (-304.056) (-304.308) (-299.653) [-300.018] -- 0:00:25
576500 -- (-301.550) (-301.059) [-298.519] (-298.209) * [-302.100] (-302.706) (-300.998) (-301.276) -- 0:00:24
577000 -- (-301.525) (-299.988) [-300.672] (-298.652) * (-305.503) (-301.594) (-301.813) [-300.165] -- 0:00:25
577500 -- (-301.797) (-298.845) [-302.804] (-301.064) * (-299.687) [-300.676] (-302.544) (-300.022) -- 0:00:25
578000 -- [-298.767] (-299.188) (-299.337) (-301.605) * (-300.413) (-299.866) [-299.506] (-300.215) -- 0:00:25
578500 -- (-299.310) (-299.694) [-299.584] (-301.958) * (-307.438) (-299.653) (-299.693) [-301.290] -- 0:00:25
579000 -- (-301.195) (-302.615) [-299.506] (-301.639) * (-300.560) (-299.800) (-302.058) [-298.892] -- 0:00:25
579500 -- (-299.714) (-303.673) [-301.060] (-301.294) * (-300.276) (-301.563) [-298.531] (-300.980) -- 0:00:25
580000 -- (-300.178) (-302.128) [-300.524] (-300.714) * (-300.143) (-303.188) (-306.778) [-300.685] -- 0:00:25
Average standard deviation of split frequencies: 0.008596
580500 -- (-302.074) (-303.528) (-302.294) [-301.225] * [-301.257] (-298.507) (-302.173) (-302.233) -- 0:00:25
581000 -- (-305.549) (-301.785) [-298.688] (-302.303) * (-304.055) (-299.215) (-300.029) [-303.242] -- 0:00:25
581500 -- (-302.826) [-299.779] (-298.189) (-299.434) * (-299.562) (-303.286) (-298.069) [-299.198] -- 0:00:25
582000 -- (-299.536) (-300.388) [-298.727] (-299.076) * (-302.332) (-302.900) [-300.872] (-302.700) -- 0:00:25
582500 -- [-301.874] (-302.036) (-298.699) (-300.846) * (-301.111) (-305.342) (-304.255) [-298.699] -- 0:00:25
583000 -- (-298.484) (-302.210) (-298.788) [-301.887] * (-301.845) [-301.405] (-300.618) (-299.785) -- 0:00:25
583500 -- [-299.001] (-299.875) (-299.961) (-299.705) * (-302.134) [-299.955] (-298.738) (-301.387) -- 0:00:24
584000 -- (-301.816) [-302.829] (-299.054) (-300.421) * (-298.591) (-299.766) (-299.203) [-300.181] -- 0:00:24
584500 -- (-299.786) (-299.169) [-298.935] (-302.005) * (-300.675) (-310.354) (-300.300) [-300.251] -- 0:00:24
585000 -- (-301.893) (-301.879) [-302.573] (-298.739) * (-299.959) (-304.390) [-299.140] (-304.214) -- 0:00:24
Average standard deviation of split frequencies: 0.009133
585500 -- (-300.596) [-299.486] (-299.373) (-298.249) * (-299.931) (-304.243) (-298.713) [-301.858] -- 0:00:24
586000 -- (-299.888) (-305.346) [-298.945] (-299.863) * (-301.034) (-304.297) [-302.985] (-298.750) -- 0:00:24
586500 -- (-299.598) [-302.603] (-302.533) (-300.325) * (-299.777) (-298.961) [-299.794] (-300.572) -- 0:00:24
587000 -- (-301.400) [-299.631] (-302.908) (-301.472) * (-298.621) (-299.705) [-299.823] (-299.521) -- 0:00:24
587500 -- [-299.184] (-304.791) (-302.250) (-300.861) * [-301.224] (-301.690) (-301.437) (-301.014) -- 0:00:24
588000 -- [-301.666] (-298.383) (-300.343) (-300.041) * [-300.156] (-302.500) (-298.414) (-303.419) -- 0:00:24
588500 -- (-304.692) (-303.324) (-299.899) [-299.592] * (-301.523) [-298.712] (-303.935) (-300.072) -- 0:00:24
589000 -- [-300.205] (-300.716) (-300.227) (-299.695) * (-300.884) [-302.853] (-303.362) (-300.599) -- 0:00:24
589500 -- (-301.381) (-299.373) (-298.490) [-299.047] * [-301.331] (-305.619) (-298.761) (-301.726) -- 0:00:24
590000 -- (-299.017) (-299.128) [-298.566] (-299.048) * [-300.538] (-304.222) (-299.297) (-298.455) -- 0:00:24
Average standard deviation of split frequencies: 0.009201
590500 -- (-299.250) (-299.174) (-298.417) [-298.778] * (-299.039) (-301.464) [-300.881] (-298.706) -- 0:00:24
591000 -- [-300.423] (-300.154) (-300.410) (-298.652) * (-298.972) (-300.407) (-298.831) [-301.942] -- 0:00:24
591500 -- (-303.577) (-298.471) (-298.858) [-298.426] * (-298.812) (-299.549) [-302.139] (-299.417) -- 0:00:24
592000 -- (-304.418) (-299.003) (-299.471) [-302.511] * (-300.994) (-300.714) (-299.186) [-305.182] -- 0:00:24
592500 -- [-300.462] (-302.606) (-302.141) (-301.665) * (-301.822) (-300.745) [-300.524] (-301.594) -- 0:00:24
593000 -- (-300.953) (-300.392) (-301.470) [-302.842] * (-300.244) (-298.995) [-298.305] (-301.004) -- 0:00:24
593500 -- (-301.469) (-300.391) [-299.591] (-301.096) * (-301.392) [-301.972] (-301.257) (-300.506) -- 0:00:23
594000 -- (-301.833) (-299.851) [-300.884] (-299.445) * (-302.218) [-301.407] (-300.277) (-301.372) -- 0:00:24
594500 -- (-298.774) [-301.312] (-299.144) (-303.075) * (-303.040) (-303.101) [-300.795] (-301.127) -- 0:00:24
595000 -- (-301.299) [-299.111] (-300.182) (-312.572) * (-299.661) (-302.632) [-302.380] (-302.579) -- 0:00:24
Average standard deviation of split frequencies: 0.009584
595500 -- (-300.053) [-299.564] (-301.338) (-299.677) * (-300.199) [-301.116] (-301.461) (-303.728) -- 0:00:24
596000 -- [-299.458] (-303.975) (-300.158) (-307.593) * [-301.753] (-301.500) (-305.071) (-299.993) -- 0:00:24
596500 -- (-298.489) (-305.717) (-300.753) [-301.457] * (-300.313) [-299.182] (-299.838) (-302.082) -- 0:00:24
597000 -- [-299.114] (-301.970) (-299.157) (-298.326) * [-299.483] (-299.547) (-300.562) (-300.275) -- 0:00:24
597500 -- [-300.520] (-299.639) (-299.594) (-298.996) * (-299.661) (-299.060) [-299.149] (-303.012) -- 0:00:24
598000 -- (-299.609) (-304.843) (-299.938) [-299.982] * (-299.041) (-302.319) [-302.880] (-304.684) -- 0:00:24
598500 -- (-301.999) (-301.595) (-301.062) [-300.038] * [-302.216] (-304.474) (-302.492) (-299.029) -- 0:00:24
599000 -- [-299.100] (-303.191) (-304.603) (-302.758) * [-300.390] (-299.312) (-305.587) (-302.644) -- 0:00:24
599500 -- (-299.801) [-298.601] (-299.743) (-303.934) * [-299.124] (-298.810) (-303.924) (-299.635) -- 0:00:24
600000 -- (-302.572) [-299.904] (-301.931) (-304.838) * (-299.763) (-300.697) (-302.483) [-300.359] -- 0:00:24
Average standard deviation of split frequencies: 0.009787
600500 -- (-301.385) [-298.394] (-299.030) (-299.485) * [-301.843] (-300.186) (-298.475) (-299.514) -- 0:00:23
601000 -- (-299.013) (-301.978) (-299.320) [-303.572] * (-299.679) (-300.769) (-300.421) [-298.951] -- 0:00:23
601500 -- [-301.021] (-299.998) (-305.960) (-304.861) * (-303.697) (-299.549) (-299.721) [-299.707] -- 0:00:23
602000 -- (-299.519) [-300.309] (-299.643) (-301.423) * (-304.505) (-300.025) (-304.979) [-301.596] -- 0:00:23
602500 -- [-298.648] (-299.904) (-301.886) (-299.529) * (-301.407) (-302.727) (-302.366) [-301.571] -- 0:00:23
603000 -- [-300.178] (-301.484) (-301.841) (-298.755) * [-300.431] (-301.002) (-298.572) (-299.262) -- 0:00:23
603500 -- [-300.164] (-299.745) (-299.355) (-299.732) * [-303.764] (-302.464) (-298.299) (-302.518) -- 0:00:23
604000 -- (-301.408) (-299.058) (-302.245) [-299.208] * (-305.311) (-302.837) [-299.300] (-300.392) -- 0:00:23
604500 -- (-298.638) [-301.217] (-302.060) (-299.059) * (-302.285) [-303.308] (-299.983) (-301.083) -- 0:00:23
605000 -- (-300.304) (-298.542) (-303.075) [-298.289] * (-299.934) (-303.974) [-300.627] (-302.423) -- 0:00:23
Average standard deviation of split frequencies: 0.009975
605500 -- (-301.946) [-301.176] (-301.524) (-301.371) * (-303.325) [-300.507] (-299.283) (-301.308) -- 0:00:23
606000 -- (-299.570) (-299.519) [-302.652] (-305.743) * (-299.124) (-301.900) (-299.986) [-302.944] -- 0:00:23
606500 -- (-299.795) (-299.681) [-302.848] (-302.101) * (-306.043) (-306.694) [-300.482] (-303.275) -- 0:00:23
607000 -- (-300.673) [-298.336] (-302.122) (-300.357) * [-298.797] (-301.545) (-299.796) (-302.056) -- 0:00:23
607500 -- [-300.279] (-300.348) (-302.118) (-305.336) * (-299.121) [-299.055] (-303.435) (-300.260) -- 0:00:23
608000 -- [-298.948] (-299.955) (-298.547) (-301.555) * (-299.421) [-299.681] (-300.719) (-299.267) -- 0:00:23
608500 -- [-298.282] (-300.257) (-300.145) (-301.781) * (-300.507) [-303.546] (-300.207) (-302.119) -- 0:00:23
609000 -- (-300.105) [-303.114] (-299.416) (-300.979) * (-299.265) (-299.614) (-302.307) [-299.344] -- 0:00:23
609500 -- (-300.908) [-298.443] (-302.116) (-298.708) * [-300.014] (-301.246) (-302.339) (-299.024) -- 0:00:23
610000 -- [-300.062] (-299.404) (-302.236) (-301.322) * (-300.379) (-302.409) (-300.993) [-299.579] -- 0:00:23
Average standard deviation of split frequencies: 0.009808
610500 -- (-303.046) (-302.211) (-299.193) [-302.478] * (-300.448) (-300.053) (-299.506) [-299.150] -- 0:00:22
611000 -- (-303.910) (-300.008) [-300.509] (-301.014) * [-299.420] (-299.613) (-298.672) (-304.202) -- 0:00:22
611500 -- [-302.204] (-304.434) (-299.511) (-301.612) * (-303.891) (-298.624) [-299.316] (-303.702) -- 0:00:23
612000 -- (-298.954) (-298.338) [-301.391] (-301.109) * (-304.213) (-302.218) (-299.769) [-300.153] -- 0:00:23
612500 -- (-302.166) (-299.675) [-298.465] (-300.351) * [-299.993] (-300.349) (-298.414) (-298.300) -- 0:00:23
613000 -- (-300.816) (-302.499) (-298.399) [-299.143] * [-300.689] (-298.616) (-298.145) (-307.337) -- 0:00:23
613500 -- (-300.835) (-304.331) (-298.811) [-299.312] * (-300.918) (-300.804) (-299.402) [-301.418] -- 0:00:23
614000 -- (-300.549) (-300.083) [-298.936] (-299.774) * (-301.693) [-301.557] (-303.194) (-299.395) -- 0:00:23
614500 -- (-299.653) (-301.764) [-300.086] (-311.545) * (-304.232) (-303.934) [-300.314] (-300.524) -- 0:00:23
615000 -- (-300.162) [-301.412] (-299.718) (-304.359) * (-302.111) (-302.669) [-300.808] (-298.686) -- 0:00:23
Average standard deviation of split frequencies: 0.009858
615500 -- [-302.228] (-304.233) (-299.388) (-301.403) * (-305.382) (-301.290) (-299.399) [-299.725] -- 0:00:23
616000 -- (-302.970) (-299.820) [-298.888] (-302.946) * (-303.371) (-300.816) [-299.617] (-298.910) -- 0:00:23
616500 -- (-303.641) [-300.478] (-300.370) (-301.496) * (-300.924) (-300.017) (-300.019) [-299.990] -- 0:00:23
617000 -- (-303.855) [-302.793] (-300.664) (-298.689) * [-300.087] (-301.341) (-299.898) (-305.812) -- 0:00:22
617500 -- (-299.593) (-299.571) [-299.155] (-299.108) * (-302.756) (-299.111) [-303.022] (-299.298) -- 0:00:22
618000 -- (-308.569) (-302.853) [-299.410] (-302.635) * (-300.493) (-303.365) (-298.267) [-299.154] -- 0:00:22
618500 -- (-305.097) [-301.521] (-299.006) (-301.478) * (-301.387) [-299.698] (-301.877) (-299.204) -- 0:00:22
619000 -- (-300.924) [-300.320] (-301.495) (-299.311) * (-301.148) (-298.775) (-302.315) [-298.743] -- 0:00:22
619500 -- (-301.127) (-298.234) [-299.654] (-305.279) * [-300.631] (-299.140) (-300.259) (-300.597) -- 0:00:22
620000 -- (-298.259) (-299.429) [-300.165] (-307.317) * (-300.283) (-301.310) (-299.667) [-299.973] -- 0:00:22
Average standard deviation of split frequencies: 0.009740
620500 -- (-303.391) [-301.281] (-298.742) (-300.999) * [-301.697] (-304.380) (-299.323) (-300.804) -- 0:00:22
621000 -- (-302.300) [-299.404] (-298.890) (-299.237) * (-302.131) (-301.091) (-300.147) [-299.316] -- 0:00:22
621500 -- (-301.280) (-300.354) (-299.029) [-300.231] * (-301.207) (-299.999) (-299.189) [-299.182] -- 0:00:22
622000 -- (-300.278) (-299.658) (-301.876) [-301.885] * (-298.917) [-300.844] (-300.054) (-301.335) -- 0:00:22
622500 -- (-298.629) (-300.188) [-298.551] (-299.321) * [-300.848] (-302.871) (-301.277) (-301.282) -- 0:00:22
623000 -- (-298.469) [-299.602] (-299.430) (-299.644) * (-299.313) [-299.166] (-298.436) (-299.578) -- 0:00:22
623500 -- (-298.498) (-299.807) (-301.739) [-300.267] * (-299.458) [-301.725] (-303.356) (-299.797) -- 0:00:22
624000 -- [-302.241] (-299.095) (-300.207) (-299.382) * (-300.890) (-301.626) (-303.292) [-299.425] -- 0:00:22
624500 -- [-302.822] (-300.541) (-299.815) (-302.271) * [-301.464] (-300.362) (-299.453) (-298.478) -- 0:00:22
625000 -- (-300.693) (-303.074) (-304.043) [-300.653] * (-299.120) (-301.100) (-299.323) [-299.377] -- 0:00:22
Average standard deviation of split frequencies: 0.009524
625500 -- (-302.709) (-305.647) [-300.382] (-306.686) * [-299.712] (-304.880) (-304.201) (-304.242) -- 0:00:22
626000 -- (-304.216) [-301.376] (-299.380) (-298.875) * (-305.510) [-304.066] (-301.763) (-302.287) -- 0:00:22
626500 -- (-302.028) (-300.342) (-299.328) [-299.406] * (-304.715) (-299.498) [-298.665] (-300.440) -- 0:00:22
627000 -- (-305.628) [-299.052] (-298.761) (-299.774) * (-299.086) (-300.246) (-302.573) [-301.426] -- 0:00:22
627500 -- (-301.848) (-300.629) [-300.957] (-300.754) * (-298.656) [-298.188] (-300.639) (-299.399) -- 0:00:21
628000 -- [-300.615] (-299.448) (-300.940) (-299.396) * [-300.294] (-299.540) (-305.689) (-298.169) -- 0:00:21
628500 -- (-300.623) [-299.480] (-302.098) (-299.354) * (-301.549) (-299.644) (-300.261) [-299.247] -- 0:00:22
629000 -- [-300.182] (-299.436) (-304.515) (-299.013) * [-301.875] (-299.425) (-298.728) (-300.970) -- 0:00:22
629500 -- (-302.585) (-300.322) (-302.078) [-305.721] * (-299.748) (-298.280) (-299.662) [-301.972] -- 0:00:22
630000 -- (-302.515) (-300.659) [-300.601] (-303.023) * [-300.852] (-300.416) (-302.743) (-298.917) -- 0:00:22
Average standard deviation of split frequencies: 0.009189
630500 -- (-301.515) (-299.891) [-303.284] (-299.546) * (-299.052) (-298.434) [-298.714] (-300.776) -- 0:00:22
631000 -- [-300.332] (-300.307) (-300.147) (-300.534) * (-302.502) [-300.823] (-303.085) (-300.295) -- 0:00:22
631500 -- (-304.694) [-300.087] (-299.104) (-300.148) * (-300.543) (-299.588) (-302.896) [-302.948] -- 0:00:22
632000 -- [-301.228] (-300.640) (-300.024) (-304.988) * (-301.304) (-301.344) (-301.054) [-299.475] -- 0:00:22
632500 -- (-301.767) (-300.655) [-300.634] (-301.535) * (-298.980) (-300.521) (-302.103) [-298.731] -- 0:00:22
633000 -- (-298.635) (-302.468) (-302.322) [-299.256] * (-299.999) (-300.148) (-304.153) [-299.948] -- 0:00:22
633500 -- [-301.848] (-299.523) (-299.557) (-298.985) * (-301.779) (-300.167) [-302.821] (-298.438) -- 0:00:21
634000 -- (-300.499) [-299.402] (-300.007) (-300.745) * (-300.172) (-301.405) [-300.285] (-301.215) -- 0:00:21
634500 -- (-299.783) (-300.829) (-300.314) [-302.608] * (-300.166) (-299.751) [-300.027] (-300.987) -- 0:00:21
635000 -- (-302.180) (-300.557) (-300.079) [-299.841] * (-300.218) [-298.671] (-300.048) (-298.466) -- 0:00:21
Average standard deviation of split frequencies: 0.009854
635500 -- [-298.348] (-303.722) (-299.820) (-300.378) * (-299.659) (-300.457) [-301.066] (-301.890) -- 0:00:21
636000 -- (-300.935) (-298.643) [-302.048] (-306.239) * (-299.498) (-300.578) [-301.730] (-300.319) -- 0:00:21
636500 -- (-300.138) [-299.899] (-301.413) (-304.318) * (-300.532) [-303.238] (-299.757) (-301.015) -- 0:00:21
637000 -- (-302.043) [-299.850] (-301.353) (-301.571) * (-301.504) (-298.755) (-298.931) [-302.037] -- 0:00:21
637500 -- (-302.918) [-301.277] (-303.946) (-299.510) * [-302.498] (-298.655) (-298.128) (-300.179) -- 0:00:21
638000 -- (-298.548) (-299.943) (-299.658) [-298.392] * (-301.456) [-300.520] (-299.077) (-300.038) -- 0:00:21
638500 -- (-301.569) (-301.447) (-298.858) [-298.946] * [-303.651] (-305.669) (-298.725) (-301.190) -- 0:00:21
639000 -- [-300.324] (-301.241) (-302.159) (-302.814) * (-298.794) (-299.181) (-298.464) [-302.112] -- 0:00:21
639500 -- (-299.925) (-301.454) [-299.917] (-299.341) * (-300.681) (-298.221) (-299.754) [-300.972] -- 0:00:21
640000 -- (-299.377) (-301.109) [-300.718] (-299.738) * [-304.965] (-299.538) (-307.684) (-303.159) -- 0:00:21
Average standard deviation of split frequencies: 0.009795
640500 -- (-301.975) (-301.142) [-298.766] (-299.907) * (-304.089) (-299.362) [-299.268] (-300.998) -- 0:00:21
641000 -- (-299.389) (-302.989) [-299.394] (-300.336) * (-300.378) (-300.363) (-298.210) [-301.245] -- 0:00:21
641500 -- (-306.269) (-307.402) [-298.720] (-299.057) * (-302.512) (-300.337) (-303.001) [-301.579] -- 0:00:21
642000 -- (-303.447) [-302.566] (-303.520) (-299.513) * (-298.329) (-301.616) [-300.146] (-299.112) -- 0:00:21
642500 -- (-300.476) (-298.893) (-299.760) [-300.417] * (-298.190) (-303.112) [-299.813] (-299.727) -- 0:00:21
643000 -- [-299.304] (-302.804) (-299.388) (-301.606) * (-303.635) [-299.010] (-304.465) (-299.379) -- 0:00:21
643500 -- (-299.571) (-300.871) [-300.006] (-299.163) * (-302.183) [-298.876] (-301.883) (-303.580) -- 0:00:21
644000 -- (-299.659) (-303.273) [-303.153] (-298.992) * (-300.099) (-300.409) (-299.651) [-299.652] -- 0:00:21
644500 -- (-299.688) (-307.841) (-302.719) [-300.275] * (-303.290) [-298.151] (-300.833) (-301.080) -- 0:00:20
645000 -- (-301.344) [-304.359] (-302.431) (-301.823) * (-302.462) (-299.817) (-299.633) [-301.829] -- 0:00:20
Average standard deviation of split frequencies: 0.010002
645500 -- (-301.002) (-302.771) [-300.863] (-300.692) * (-301.863) [-299.991] (-302.522) (-301.752) -- 0:00:21
646000 -- [-301.387] (-300.016) (-302.174) (-301.806) * [-300.158] (-301.239) (-299.675) (-300.080) -- 0:00:21
646500 -- (-301.378) (-298.853) (-299.353) [-300.604] * (-301.129) [-298.304] (-303.489) (-300.265) -- 0:00:21
647000 -- (-299.759) [-299.754] (-301.199) (-301.203) * (-299.074) (-298.973) [-299.569] (-298.610) -- 0:00:21
647500 -- (-299.612) [-300.523] (-303.946) (-302.446) * [-300.536] (-298.779) (-301.477) (-302.659) -- 0:00:21
648000 -- (-300.775) (-301.035) (-300.643) [-301.878] * (-299.774) [-299.784] (-302.384) (-301.564) -- 0:00:21
648500 -- [-303.124] (-303.410) (-300.028) (-301.800) * [-302.007] (-302.913) (-302.040) (-302.960) -- 0:00:21
649000 -- (-303.404) [-300.234] (-299.408) (-299.034) * (-301.608) (-299.753) (-299.323) [-302.528] -- 0:00:21
649500 -- (-301.796) [-301.428] (-300.451) (-300.454) * [-301.008] (-301.297) (-300.753) (-301.812) -- 0:00:21
650000 -- (-300.086) (-300.414) (-301.078) [-299.616] * (-298.794) (-299.461) [-301.858] (-304.500) -- 0:00:21
Average standard deviation of split frequencies: 0.010058
650500 -- [-300.054] (-300.948) (-301.201) (-300.424) * (-298.696) (-299.225) (-304.862) [-305.371] -- 0:00:20
651000 -- [-299.435] (-302.791) (-301.409) (-304.886) * (-304.220) (-301.674) (-299.395) [-299.691] -- 0:00:20
651500 -- (-300.465) (-301.602) (-299.692) [-303.742] * (-300.421) [-298.365] (-302.113) (-302.056) -- 0:00:20
652000 -- [-299.086] (-301.902) (-299.311) (-299.523) * (-303.018) [-299.686] (-301.922) (-303.254) -- 0:00:20
652500 -- [-303.174] (-303.584) (-298.875) (-299.009) * (-301.366) [-299.435] (-301.768) (-301.635) -- 0:00:20
653000 -- [-301.579] (-299.394) (-304.416) (-299.066) * [-300.426] (-303.118) (-298.333) (-302.480) -- 0:00:20
653500 -- (-300.343) [-298.872] (-300.197) (-300.771) * (-300.910) (-298.823) [-299.601] (-298.916) -- 0:00:20
654000 -- [-304.509] (-300.121) (-300.388) (-299.564) * (-302.814) [-301.125] (-301.206) (-300.207) -- 0:00:20
654500 -- (-301.210) (-299.380) (-299.536) [-302.383] * (-307.948) [-299.741] (-298.620) (-299.147) -- 0:00:20
655000 -- (-300.216) (-299.273) (-299.145) [-298.952] * (-306.451) (-299.912) [-301.060] (-302.180) -- 0:00:20
Average standard deviation of split frequencies: 0.009680
655500 -- (-299.832) (-300.738) [-299.415] (-301.181) * (-308.387) (-299.434) [-300.901] (-299.135) -- 0:00:20
656000 -- (-299.929) [-299.695] (-300.809) (-300.284) * (-299.748) (-298.623) (-300.355) [-300.387] -- 0:00:20
656500 -- [-303.549] (-305.073) (-302.142) (-299.496) * [-301.940] (-303.714) (-300.328) (-299.600) -- 0:00:20
657000 -- (-302.043) (-300.696) (-299.410) [-300.381] * [-300.500] (-307.685) (-299.163) (-303.951) -- 0:00:20
657500 -- (-301.839) (-301.071) [-298.701] (-298.603) * (-303.870) (-300.112) [-300.639] (-299.823) -- 0:00:20
658000 -- (-302.578) [-301.410] (-301.534) (-299.126) * (-302.180) [-301.652] (-300.633) (-301.147) -- 0:00:20
658500 -- (-302.659) (-299.803) [-299.444] (-299.631) * (-301.257) (-299.700) [-299.813] (-299.063) -- 0:00:20
659000 -- (-304.208) [-301.807] (-300.568) (-303.015) * (-304.578) (-298.961) (-301.979) [-302.253] -- 0:00:20
659500 -- (-300.459) (-301.695) [-299.353] (-303.747) * (-302.582) (-299.337) [-300.675] (-303.225) -- 0:00:20
660000 -- (-298.606) [-302.407] (-298.866) (-301.737) * (-302.238) (-301.094) (-300.398) [-300.787] -- 0:00:20
Average standard deviation of split frequencies: 0.009588
660500 -- (-299.109) (-298.866) (-304.532) [-299.301] * (-300.572) [-306.486] (-301.987) (-302.983) -- 0:00:20
661000 -- (-299.573) (-301.513) (-301.247) [-298.802] * (-304.611) [-301.180] (-299.085) (-300.265) -- 0:00:20
661500 -- (-300.030) (-301.087) (-301.213) [-299.452] * (-299.582) [-299.528] (-298.505) (-301.163) -- 0:00:19
662000 -- [-298.943] (-303.926) (-302.404) (-300.071) * [-299.106] (-299.019) (-299.533) (-299.848) -- 0:00:19
662500 -- (-301.309) (-303.247) (-302.498) [-299.243] * (-299.450) [-299.651] (-299.870) (-299.771) -- 0:00:19
663000 -- (-300.594) (-301.201) (-300.864) [-301.365] * (-301.578) [-298.591] (-301.543) (-301.065) -- 0:00:20
663500 -- [-300.138] (-299.153) (-302.203) (-300.357) * (-300.606) (-299.556) (-299.389) [-302.972] -- 0:00:20
664000 -- (-299.165) (-299.757) (-299.396) [-303.266] * (-301.226) (-298.476) [-299.943] (-304.148) -- 0:00:20
664500 -- (-300.279) (-301.068) [-303.777] (-301.072) * (-300.933) (-299.307) (-300.751) [-303.821] -- 0:00:20
665000 -- (-299.652) (-298.858) (-299.271) [-300.149] * (-304.048) [-299.069] (-299.949) (-305.772) -- 0:00:20
Average standard deviation of split frequencies: 0.009618
665500 -- [-300.207] (-300.297) (-299.334) (-302.903) * (-307.001) (-299.833) (-302.603) [-300.104] -- 0:00:20
666000 -- (-299.920) (-302.275) [-300.227] (-301.132) * (-308.296) (-301.106) [-299.999] (-300.711) -- 0:00:20
666500 -- (-300.090) (-299.551) (-298.759) [-299.814] * (-300.331) (-302.676) [-299.062] (-298.927) -- 0:00:20
667000 -- (-300.662) (-300.623) [-302.308] (-298.946) * [-299.077] (-299.118) (-300.066) (-299.734) -- 0:00:19
667500 -- (-298.990) (-300.724) [-299.335] (-301.113) * [-298.383] (-300.607) (-300.158) (-299.799) -- 0:00:19
668000 -- [-301.241] (-298.460) (-302.509) (-303.039) * (-300.090) [-300.539] (-298.767) (-298.751) -- 0:00:19
668500 -- (-304.407) (-298.373) [-301.216] (-302.144) * [-300.432] (-301.293) (-303.257) (-299.224) -- 0:00:19
669000 -- (-299.753) (-298.721) [-302.041] (-300.612) * (-305.730) (-299.379) [-300.752] (-298.288) -- 0:00:19
669500 -- (-299.387) (-300.406) [-298.922] (-302.074) * (-300.794) (-302.600) (-299.871) [-300.307] -- 0:00:19
670000 -- [-300.053] (-304.528) (-299.855) (-298.983) * (-301.458) [-302.245] (-300.331) (-299.472) -- 0:00:19
Average standard deviation of split frequencies: 0.009592
670500 -- [-298.991] (-300.626) (-300.167) (-300.052) * (-300.454) (-301.864) (-302.031) [-298.964] -- 0:00:19
671000 -- (-299.508) [-301.008] (-299.621) (-298.571) * [-300.928] (-299.733) (-299.778) (-299.753) -- 0:00:19
671500 -- (-302.194) (-299.648) (-302.600) [-300.692] * (-299.379) (-300.201) (-299.431) [-298.407] -- 0:00:19
672000 -- (-298.723) (-300.387) (-300.502) [-300.127] * (-302.748) (-303.955) (-299.025) [-302.772] -- 0:00:19
672500 -- [-300.801] (-301.300) (-298.455) (-299.766) * [-299.666] (-301.772) (-299.920) (-304.260) -- 0:00:19
673000 -- (-298.973) (-299.677) (-299.740) [-300.244] * [-301.332] (-299.239) (-300.906) (-302.790) -- 0:00:19
673500 -- (-299.008) (-303.511) (-302.457) [-300.023] * (-300.256) (-302.572) (-304.807) [-300.331] -- 0:00:19
674000 -- (-302.198) [-304.485] (-305.986) (-299.434) * (-300.077) (-299.495) (-301.729) [-300.250] -- 0:00:19
674500 -- (-300.209) (-303.523) (-300.912) [-300.476] * (-299.027) (-300.067) [-299.830] (-302.493) -- 0:00:19
675000 -- (-299.422) [-298.337] (-301.121) (-299.835) * (-301.195) [-300.937] (-298.614) (-303.518) -- 0:00:19
Average standard deviation of split frequencies: 0.009845
675500 -- [-305.974] (-298.976) (-303.298) (-300.211) * (-302.383) (-298.103) [-299.160] (-300.615) -- 0:00:19
676000 -- [-304.043] (-298.599) (-302.374) (-308.367) * (-303.916) (-300.012) (-300.433) [-300.185] -- 0:00:19
676500 -- (-300.230) (-303.800) [-299.977] (-304.068) * (-304.095) [-301.681] (-299.882) (-301.145) -- 0:00:19
677000 -- (-298.712) (-302.705) (-299.508) [-300.518] * (-301.637) (-303.406) (-301.282) [-301.299] -- 0:00:19
677500 -- (-304.215) [-303.734] (-300.863) (-301.036) * (-302.351) (-300.366) (-301.945) [-302.619] -- 0:00:19
678000 -- (-300.941) (-300.233) (-298.699) [-299.265] * (-299.551) (-298.811) [-299.682] (-301.220) -- 0:00:18
678500 -- (-300.919) (-302.188) [-299.612] (-301.275) * [-298.604] (-298.455) (-302.347) (-299.957) -- 0:00:18
679000 -- (-298.492) (-302.940) (-302.603) [-299.257] * [-301.131] (-300.296) (-299.969) (-300.068) -- 0:00:18
679500 -- (-299.143) (-303.630) [-299.967] (-298.918) * [-300.235] (-298.796) (-300.308) (-302.893) -- 0:00:18
680000 -- [-299.363] (-301.204) (-300.120) (-298.767) * (-304.548) (-299.469) (-300.665) [-303.098] -- 0:00:19
Average standard deviation of split frequencies: 0.009696
680500 -- (-301.122) (-299.856) (-299.323) [-298.754] * [-299.298] (-303.809) (-300.025) (-301.050) -- 0:00:19
681000 -- (-304.918) (-300.252) [-304.077] (-298.848) * (-300.882) (-306.055) [-299.127] (-298.404) -- 0:00:19
681500 -- (-299.367) [-298.487] (-301.028) (-298.869) * [-302.193] (-309.558) (-298.552) (-298.984) -- 0:00:19
682000 -- (-298.348) (-298.645) [-301.870] (-299.026) * (-302.793) (-300.841) (-307.366) [-299.987] -- 0:00:19
682500 -- (-301.576) (-299.016) (-304.208) [-298.865] * [-300.827] (-299.806) (-304.105) (-300.645) -- 0:00:19
683000 -- (-301.656) [-299.609] (-300.071) (-300.025) * (-299.155) [-299.860] (-305.304) (-299.700) -- 0:00:19
683500 -- [-299.360] (-300.593) (-301.107) (-301.005) * (-299.336) [-300.293] (-306.230) (-303.085) -- 0:00:18
684000 -- [-300.139] (-300.498) (-302.899) (-303.223) * (-300.496) [-299.840] (-304.789) (-304.344) -- 0:00:18
684500 -- (-300.964) (-300.286) [-304.032] (-298.989) * (-299.701) (-298.751) [-309.538] (-298.558) -- 0:00:18
685000 -- (-299.085) (-302.197) [-302.021] (-299.936) * [-298.246] (-301.677) (-300.108) (-300.212) -- 0:00:18
Average standard deviation of split frequencies: 0.010186
685500 -- [-298.686] (-298.936) (-300.115) (-299.182) * (-302.705) [-299.080] (-299.484) (-301.441) -- 0:00:18
686000 -- (-305.293) [-299.409] (-300.513) (-301.409) * (-302.259) (-302.112) [-301.419] (-301.200) -- 0:00:18
686500 -- [-300.970] (-299.260) (-302.091) (-303.007) * (-299.946) [-302.117] (-301.508) (-304.313) -- 0:00:18
687000 -- (-299.220) [-302.914] (-300.083) (-306.685) * [-299.704] (-299.533) (-303.110) (-301.810) -- 0:00:18
687500 -- (-301.497) [-303.140] (-299.677) (-299.861) * (-301.802) [-300.449] (-299.684) (-301.479) -- 0:00:18
688000 -- [-298.714] (-299.706) (-299.296) (-302.667) * (-302.014) (-304.305) (-298.830) [-299.818] -- 0:00:18
688500 -- (-301.311) (-301.792) (-302.658) [-299.268] * [-301.200] (-301.720) (-300.866) (-300.937) -- 0:00:18
689000 -- (-299.192) [-302.745] (-302.945) (-302.377) * (-299.358) (-302.025) [-300.062] (-299.250) -- 0:00:18
689500 -- (-299.190) (-301.638) [-300.099] (-301.824) * [-304.946] (-300.692) (-302.026) (-298.969) -- 0:00:18
690000 -- (-301.957) (-300.744) [-300.149] (-300.775) * (-299.342) (-299.466) [-299.048] (-307.756) -- 0:00:18
Average standard deviation of split frequencies: 0.009598
690500 -- (-301.423) (-301.497) [-300.905] (-299.898) * [-298.454] (-299.008) (-299.867) (-299.871) -- 0:00:18
691000 -- (-303.111) (-299.553) (-300.637) [-298.695] * (-299.982) [-300.082] (-299.426) (-298.648) -- 0:00:18
691500 -- (-298.483) [-300.244] (-300.487) (-300.301) * (-301.887) (-301.472) (-301.721) [-300.490] -- 0:00:18
692000 -- (-299.132) (-304.776) [-299.509] (-299.711) * (-300.155) [-298.968] (-303.715) (-301.686) -- 0:00:18
692500 -- (-299.263) [-304.044] (-300.414) (-298.405) * (-299.073) (-299.320) (-300.043) [-302.084] -- 0:00:18
693000 -- (-303.103) (-302.315) (-302.456) [-301.324] * [-299.168] (-304.220) (-302.642) (-302.805) -- 0:00:18
693500 -- [-301.231] (-299.625) (-300.564) (-299.113) * [-299.762] (-305.005) (-302.516) (-302.607) -- 0:00:18
694000 -- [-299.269] (-303.147) (-300.201) (-299.793) * (-302.857) (-302.516) [-301.674] (-299.124) -- 0:00:18
694500 -- (-300.814) (-299.522) (-300.789) [-301.318] * (-302.687) (-302.060) [-301.339] (-298.900) -- 0:00:18
695000 -- (-299.078) (-299.686) [-299.687] (-299.134) * (-299.636) [-301.994] (-300.492) (-302.420) -- 0:00:17
Average standard deviation of split frequencies: 0.009567
695500 -- (-301.182) (-299.962) (-299.754) [-302.405] * [-301.436] (-301.413) (-303.279) (-303.407) -- 0:00:17
696000 -- (-302.508) (-303.181) [-303.869] (-299.032) * [-300.944] (-300.452) (-299.389) (-300.858) -- 0:00:17
696500 -- (-299.020) (-303.136) (-300.698) [-298.914] * (-299.860) [-302.209] (-305.526) (-306.978) -- 0:00:17
697000 -- [-302.090] (-300.138) (-302.584) (-301.999) * (-302.849) (-300.120) (-302.968) [-300.692] -- 0:00:17
697500 -- (-300.505) (-300.162) (-301.459) [-300.643] * [-300.878] (-302.114) (-300.895) (-300.263) -- 0:00:18
698000 -- [-301.104] (-299.300) (-303.408) (-304.109) * [-298.735] (-299.323) (-300.447) (-299.502) -- 0:00:18
698500 -- (-299.151) [-298.189] (-300.101) (-301.154) * (-300.801) [-302.585] (-299.647) (-298.623) -- 0:00:18
699000 -- (-305.486) [-300.531] (-300.832) (-304.535) * (-301.524) [-298.862] (-298.494) (-302.756) -- 0:00:18
699500 -- [-301.097] (-300.009) (-301.431) (-299.640) * (-301.331) (-300.274) (-299.676) [-299.360] -- 0:00:18
700000 -- (-301.430) (-298.969) [-301.374] (-300.149) * (-302.843) (-301.540) [-305.982] (-298.905) -- 0:00:18
Average standard deviation of split frequencies: 0.009545
700500 -- (-300.689) (-299.016) (-300.662) [-301.249] * (-299.583) (-302.667) [-299.796] (-301.291) -- 0:00:17
701000 -- (-303.538) (-300.378) [-301.812] (-298.565) * [-300.367] (-303.751) (-299.385) (-298.765) -- 0:00:17
701500 -- (-305.503) (-301.854) [-299.827] (-300.347) * (-298.893) (-301.789) [-300.260] (-298.824) -- 0:00:17
702000 -- [-300.077] (-301.591) (-300.428) (-299.266) * (-301.725) [-300.977] (-300.578) (-300.676) -- 0:00:17
702500 -- (-301.327) (-300.793) (-298.823) [-302.876] * (-299.857) (-302.580) (-299.235) [-301.092] -- 0:00:17
703000 -- (-300.818) (-304.629) (-300.355) [-302.918] * (-301.784) [-300.358] (-299.695) (-300.591) -- 0:00:17
703500 -- [-303.118] (-300.963) (-300.888) (-301.228) * [-300.307] (-300.157) (-303.206) (-301.189) -- 0:00:17
704000 -- (-301.501) (-302.219) [-302.677] (-298.816) * (-302.088) [-302.076] (-302.125) (-303.330) -- 0:00:17
704500 -- (-305.021) [-299.262] (-301.105) (-298.303) * (-302.738) [-301.317] (-300.388) (-300.082) -- 0:00:17
705000 -- (-301.967) (-301.716) (-300.360) [-298.612] * (-300.198) (-299.749) (-299.168) [-301.414] -- 0:00:17
Average standard deviation of split frequencies: 0.010308
705500 -- (-301.186) (-302.096) (-300.141) [-300.296] * [-298.319] (-300.105) (-299.980) (-301.900) -- 0:00:17
706000 -- [-300.310] (-301.056) (-300.572) (-301.781) * (-298.978) (-299.256) (-303.800) [-299.722] -- 0:00:17
706500 -- (-299.947) (-301.745) (-301.011) [-300.363] * (-298.851) (-299.381) (-299.537) [-298.744] -- 0:00:17
707000 -- (-299.068) (-300.683) (-300.078) [-303.273] * (-300.152) (-300.968) [-299.852] (-300.150) -- 0:00:17
707500 -- (-301.010) [-300.826] (-300.570) (-300.796) * [-300.511] (-300.229) (-300.530) (-299.755) -- 0:00:17
708000 -- (-300.376) [-299.582] (-300.305) (-300.992) * [-300.664] (-301.266) (-299.073) (-299.251) -- 0:00:17
708500 -- (-299.538) [-300.710] (-302.247) (-298.998) * (-299.367) [-303.333] (-301.749) (-301.605) -- 0:00:17
709000 -- (-299.488) (-300.159) (-299.679) [-299.058] * (-303.439) (-305.783) [-298.379] (-301.565) -- 0:00:17
709500 -- [-300.310] (-298.550) (-299.161) (-299.780) * [-299.876] (-300.856) (-298.852) (-302.352) -- 0:00:17
710000 -- [-299.441] (-301.783) (-302.459) (-299.839) * [-299.226] (-305.912) (-299.715) (-301.191) -- 0:00:17
Average standard deviation of split frequencies: 0.010489
710500 -- (-298.501) (-300.462) [-300.383] (-300.814) * [-301.777] (-301.803) (-300.018) (-299.150) -- 0:00:17
711000 -- [-298.480] (-300.714) (-300.338) (-307.222) * [-300.571] (-299.555) (-301.385) (-299.115) -- 0:00:17
711500 -- (-298.380) [-298.766] (-299.334) (-302.014) * [-300.933] (-299.025) (-301.538) (-298.701) -- 0:00:17
712000 -- (-299.871) (-300.110) [-298.982] (-299.536) * [-300.348] (-298.595) (-299.184) (-303.674) -- 0:00:16
712500 -- (-306.249) (-302.265) [-298.744] (-300.942) * (-302.306) [-300.298] (-298.985) (-302.699) -- 0:00:16
713000 -- (-301.031) (-300.583) (-299.847) [-300.149] * (-300.702) (-299.910) [-299.925] (-298.943) -- 0:00:16
713500 -- (-298.971) (-302.691) [-299.575] (-301.832) * (-299.803) (-305.492) (-300.238) [-299.468] -- 0:00:16
714000 -- [-299.143] (-300.612) (-300.820) (-301.415) * [-300.448] (-305.303) (-303.136) (-299.457) -- 0:00:16
714500 -- (-300.559) [-298.503] (-300.243) (-299.570) * (-299.852) [-306.745] (-300.132) (-299.381) -- 0:00:17
715000 -- (-300.856) (-298.380) [-298.748] (-301.465) * (-303.313) (-305.323) [-300.294] (-304.940) -- 0:00:17
Average standard deviation of split frequencies: 0.010987
715500 -- [-300.154] (-300.432) (-298.904) (-300.523) * (-301.489) (-304.411) [-301.857] (-299.903) -- 0:00:17
716000 -- (-299.433) (-300.077) (-299.060) [-301.141] * (-302.909) [-299.684] (-302.032) (-300.195) -- 0:00:17
716500 -- (-301.201) [-300.128] (-298.801) (-300.494) * (-298.618) [-304.072] (-298.842) (-299.528) -- 0:00:17
717000 -- [-301.910] (-304.592) (-300.887) (-300.362) * (-301.274) (-302.066) (-299.920) [-299.714] -- 0:00:16
717500 -- (-301.344) (-302.790) (-301.132) [-301.537] * (-298.385) (-299.042) (-300.696) [-299.577] -- 0:00:16
718000 -- (-300.600) [-301.319] (-304.456) (-302.001) * (-298.766) [-303.661] (-300.411) (-301.653) -- 0:00:16
718500 -- (-302.017) (-301.406) [-299.673] (-302.726) * [-300.165] (-305.344) (-303.248) (-299.453) -- 0:00:16
719000 -- (-302.209) (-303.560) (-303.189) [-300.188] * (-302.061) (-300.952) [-301.744] (-299.393) -- 0:00:16
719500 -- (-302.550) (-306.975) (-300.121) [-300.140] * [-304.421] (-300.470) (-300.114) (-301.123) -- 0:00:16
720000 -- (-302.918) (-306.165) (-299.498) [-298.986] * [-299.383] (-300.817) (-298.791) (-300.355) -- 0:00:16
Average standard deviation of split frequencies: 0.010916
720500 -- (-301.648) (-299.124) (-301.008) [-298.888] * (-299.372) (-300.361) [-300.079] (-299.066) -- 0:00:16
721000 -- [-300.279] (-301.232) (-300.984) (-299.579) * (-300.161) [-300.865] (-299.543) (-300.786) -- 0:00:16
721500 -- [-301.456] (-299.829) (-300.945) (-300.003) * (-301.265) [-304.867] (-300.213) (-304.440) -- 0:00:16
722000 -- (-298.609) (-299.080) (-298.970) [-301.460] * (-301.097) (-300.796) [-301.033] (-299.688) -- 0:00:16
722500 -- (-300.791) (-299.427) (-302.395) [-299.490] * (-301.040) (-302.590) (-301.854) [-299.142] -- 0:00:16
723000 -- (-298.830) [-303.967] (-299.435) (-299.558) * (-301.545) (-301.570) (-304.513) [-299.695] -- 0:00:16
723500 -- (-301.810) (-308.479) [-299.597] (-300.276) * (-299.039) (-298.576) (-303.843) [-300.473] -- 0:00:16
724000 -- [-301.124] (-300.625) (-298.294) (-300.384) * (-300.280) (-299.428) (-299.724) [-301.596] -- 0:00:16
724500 -- (-299.622) (-301.581) [-298.067] (-300.461) * (-299.856) (-299.597) [-300.037] (-298.616) -- 0:00:16
725000 -- (-298.609) [-299.395] (-298.709) (-298.233) * (-300.402) (-301.422) (-303.774) [-298.460] -- 0:00:16
Average standard deviation of split frequencies: 0.010795
725500 -- (-298.992) (-300.358) (-298.106) [-299.924] * (-298.684) [-301.108] (-300.993) (-300.325) -- 0:00:16
726000 -- (-302.503) (-305.193) [-298.599] (-301.435) * (-299.387) (-300.917) [-299.529] (-304.699) -- 0:00:16
726500 -- (-302.474) [-299.732] (-299.942) (-300.596) * (-300.147) [-299.144] (-301.069) (-300.297) -- 0:00:16
727000 -- [-302.451] (-300.923) (-300.709) (-299.579) * (-300.171) [-299.941] (-301.060) (-302.727) -- 0:00:16
727500 -- (-301.625) (-300.302) (-309.143) [-298.823] * (-300.049) (-300.583) (-303.505) [-298.551] -- 0:00:16
728000 -- (-303.854) (-300.252) (-299.125) [-299.785] * (-298.575) [-301.141] (-302.823) (-299.291) -- 0:00:16
728500 -- [-300.469] (-301.134) (-298.498) (-300.473) * (-301.651) (-300.127) (-300.349) [-301.733] -- 0:00:16
729000 -- (-302.602) [-299.722] (-299.766) (-300.528) * (-304.358) (-299.810) [-299.057] (-301.950) -- 0:00:15
729500 -- (-300.424) (-299.501) (-299.724) [-298.649] * (-301.401) [-298.503] (-304.836) (-301.686) -- 0:00:15
730000 -- (-304.309) (-302.985) [-298.692] (-302.781) * (-300.284) [-299.552] (-300.824) (-301.505) -- 0:00:15
Average standard deviation of split frequencies: 0.010847
730500 -- (-302.545) (-299.928) (-300.713) [-299.472] * (-301.674) (-304.206) (-302.057) [-298.868] -- 0:00:15
731000 -- (-300.228) [-301.431] (-305.405) (-302.652) * [-298.590] (-301.417) (-299.821) (-299.505) -- 0:00:15
731500 -- (-298.696) (-301.964) [-300.959] (-301.275) * [-299.935] (-302.066) (-301.907) (-301.671) -- 0:00:15
732000 -- (-300.176) (-301.631) [-299.486] (-298.589) * (-303.236) (-304.071) [-304.871] (-302.786) -- 0:00:16
732500 -- (-301.474) (-298.507) [-303.091] (-299.147) * (-299.508) (-299.300) (-300.775) [-300.887] -- 0:00:16
733000 -- [-301.630] (-300.247) (-300.780) (-302.525) * [-302.953] (-302.387) (-300.514) (-301.297) -- 0:00:16
733500 -- [-300.441] (-300.644) (-303.234) (-299.592) * (-300.685) (-302.713) [-299.457] (-299.490) -- 0:00:15
734000 -- (-302.100) [-299.096] (-299.835) (-298.201) * [-299.857] (-300.331) (-298.689) (-301.064) -- 0:00:15
734500 -- (-301.699) (-299.217) [-300.516] (-301.106) * (-301.827) (-300.176) [-298.753] (-303.035) -- 0:00:15
735000 -- [-299.568] (-299.745) (-302.680) (-304.166) * [-305.060] (-302.284) (-299.657) (-300.609) -- 0:00:15
Average standard deviation of split frequencies: 0.010848
735500 -- [-299.776] (-299.980) (-298.843) (-300.300) * (-304.876) (-298.896) (-303.231) [-298.897] -- 0:00:15
736000 -- (-300.892) (-300.738) (-299.559) [-299.040] * (-300.183) (-298.836) (-301.616) [-298.819] -- 0:00:15
736500 -- (-303.685) (-301.952) [-299.459] (-300.702) * [-304.291] (-298.374) (-299.630) (-301.535) -- 0:00:15
737000 -- (-302.019) [-299.916] (-301.539) (-298.656) * (-299.163) [-301.022] (-299.134) (-299.372) -- 0:00:15
737500 -- (-300.451) [-299.266] (-298.802) (-299.595) * [-301.266] (-300.094) (-299.265) (-302.244) -- 0:00:15
738000 -- [-300.414] (-302.510) (-300.022) (-302.783) * [-300.800] (-301.404) (-300.177) (-299.686) -- 0:00:15
738500 -- (-300.069) (-300.191) (-302.625) [-300.226] * [-299.068] (-301.490) (-302.441) (-298.876) -- 0:00:15
739000 -- (-301.148) (-302.785) (-304.036) [-300.282] * (-298.906) (-303.015) (-304.480) [-300.051] -- 0:00:15
739500 -- (-299.082) (-301.949) [-299.023] (-298.560) * (-299.223) (-301.089) (-298.172) [-300.822] -- 0:00:15
740000 -- (-299.439) (-300.937) [-298.435] (-298.636) * (-299.705) [-299.794] (-301.983) (-300.303) -- 0:00:15
Average standard deviation of split frequencies: 0.010899
740500 -- [-298.950] (-299.251) (-301.002) (-300.289) * (-299.207) [-299.257] (-298.855) (-298.391) -- 0:00:15
741000 -- (-301.266) (-308.271) (-302.499) [-298.707] * (-303.885) (-300.653) [-300.277] (-300.111) -- 0:00:15
741500 -- (-299.333) (-301.026) (-299.937) [-298.325] * (-301.264) (-306.437) (-300.007) [-302.081] -- 0:00:15
742000 -- (-303.433) (-304.781) (-301.342) [-300.697] * (-300.471) (-300.492) (-299.003) [-298.980] -- 0:00:15
742500 -- (-300.844) [-300.388] (-298.949) (-302.755) * [-299.083] (-299.361) (-300.731) (-301.042) -- 0:00:15
743000 -- [-299.445] (-300.605) (-301.677) (-298.738) * [-303.970] (-301.432) (-300.304) (-300.839) -- 0:00:15
743500 -- (-298.710) [-298.711] (-299.944) (-298.702) * (-301.555) [-302.684] (-299.895) (-302.053) -- 0:00:15
744000 -- (-298.904) (-300.455) (-299.822) [-299.576] * [-300.481] (-302.097) (-299.566) (-306.711) -- 0:00:15
744500 -- (-300.768) (-301.208) [-300.002] (-299.695) * (-302.193) (-298.557) [-299.401] (-301.349) -- 0:00:15
745000 -- (-299.459) [-300.445] (-303.170) (-298.758) * (-304.321) (-300.075) (-301.752) [-299.166] -- 0:00:15
Average standard deviation of split frequencies: 0.010505
745500 -- (-299.439) [-300.428] (-300.612) (-300.019) * [-299.003] (-301.273) (-301.369) (-301.089) -- 0:00:15
746000 -- (-299.889) (-301.983) (-300.678) [-299.207] * [-299.476] (-299.674) (-298.490) (-300.751) -- 0:00:14
746500 -- (-307.413) (-301.447) [-303.910] (-299.697) * [-301.340] (-298.474) (-299.333) (-301.354) -- 0:00:14
747000 -- (-302.172) (-300.696) [-299.748] (-298.524) * [-298.804] (-299.119) (-299.514) (-299.372) -- 0:00:14
747500 -- (-303.029) (-299.916) (-307.715) [-299.496] * (-299.366) [-299.220] (-300.868) (-299.087) -- 0:00:14
748000 -- (-305.099) [-300.956] (-301.546) (-300.086) * (-303.202) (-299.518) [-302.260] (-300.161) -- 0:00:14
748500 -- [-300.049] (-301.264) (-299.673) (-298.601) * (-298.908) (-298.703) [-300.180] (-301.962) -- 0:00:14
749000 -- (-299.399) (-302.201) [-303.564] (-298.559) * (-299.733) [-299.223] (-300.459) (-302.749) -- 0:00:15
749500 -- (-299.216) (-299.972) (-301.001) [-299.728] * (-299.141) (-300.192) (-299.109) [-299.632] -- 0:00:15
750000 -- (-300.792) (-300.940) [-299.370] (-300.537) * (-300.684) (-299.244) [-301.083] (-302.359) -- 0:00:15
Average standard deviation of split frequencies: 0.009694
750500 -- (-301.599) [-299.057] (-299.631) (-299.626) * (-298.516) [-299.951] (-299.647) (-300.073) -- 0:00:14
751000 -- (-305.076) [-300.535] (-300.126) (-302.085) * (-298.574) (-304.995) [-300.847] (-307.165) -- 0:00:14
751500 -- [-300.982] (-300.912) (-300.724) (-304.910) * (-298.309) [-299.154] (-300.433) (-302.445) -- 0:00:14
752000 -- [-298.797] (-301.481) (-299.349) (-300.205) * (-299.239) (-305.519) [-299.697] (-301.418) -- 0:00:14
752500 -- (-300.458) (-301.628) (-305.804) [-302.385] * (-304.314) (-300.245) [-302.178] (-301.869) -- 0:00:14
753000 -- (-300.811) (-306.217) [-300.924] (-302.893) * (-302.140) (-298.580) (-301.323) [-298.994] -- 0:00:14
753500 -- (-300.892) (-303.431) [-299.526] (-299.208) * [-299.337] (-300.560) (-300.347) (-298.690) -- 0:00:14
754000 -- (-300.775) (-298.961) (-298.547) [-299.914] * (-302.490) (-299.752) (-301.331) [-298.404] -- 0:00:14
754500 -- [-298.780] (-301.424) (-298.829) (-299.716) * (-301.530) [-298.818] (-299.696) (-301.299) -- 0:00:14
755000 -- (-298.485) (-300.959) (-299.442) [-302.173] * (-302.480) (-301.141) [-298.892] (-299.501) -- 0:00:14
Average standard deviation of split frequencies: 0.009977
755500 -- [-299.910] (-299.062) (-298.694) (-302.600) * (-302.841) (-298.837) (-298.467) [-300.432] -- 0:00:14
756000 -- (-298.884) [-304.579] (-298.815) (-302.872) * (-304.850) (-301.665) [-300.812] (-302.541) -- 0:00:14
756500 -- [-299.404] (-305.875) (-299.811) (-298.244) * [-298.935] (-299.749) (-300.368) (-301.834) -- 0:00:14
757000 -- (-298.828) (-302.972) (-304.631) [-300.919] * (-300.921) [-298.585] (-302.148) (-300.196) -- 0:00:14
757500 -- (-298.556) (-300.131) (-302.992) [-301.707] * (-300.352) (-304.929) (-299.404) [-298.758] -- 0:00:14
758000 -- [-298.808] (-300.753) (-301.950) (-299.834) * (-303.139) [-302.124] (-300.668) (-302.474) -- 0:00:14
758500 -- (-301.080) (-301.303) [-298.485] (-299.274) * (-302.337) (-300.302) [-299.235] (-299.696) -- 0:00:14
759000 -- (-300.377) (-303.128) [-299.239] (-300.210) * [-302.463] (-301.237) (-300.574) (-301.570) -- 0:00:14
759500 -- (-304.159) [-298.902] (-300.229) (-299.496) * (-301.176) (-301.715) (-301.452) [-300.534] -- 0:00:14
760000 -- (-300.479) [-299.007] (-299.473) (-302.807) * (-301.791) [-304.322] (-300.389) (-299.658) -- 0:00:14
Average standard deviation of split frequencies: 0.009709
760500 -- (-302.286) (-301.256) (-300.265) [-303.968] * (-301.907) (-301.188) (-299.594) [-298.814] -- 0:00:14
761000 -- (-301.950) (-301.365) (-299.536) [-300.753] * (-301.760) [-300.381] (-301.118) (-301.236) -- 0:00:14
761500 -- [-298.926] (-300.416) (-301.985) (-299.986) * [-299.904] (-298.951) (-300.094) (-298.882) -- 0:00:14
762000 -- [-301.722] (-300.322) (-299.452) (-298.497) * (-298.790) [-301.834] (-298.916) (-301.190) -- 0:00:14
762500 -- (-302.747) (-301.654) [-299.790] (-303.104) * (-299.558) (-298.274) (-301.594) [-302.996] -- 0:00:14
763000 -- (-299.783) (-305.260) [-300.311] (-303.919) * (-300.253) [-298.669] (-301.593) (-301.440) -- 0:00:13
763500 -- (-300.410) (-300.635) (-298.655) [-299.283] * (-304.272) (-300.369) (-299.756) [-298.477] -- 0:00:13
764000 -- [-299.768] (-298.588) (-300.898) (-302.312) * (-300.328) (-301.982) [-299.942] (-303.767) -- 0:00:13
764500 -- [-300.178] (-302.176) (-301.791) (-303.127) * [-300.356] (-304.630) (-300.670) (-301.139) -- 0:00:13
765000 -- [-300.719] (-302.107) (-300.287) (-301.874) * (-302.410) (-302.275) (-302.181) [-299.576] -- 0:00:13
Average standard deviation of split frequencies: 0.009477
765500 -- [-299.043] (-298.941) (-300.460) (-299.416) * (-303.900) (-298.669) (-304.539) [-302.210] -- 0:00:13
766000 -- (-299.513) [-298.328] (-299.313) (-301.087) * (-300.245) [-299.548] (-302.692) (-299.679) -- 0:00:14
766500 -- [-303.285] (-300.646) (-300.289) (-300.048) * (-299.127) [-298.934] (-302.496) (-302.061) -- 0:00:14
767000 -- (-300.681) (-301.036) [-298.651] (-301.202) * (-300.970) (-299.218) (-300.800) [-303.645] -- 0:00:13
767500 -- [-300.056] (-298.884) (-300.665) (-301.414) * [-299.287] (-299.418) (-299.824) (-302.042) -- 0:00:13
768000 -- [-301.522] (-301.854) (-299.945) (-301.223) * (-303.781) (-306.546) [-300.615] (-298.943) -- 0:00:13
768500 -- (-299.172) (-306.243) [-302.908] (-301.664) * (-300.636) [-300.343] (-301.066) (-301.461) -- 0:00:13
769000 -- (-300.856) [-302.257] (-302.382) (-299.333) * (-302.281) (-301.870) (-306.402) [-303.534] -- 0:00:13
769500 -- [-301.181] (-303.481) (-299.954) (-298.885) * (-300.824) (-301.256) (-303.969) [-299.653] -- 0:00:13
770000 -- (-299.312) (-301.744) (-299.318) [-300.384] * [-300.666] (-300.541) (-300.661) (-299.762) -- 0:00:13
Average standard deviation of split frequencies: 0.009338
770500 -- (-301.193) [-299.971] (-299.490) (-298.532) * (-300.970) [-300.247] (-300.234) (-298.312) -- 0:00:13
771000 -- (-300.059) (-306.274) (-298.960) [-302.272] * (-301.047) (-300.047) (-306.784) [-299.374] -- 0:00:13
771500 -- (-301.284) (-303.076) [-304.617] (-301.590) * [-298.653] (-303.221) (-304.038) (-301.897) -- 0:00:13
772000 -- (-300.910) (-301.392) [-299.358] (-298.607) * [-301.293] (-303.279) (-303.315) (-300.082) -- 0:00:13
772500 -- (-303.533) (-302.719) [-299.737] (-300.672) * (-300.583) (-303.096) (-300.579) [-302.304] -- 0:00:13
773000 -- [-300.640] (-299.523) (-300.747) (-303.267) * (-301.986) [-300.339] (-300.106) (-300.298) -- 0:00:13
773500 -- (-303.120) (-300.159) [-302.325] (-306.419) * (-299.048) (-307.137) (-301.434) [-298.858] -- 0:00:13
774000 -- (-300.737) (-302.858) (-300.992) [-302.321] * (-302.657) (-301.698) [-300.159] (-298.681) -- 0:00:13
774500 -- [-301.709] (-298.780) (-299.239) (-305.051) * (-304.312) (-302.129) (-300.134) [-300.583] -- 0:00:13
775000 -- (-298.785) [-298.589] (-299.227) (-300.235) * (-299.638) (-302.709) (-301.322) [-301.251] -- 0:00:13
Average standard deviation of split frequencies: 0.009598
775500 -- (-298.671) [-301.382] (-299.090) (-301.226) * (-301.194) (-300.461) [-301.137] (-304.662) -- 0:00:13
776000 -- (-298.328) (-298.575) [-300.320] (-302.356) * (-299.227) (-300.995) (-298.708) [-300.029] -- 0:00:13
776500 -- [-299.128] (-298.463) (-304.211) (-299.300) * (-300.628) (-304.559) (-299.070) [-298.957] -- 0:00:13
777000 -- (-299.853) (-301.556) [-301.841] (-299.217) * (-300.782) (-300.326) [-299.012] (-301.050) -- 0:00:13
777500 -- (-298.638) (-299.623) [-300.499] (-299.049) * (-304.586) (-302.147) [-303.622] (-300.394) -- 0:00:13
778000 -- [-298.999] (-300.937) (-302.632) (-299.177) * (-301.907) (-300.510) [-299.482] (-299.591) -- 0:00:13
778500 -- (-302.819) [-299.968] (-301.621) (-299.140) * (-301.097) (-302.408) (-302.674) [-301.272] -- 0:00:13
779000 -- (-301.684) (-301.028) [-300.327] (-299.091) * [-301.041] (-300.580) (-299.534) (-303.356) -- 0:00:13
779500 -- (-303.663) (-301.103) [-298.492] (-301.484) * [-300.520] (-301.733) (-304.180) (-302.618) -- 0:00:13
780000 -- [-299.961] (-301.839) (-304.155) (-301.061) * (-303.288) (-302.109) (-301.898) [-302.980] -- 0:00:12
Average standard deviation of split frequencies: 0.009058
780500 -- (-301.597) (-305.002) [-298.924] (-300.000) * (-300.703) [-298.581] (-298.291) (-300.757) -- 0:00:12
781000 -- [-299.442] (-300.674) (-298.922) (-299.992) * [-298.823] (-299.341) (-305.554) (-298.313) -- 0:00:12
781500 -- [-301.870] (-300.219) (-299.309) (-299.938) * (-299.840) [-298.571] (-301.018) (-302.044) -- 0:00:12
782000 -- (-302.165) [-299.938] (-298.990) (-299.736) * (-298.692) (-302.459) [-299.675] (-302.615) -- 0:00:12
782500 -- [-301.057] (-298.918) (-301.315) (-302.820) * (-302.358) [-299.476] (-300.742) (-303.256) -- 0:00:12
783000 -- (-300.467) [-300.150] (-303.491) (-300.775) * (-302.954) (-298.143) (-301.845) [-304.106] -- 0:00:12
783500 -- (-299.745) [-302.748] (-301.653) (-299.793) * (-302.608) (-300.424) (-300.706) [-298.194] -- 0:00:12
784000 -- [-301.974] (-301.495) (-301.189) (-298.716) * (-303.426) (-301.184) (-299.081) [-299.433] -- 0:00:12
784500 -- (-300.778) (-298.945) [-300.617] (-301.886) * [-302.219] (-305.139) (-300.846) (-299.607) -- 0:00:12
785000 -- (-304.229) (-299.385) (-301.548) [-299.790] * (-303.240) [-304.028] (-299.248) (-300.153) -- 0:00:12
Average standard deviation of split frequencies: 0.008876
785500 -- [-301.925] (-299.989) (-298.520) (-302.638) * (-299.430) (-300.157) [-298.749] (-300.741) -- 0:00:12
786000 -- [-303.923] (-303.201) (-301.802) (-302.113) * (-301.807) (-300.498) (-301.295) [-302.894] -- 0:00:12
786500 -- (-299.573) [-300.845] (-303.559) (-303.270) * (-299.089) (-299.945) [-301.788] (-298.698) -- 0:00:12
787000 -- (-300.845) [-303.930] (-298.998) (-300.236) * (-299.580) (-300.534) (-299.728) [-300.257] -- 0:00:12
787500 -- (-303.911) (-300.321) [-302.213] (-300.760) * (-304.097) (-300.177) (-299.883) [-300.102] -- 0:00:12
788000 -- (-299.201) (-300.068) (-303.219) [-303.087] * (-302.772) (-302.691) (-298.480) [-299.284] -- 0:00:12
788500 -- (-303.893) [-298.562] (-300.926) (-302.797) * (-301.281) (-298.685) (-301.523) [-299.084] -- 0:00:12
789000 -- (-302.319) [-298.836] (-299.757) (-300.865) * (-302.830) [-299.265] (-306.149) (-300.036) -- 0:00:12
789500 -- [-299.201] (-302.427) (-300.454) (-302.299) * (-304.108) [-299.034] (-303.108) (-299.955) -- 0:00:12
790000 -- [-299.629] (-303.628) (-301.636) (-301.828) * (-298.529) [-298.959] (-302.195) (-304.645) -- 0:00:12
Average standard deviation of split frequencies: 0.008744
790500 -- [-299.643] (-304.170) (-302.303) (-299.607) * (-299.997) (-300.341) [-300.925] (-301.903) -- 0:00:12
791000 -- (-303.379) [-301.434] (-298.924) (-300.824) * (-301.055) [-298.747] (-302.533) (-303.874) -- 0:00:12
791500 -- (-299.973) (-306.642) (-307.443) [-301.265] * (-299.107) [-300.593] (-300.008) (-299.710) -- 0:00:12
792000 -- (-301.491) [-298.864] (-301.487) (-299.678) * (-299.789) (-303.911) [-299.221] (-300.209) -- 0:00:12
792500 -- (-300.463) [-299.515] (-304.224) (-300.777) * [-298.088] (-298.883) (-298.318) (-302.671) -- 0:00:12
793000 -- [-300.541] (-302.219) (-302.716) (-304.046) * (-298.606) [-299.941] (-304.614) (-300.270) -- 0:00:12
793500 -- [-299.634] (-301.981) (-300.358) (-301.231) * (-298.684) [-301.020] (-308.114) (-298.485) -- 0:00:12
794000 -- [-299.192] (-303.397) (-299.814) (-301.835) * [-301.579] (-300.145) (-300.157) (-301.424) -- 0:00:12
794500 -- [-299.203] (-298.985) (-300.132) (-299.330) * (-300.678) [-301.518] (-299.614) (-300.903) -- 0:00:12
795000 -- [-300.490] (-299.355) (-301.936) (-301.276) * [-299.990] (-301.670) (-299.686) (-298.418) -- 0:00:12
Average standard deviation of split frequencies: 0.008133
795500 -- (-299.503) [-299.633] (-298.868) (-301.379) * (-302.576) [-301.643] (-298.384) (-299.620) -- 0:00:12
796000 -- (-299.217) (-299.423) (-301.069) [-299.564] * [-301.515] (-301.913) (-301.601) (-298.930) -- 0:00:12
796500 -- (-299.251) (-299.766) (-300.407) [-300.023] * (-298.931) (-301.881) [-299.224] (-299.277) -- 0:00:12
797000 -- (-299.679) [-299.085] (-303.847) (-301.513) * (-299.317) (-300.199) (-301.282) [-301.021] -- 0:00:11
797500 -- (-298.297) (-299.400) [-300.785] (-303.143) * (-300.351) (-299.742) [-300.668] (-298.155) -- 0:00:11
798000 -- (-299.317) [-300.551] (-299.758) (-302.331) * (-299.888) (-298.985) (-299.456) [-301.001] -- 0:00:11
798500 -- [-299.285] (-299.634) (-299.418) (-304.362) * [-300.204] (-300.552) (-298.707) (-302.353) -- 0:00:11
799000 -- (-300.405) [-300.186] (-298.826) (-301.278) * (-298.274) (-299.107) (-300.706) [-298.803] -- 0:00:11
799500 -- (-299.683) (-303.200) [-300.520] (-306.176) * [-301.118] (-300.544) (-300.250) (-301.886) -- 0:00:11
800000 -- [-298.888] (-299.044) (-302.176) (-299.804) * [-298.610] (-300.167) (-301.184) (-300.113) -- 0:00:11
Average standard deviation of split frequencies: 0.008086
800500 -- (-304.029) (-302.098) (-299.436) [-298.954] * (-300.550) (-300.144) [-298.461] (-299.905) -- 0:00:11
801000 -- (-299.094) (-300.755) [-299.151] (-301.225) * (-300.461) [-300.018] (-299.363) (-299.500) -- 0:00:11
801500 -- (-299.921) (-301.337) (-301.181) [-298.130] * (-300.655) (-300.495) [-301.870] (-304.285) -- 0:00:11
802000 -- (-301.855) [-300.543] (-302.239) (-298.397) * (-302.813) (-300.084) [-300.113] (-299.347) -- 0:00:11
802500 -- (-302.512) (-299.693) [-301.582] (-299.784) * (-302.191) (-301.488) (-299.580) [-298.687] -- 0:00:11
803000 -- (-298.820) [-301.639] (-302.929) (-302.731) * (-302.820) (-306.012) [-299.197] (-299.426) -- 0:00:11
803500 -- (-299.567) [-302.333] (-299.696) (-304.988) * (-299.960) (-301.578) (-302.828) [-299.187] -- 0:00:11
804000 -- (-299.572) [-300.578] (-302.710) (-299.785) * (-301.692) (-299.839) [-299.950] (-300.190) -- 0:00:11
804500 -- [-300.765] (-298.729) (-300.593) (-298.471) * (-302.237) (-300.600) [-299.395] (-299.547) -- 0:00:11
805000 -- (-301.633) (-300.447) [-301.843] (-300.635) * (-301.134) (-299.043) [-298.325] (-303.164) -- 0:00:11
Average standard deviation of split frequencies: 0.007720
805500 -- (-303.397) (-300.104) [-301.366] (-300.978) * (-304.249) [-298.967] (-300.386) (-301.314) -- 0:00:11
806000 -- (-300.960) [-299.157] (-300.669) (-301.409) * [-300.605] (-299.291) (-299.479) (-299.543) -- 0:00:11
806500 -- (-301.802) (-299.989) (-302.241) [-301.049] * [-299.627] (-298.074) (-301.641) (-299.746) -- 0:00:11
807000 -- (-301.083) [-300.372] (-302.401) (-300.306) * (-298.322) (-299.196) [-302.366] (-298.772) -- 0:00:11
807500 -- (-300.768) (-298.629) (-301.168) [-299.068] * (-299.062) (-298.175) (-300.055) [-299.936] -- 0:00:11
808000 -- (-302.293) [-300.938] (-301.468) (-298.525) * (-298.360) [-298.721] (-305.002) (-301.275) -- 0:00:11
808500 -- (-302.120) (-300.804) [-311.428] (-301.602) * (-298.500) (-299.687) [-306.024] (-299.271) -- 0:00:11
809000 -- [-301.657] (-301.531) (-299.133) (-300.805) * [-303.942] (-300.167) (-301.605) (-299.878) -- 0:00:11
809500 -- (-302.515) (-300.223) [-303.749] (-299.312) * (-299.671) (-299.609) (-300.101) [-299.711] -- 0:00:11
810000 -- (-300.708) (-301.992) [-303.885] (-305.641) * (-302.652) (-301.234) [-299.522] (-300.858) -- 0:00:11
Average standard deviation of split frequencies: 0.007521
810500 -- [-300.168] (-300.166) (-306.667) (-304.660) * (-299.774) (-299.241) (-298.561) [-300.201] -- 0:00:11
811000 -- [-301.671] (-298.589) (-302.064) (-306.432) * (-298.692) [-300.038] (-302.458) (-299.834) -- 0:00:11
811500 -- [-299.345] (-300.462) (-299.044) (-303.432) * [-299.595] (-300.586) (-299.529) (-300.939) -- 0:00:11
812000 -- (-301.550) (-302.091) (-298.607) [-302.141] * (-302.060) [-301.961] (-299.952) (-299.182) -- 0:00:11
812500 -- (-301.827) [-302.676] (-301.282) (-304.552) * (-304.965) [-299.407] (-299.644) (-299.206) -- 0:00:11
813000 -- (-301.319) [-301.558] (-308.390) (-302.272) * [-302.105] (-300.387) (-301.206) (-300.670) -- 0:00:11
813500 -- (-303.681) (-300.274) (-302.200) [-300.556] * (-302.804) (-298.894) (-307.944) [-300.739] -- 0:00:11
814000 -- (-300.373) (-300.458) (-303.561) [-300.977] * (-302.536) [-302.269] (-299.929) (-299.765) -- 0:00:10
814500 -- (-299.545) (-301.102) (-302.599) [-301.220] * (-301.149) (-303.387) [-299.107] (-299.807) -- 0:00:10
815000 -- (-302.124) (-299.763) [-298.596] (-299.966) * (-307.509) [-298.248] (-300.361) (-299.624) -- 0:00:10
Average standard deviation of split frequencies: 0.007664
815500 -- (-301.558) (-305.226) [-298.566] (-300.731) * [-299.132] (-300.028) (-302.523) (-301.357) -- 0:00:10
816000 -- (-302.507) [-300.998] (-301.726) (-299.963) * (-305.145) (-301.142) [-302.157] (-299.971) -- 0:00:10
816500 -- (-299.617) (-300.108) [-298.702] (-299.913) * (-300.268) [-299.027] (-301.183) (-300.744) -- 0:00:10
817000 -- (-302.468) (-301.554) (-299.957) [-298.429] * (-299.747) [-300.549] (-301.176) (-301.105) -- 0:00:10
817500 -- (-299.525) [-300.640] (-300.435) (-299.341) * (-301.878) [-299.978] (-307.216) (-301.366) -- 0:00:10
818000 -- (-302.763) (-298.290) (-304.292) [-299.448] * (-299.829) (-300.850) [-303.798] (-300.478) -- 0:00:10
818500 -- (-303.913) (-301.978) (-303.423) [-300.443] * [-299.104] (-307.593) (-299.614) (-298.966) -- 0:00:10
819000 -- (-301.359) (-302.911) (-300.282) [-298.015] * (-299.642) (-300.903) (-299.644) [-299.643] -- 0:00:10
819500 -- (-303.791) (-299.799) (-299.826) [-301.536] * [-301.196] (-300.314) (-300.964) (-302.574) -- 0:00:10
820000 -- (-299.481) (-305.261) [-298.936] (-299.784) * [-302.992] (-305.403) (-299.846) (-307.986) -- 0:00:10
Average standard deviation of split frequencies: 0.007965
820500 -- (-301.246) [-301.325] (-299.349) (-299.461) * (-299.184) [-308.196] (-298.365) (-303.623) -- 0:00:10
821000 -- (-302.488) [-303.581] (-302.011) (-301.001) * (-307.081) (-302.119) [-299.189] (-301.988) -- 0:00:10
821500 -- (-302.133) (-301.418) (-303.773) [-299.042] * [-300.069] (-303.029) (-299.192) (-300.636) -- 0:00:10
822000 -- (-300.840) (-299.351) (-300.964) [-304.921] * [-303.052] (-300.696) (-300.653) (-299.792) -- 0:00:10
822500 -- [-301.748] (-300.922) (-300.200) (-301.201) * (-301.549) (-301.288) (-300.174) [-300.356] -- 0:00:10
823000 -- (-302.314) (-300.843) [-299.648] (-301.754) * (-300.796) [-299.819] (-300.796) (-301.929) -- 0:00:10
823500 -- (-299.737) (-299.463) (-301.705) [-299.285] * (-298.496) [-299.203] (-304.226) (-300.847) -- 0:00:10
824000 -- (-301.449) [-298.376] (-298.787) (-300.096) * [-298.378] (-299.344) (-301.907) (-302.972) -- 0:00:10
824500 -- (-302.737) (-298.857) (-298.887) [-304.948] * [-300.821] (-300.601) (-298.277) (-304.863) -- 0:00:10
825000 -- (-299.499) [-303.539] (-311.330) (-302.431) * (-300.871) [-304.112] (-300.270) (-302.995) -- 0:00:10
Average standard deviation of split frequencies: 0.008218
825500 -- (-306.471) (-301.903) (-300.709) [-300.453] * (-302.080) (-300.675) [-298.860] (-301.022) -- 0:00:10
826000 -- (-299.705) (-301.634) [-298.790] (-300.323) * (-299.131) (-305.372) (-301.859) [-300.270] -- 0:00:10
826500 -- [-299.915] (-300.541) (-299.856) (-304.756) * (-299.338) [-300.932] (-304.929) (-301.786) -- 0:00:10
827000 -- (-300.152) [-302.135] (-299.538) (-303.773) * (-300.952) [-300.220] (-303.495) (-303.603) -- 0:00:10
827500 -- [-298.447] (-301.161) (-303.301) (-300.474) * [-299.971] (-300.547) (-299.517) (-299.482) -- 0:00:10
828000 -- (-300.040) (-301.008) (-301.952) [-299.409] * (-300.419) (-299.490) (-301.951) [-299.204] -- 0:00:10
828500 -- [-300.618] (-299.328) (-301.334) (-300.177) * (-303.104) (-299.175) (-306.450) [-300.707] -- 0:00:10
829000 -- (-303.554) (-300.668) (-301.698) [-301.862] * (-301.526) (-298.918) [-298.548] (-301.096) -- 0:00:10
829500 -- (-301.964) (-299.834) [-300.392] (-298.262) * [-299.182] (-301.630) (-300.532) (-299.190) -- 0:00:10
830000 -- (-306.232) (-300.725) (-303.526) [-299.817] * [-300.121] (-299.344) (-299.380) (-298.571) -- 0:00:10
Average standard deviation of split frequencies: 0.007907
830500 -- [-300.534] (-302.238) (-299.877) (-298.248) * (-298.877) [-299.372] (-299.552) (-301.379) -- 0:00:10
831000 -- (-301.277) [-298.232] (-302.130) (-301.847) * (-298.427) (-298.663) [-301.017] (-298.488) -- 0:00:09
831500 -- (-300.083) (-299.868) (-306.115) [-299.328] * [-298.391] (-301.774) (-304.521) (-300.368) -- 0:00:09
832000 -- (-302.226) (-299.886) [-300.315] (-301.716) * (-299.718) [-300.028] (-298.280) (-300.764) -- 0:00:09
832500 -- (-299.619) (-298.147) (-299.470) [-304.025] * (-304.212) [-300.854] (-299.693) (-302.898) -- 0:00:09
833000 -- (-298.989) (-298.327) (-303.656) [-302.919] * (-301.598) (-301.365) [-299.535] (-298.857) -- 0:00:09
833500 -- (-302.031) (-298.353) (-300.761) [-299.694] * [-301.416] (-301.455) (-300.645) (-302.963) -- 0:00:09
834000 -- (-300.717) (-300.477) [-299.351] (-299.677) * (-303.299) [-299.987] (-302.699) (-300.211) -- 0:00:09
834500 -- [-300.263] (-299.130) (-301.693) (-300.736) * [-302.625] (-299.002) (-302.434) (-301.199) -- 0:00:09
835000 -- (-300.977) [-299.734] (-300.875) (-301.146) * [-303.501] (-301.674) (-300.635) (-298.847) -- 0:00:09
Average standard deviation of split frequencies: 0.007782
835500 -- (-300.389) [-299.332] (-300.801) (-302.516) * [-302.969] (-300.897) (-302.084) (-300.312) -- 0:00:09
836000 -- (-298.563) [-304.120] (-301.872) (-301.330) * (-301.167) [-301.534] (-302.580) (-300.758) -- 0:00:09
836500 -- (-299.543) [-303.023] (-299.457) (-298.683) * (-301.449) (-299.766) (-301.309) [-302.249] -- 0:00:09
837000 -- (-300.371) [-300.454] (-298.911) (-299.873) * (-299.062) [-300.836] (-301.621) (-299.528) -- 0:00:09
837500 -- (-301.018) (-298.263) (-302.292) [-304.831] * (-300.263) (-300.428) [-299.961] (-300.389) -- 0:00:09
838000 -- [-300.457] (-299.173) (-300.952) (-300.668) * (-303.063) (-301.978) (-302.179) [-299.055] -- 0:00:09
838500 -- (-303.028) [-298.595] (-300.063) (-299.690) * (-300.781) [-311.650] (-299.562) (-300.197) -- 0:00:09
839000 -- [-300.273] (-298.836) (-301.088) (-302.782) * (-299.717) (-303.456) [-300.455] (-299.678) -- 0:00:09
839500 -- (-298.741) [-300.904] (-306.434) (-300.793) * (-302.032) (-299.841) (-304.004) [-303.515] -- 0:00:09
840000 -- (-300.090) [-300.263] (-301.684) (-299.193) * [-298.162] (-299.562) (-305.779) (-298.810) -- 0:00:09
Average standard deviation of split frequencies: 0.007701
840500 -- (-301.621) (-302.845) [-298.665] (-299.797) * (-299.946) [-299.249] (-301.206) (-301.881) -- 0:00:09
841000 -- (-306.448) (-301.136) (-299.071) [-303.235] * (-300.073) (-299.193) (-299.712) [-299.284] -- 0:00:09
841500 -- (-302.550) [-300.466] (-304.319) (-300.303) * [-303.126] (-300.449) (-300.215) (-307.329) -- 0:00:09
842000 -- (-300.515) (-299.954) [-303.023] (-300.459) * (-301.973) (-300.453) [-300.724] (-309.389) -- 0:00:09
842500 -- [-300.558] (-300.596) (-302.219) (-298.882) * (-300.603) [-299.803] (-300.704) (-299.012) -- 0:00:09
843000 -- (-300.989) [-302.348] (-301.262) (-298.767) * (-301.072) (-300.304) [-298.284] (-300.706) -- 0:00:09
843500 -- (-307.762) [-301.185] (-298.931) (-298.891) * (-301.047) (-299.405) [-298.359] (-299.297) -- 0:00:09
844000 -- (-299.814) [-299.686] (-301.137) (-299.657) * (-300.598) [-299.931] (-298.872) (-299.239) -- 0:00:09
844500 -- [-302.741] (-299.728) (-304.267) (-300.639) * [-301.434] (-299.363) (-300.999) (-298.757) -- 0:00:09
845000 -- (-299.116) (-302.790) (-298.583) [-298.888] * (-301.666) (-300.931) [-298.857] (-299.918) -- 0:00:09
Average standard deviation of split frequencies: 0.007727
845500 -- [-300.904] (-299.209) (-299.951) (-298.415) * (-299.144) (-300.189) (-299.143) [-298.556] -- 0:00:09
846000 -- (-304.406) [-298.209] (-302.921) (-300.468) * (-301.664) [-299.903] (-301.260) (-298.702) -- 0:00:09
846500 -- (-302.645) [-298.860] (-301.588) (-298.970) * [-305.447] (-301.916) (-301.164) (-302.304) -- 0:00:09
847000 -- (-303.841) [-298.721] (-299.372) (-300.871) * (-300.849) (-301.566) [-299.485] (-299.871) -- 0:00:09
847500 -- (-300.530) (-299.980) (-300.242) [-302.280] * (-309.724) [-299.077] (-299.603) (-298.833) -- 0:00:08
848000 -- (-300.015) [-299.044] (-302.797) (-301.876) * (-303.794) (-299.303) [-299.932] (-303.608) -- 0:00:08
848500 -- [-301.624] (-299.863) (-301.578) (-300.785) * [-300.986] (-298.379) (-301.833) (-300.528) -- 0:00:08
849000 -- (-300.001) (-298.953) (-300.140) [-299.629] * [-299.981] (-300.551) (-303.788) (-301.008) -- 0:00:08
849500 -- (-306.106) (-303.894) [-300.739] (-303.288) * (-300.177) (-304.219) (-301.000) [-303.525] -- 0:00:08
850000 -- (-303.258) (-301.144) [-300.261] (-301.484) * (-299.295) [-300.933] (-299.991) (-302.165) -- 0:00:08
Average standard deviation of split frequencies: 0.007426
850500 -- (-298.459) (-301.771) [-300.586] (-300.683) * (-298.494) [-301.347] (-300.394) (-299.854) -- 0:00:08
851000 -- (-300.496) (-300.813) [-301.809] (-299.580) * (-299.724) (-301.229) [-299.541] (-299.568) -- 0:00:08
851500 -- [-299.039] (-301.568) (-300.938) (-300.501) * (-300.999) (-300.730) (-301.689) [-299.718] -- 0:00:08
852000 -- (-299.418) (-301.820) (-303.284) [-298.940] * [-300.168] (-300.831) (-302.395) (-298.848) -- 0:00:08
852500 -- [-301.152] (-300.098) (-301.419) (-300.517) * [-300.431] (-300.547) (-299.877) (-299.977) -- 0:00:08
853000 -- (-300.644) (-301.536) (-301.322) [-298.706] * [-302.002] (-298.912) (-301.454) (-301.182) -- 0:00:08
853500 -- (-298.462) (-302.587) [-300.953] (-298.443) * (-301.399) (-299.954) (-300.047) [-301.631] -- 0:00:08
854000 -- (-303.636) (-299.510) (-300.914) [-298.923] * (-302.116) (-304.318) (-301.809) [-304.844] -- 0:00:08
854500 -- (-299.884) (-299.289) [-300.820] (-305.490) * [-300.018] (-302.451) (-300.108) (-299.726) -- 0:00:08
855000 -- (-298.691) (-299.096) (-304.210) [-303.069] * [-298.711] (-299.780) (-300.789) (-301.151) -- 0:00:08
Average standard deviation of split frequencies: 0.007233
855500 -- (-298.357) [-298.695] (-308.442) (-302.096) * (-299.706) [-301.581] (-301.986) (-303.771) -- 0:00:08
856000 -- (-298.812) (-299.177) [-299.272] (-299.105) * (-300.893) (-300.048) (-298.396) [-301.086] -- 0:00:08
856500 -- (-300.377) (-302.472) [-299.987] (-299.860) * (-300.682) (-300.615) [-303.552] (-300.763) -- 0:00:08
857000 -- (-298.370) [-299.759] (-300.135) (-300.998) * (-300.420) [-300.769] (-306.252) (-301.582) -- 0:00:08
857500 -- (-298.726) (-299.216) [-300.884] (-300.617) * (-300.137) (-299.210) [-301.378] (-304.559) -- 0:00:08
858000 -- [-298.439] (-302.168) (-303.167) (-301.002) * (-301.667) [-302.312] (-302.073) (-298.697) -- 0:00:08
858500 -- (-298.829) [-300.069] (-299.564) (-303.535) * (-299.037) (-301.313) [-299.247] (-300.150) -- 0:00:08
859000 -- (-299.301) [-299.926] (-301.025) (-303.404) * (-302.251) [-298.619] (-303.357) (-300.043) -- 0:00:08
859500 -- (-299.247) (-304.354) (-299.585) [-299.923] * [-301.096] (-302.707) (-301.404) (-300.046) -- 0:00:08
860000 -- (-302.969) (-302.493) [-298.958] (-301.902) * (-298.986) (-299.889) [-300.065] (-303.377) -- 0:00:08
Average standard deviation of split frequencies: 0.007266
860500 -- (-301.230) [-299.007] (-300.108) (-302.878) * (-300.510) (-301.992) [-299.014] (-301.683) -- 0:00:08
861000 -- (-299.018) (-299.509) (-301.930) [-300.896] * (-300.161) (-301.714) (-299.489) [-299.648] -- 0:00:08
861500 -- (-299.250) [-299.014] (-302.478) (-302.702) * (-299.309) (-304.444) [-299.959] (-298.964) -- 0:00:08
862000 -- (-299.085) (-300.596) (-299.823) [-300.229] * [-299.114] (-300.731) (-302.328) (-302.488) -- 0:00:08
862500 -- (-298.855) [-302.791] (-298.699) (-300.055) * (-299.935) [-300.271] (-300.917) (-300.500) -- 0:00:08
863000 -- (-300.626) (-301.866) (-299.487) [-301.330] * (-301.303) (-301.228) (-300.189) [-298.816] -- 0:00:08
863500 -- (-299.006) (-307.595) (-299.706) [-300.620] * (-300.168) (-303.163) (-304.270) [-300.321] -- 0:00:08
864000 -- (-299.352) (-300.436) [-299.387] (-299.244) * [-303.982] (-301.727) (-300.693) (-299.748) -- 0:00:08
864500 -- [-301.823] (-299.845) (-298.984) (-306.183) * (-301.413) (-301.207) (-298.510) [-298.902] -- 0:00:07
865000 -- (-298.718) [-299.303] (-299.941) (-300.717) * (-300.294) (-300.934) (-301.878) [-299.648] -- 0:00:07
Average standard deviation of split frequencies: 0.007222
865500 -- (-299.164) (-300.192) [-299.552] (-298.921) * (-302.492) (-301.085) [-300.269] (-299.949) -- 0:00:07
866000 -- [-300.616] (-301.573) (-299.819) (-299.452) * (-302.394) [-299.384] (-299.919) (-300.557) -- 0:00:07
866500 -- (-298.874) [-304.534] (-302.538) (-302.191) * (-301.797) [-302.469] (-301.844) (-300.138) -- 0:00:07
867000 -- (-298.396) (-300.312) (-302.769) [-301.178] * (-301.289) (-300.033) [-300.769] (-303.294) -- 0:00:07
867500 -- (-299.877) (-302.410) [-300.637] (-299.894) * [-305.242] (-305.391) (-300.999) (-300.146) -- 0:00:07
868000 -- (-298.352) (-298.371) (-300.336) [-300.038] * (-302.372) [-299.187] (-303.400) (-302.930) -- 0:00:07
868500 -- [-299.276] (-299.902) (-301.499) (-299.150) * (-300.629) (-298.185) [-301.045] (-302.229) -- 0:00:07
869000 -- (-298.714) (-300.759) (-299.374) [-301.268] * (-303.130) (-301.963) (-299.515) [-298.951] -- 0:00:07
869500 -- (-303.228) [-299.885] (-300.054) (-299.409) * (-299.190) [-300.025] (-302.366) (-299.669) -- 0:00:07
870000 -- (-306.180) (-299.549) (-303.292) [-300.094] * (-298.936) (-304.071) [-299.074] (-300.807) -- 0:00:07
Average standard deviation of split frequencies: 0.006966
870500 -- [-302.138] (-300.185) (-304.695) (-300.832) * (-299.623) (-303.098) [-299.957] (-299.430) -- 0:00:07
871000 -- (-299.003) (-299.706) [-299.616] (-302.381) * (-301.255) (-305.002) [-298.689] (-299.861) -- 0:00:07
871500 -- (-300.436) (-302.958) [-300.293] (-300.375) * [-300.603] (-299.118) (-300.819) (-300.133) -- 0:00:07
872000 -- (-302.055) (-300.498) (-300.395) [-298.439] * (-300.158) (-299.458) [-300.535] (-301.458) -- 0:00:07
872500 -- (-301.066) [-299.699] (-300.158) (-302.778) * (-300.434) (-299.590) (-302.358) [-300.735] -- 0:00:07
873000 -- (-301.029) (-299.718) [-299.061] (-300.244) * (-300.638) (-305.744) (-300.639) [-301.238] -- 0:00:07
873500 -- (-300.118) (-298.604) (-300.244) [-299.615] * (-299.856) (-304.382) [-299.379] (-301.255) -- 0:00:07
874000 -- [-299.737] (-302.287) (-301.842) (-300.725) * (-299.427) [-302.137] (-301.493) (-300.469) -- 0:00:07
874500 -- (-300.935) (-302.770) [-299.684] (-303.962) * (-298.869) (-308.169) (-300.675) [-301.506] -- 0:00:07
875000 -- (-302.280) (-299.952) [-303.987] (-300.221) * (-299.393) (-301.263) [-300.096] (-305.898) -- 0:00:07
Average standard deviation of split frequencies: 0.006422
875500 -- (-301.396) (-299.154) [-300.338] (-299.793) * (-299.064) (-299.307) (-301.520) [-298.834] -- 0:00:07
876000 -- [-300.786] (-300.709) (-301.942) (-301.362) * (-300.057) (-302.363) [-302.881] (-301.315) -- 0:00:07
876500 -- (-299.944) (-299.444) [-302.109] (-300.982) * (-300.822) (-299.698) [-302.302] (-299.690) -- 0:00:07
877000 -- (-303.394) [-299.603] (-298.345) (-307.991) * [-300.258] (-302.512) (-303.028) (-301.107) -- 0:00:07
877500 -- (-300.835) (-300.813) (-299.747) [-298.722] * (-300.172) (-298.843) (-304.019) [-299.374] -- 0:00:07
878000 -- (-302.461) [-298.833] (-299.710) (-300.283) * (-300.221) (-302.662) (-301.619) [-300.024] -- 0:00:07
878500 -- [-298.534] (-304.393) (-302.006) (-304.059) * (-298.725) (-300.820) [-300.988] (-299.789) -- 0:00:07
879000 -- (-299.048) [-302.557] (-300.581) (-312.017) * (-302.056) (-301.855) [-299.535] (-301.967) -- 0:00:07
879500 -- (-299.649) [-299.240] (-300.235) (-301.185) * (-299.994) (-300.861) [-298.904] (-300.512) -- 0:00:07
880000 -- (-299.973) (-300.877) (-303.370) [-302.154] * (-301.807) (-299.881) [-301.397] (-301.859) -- 0:00:07
Average standard deviation of split frequencies: 0.006495
880500 -- (-299.442) (-302.657) (-300.375) [-300.696] * (-300.328) (-300.097) [-302.015] (-298.791) -- 0:00:07
881000 -- (-302.424) (-301.852) [-299.562] (-302.204) * (-298.533) (-300.047) (-299.702) [-301.282] -- 0:00:07
881500 -- [-300.222] (-304.489) (-299.150) (-299.508) * (-303.798) [-301.348] (-300.870) (-304.930) -- 0:00:06
882000 -- (-301.107) (-301.488) (-299.386) [-303.961] * (-302.580) (-301.639) (-298.340) [-298.998] -- 0:00:06
882500 -- [-299.635] (-299.163) (-298.960) (-300.008) * (-301.984) (-302.345) [-299.827] (-300.522) -- 0:00:06
883000 -- [-298.569] (-300.299) (-303.643) (-300.136) * (-299.337) (-299.438) [-298.477] (-300.876) -- 0:00:06
883500 -- [-300.815] (-306.128) (-299.241) (-300.056) * (-300.391) (-299.671) [-300.984] (-307.395) -- 0:00:06
884000 -- (-300.921) (-305.917) [-303.405] (-301.969) * (-300.802) [-300.655] (-298.683) (-301.116) -- 0:00:06
884500 -- (-303.456) [-299.166] (-298.874) (-304.791) * [-299.366] (-305.086) (-301.779) (-306.577) -- 0:00:06
885000 -- (-309.697) [-299.269] (-299.352) (-300.624) * (-301.149) [-301.502] (-300.262) (-299.292) -- 0:00:06
Average standard deviation of split frequencies: 0.006562
885500 -- (-300.360) (-302.954) (-299.250) [-300.099] * (-299.908) [-300.328] (-298.582) (-305.601) -- 0:00:06
886000 -- [-298.182] (-302.161) (-303.876) (-301.405) * (-301.241) (-300.702) (-299.772) [-298.961] -- 0:00:06
886500 -- (-300.689) [-305.056] (-300.287) (-299.808) * (-303.471) [-301.522] (-299.926) (-298.596) -- 0:00:06
887000 -- (-299.932) (-301.238) (-301.402) [-305.730] * (-299.288) (-302.020) (-301.325) [-300.051] -- 0:00:06
887500 -- (-302.711) [-299.806] (-299.863) (-301.923) * (-303.108) (-300.514) [-299.674] (-300.462) -- 0:00:06
888000 -- [-299.318] (-300.389) (-300.134) (-300.419) * (-298.709) (-300.168) (-304.872) [-299.691] -- 0:00:06
888500 -- (-298.766) (-298.775) [-298.845] (-302.940) * [-301.696] (-300.090) (-299.104) (-299.988) -- 0:00:06
889000 -- [-299.265] (-299.595) (-301.028) (-300.852) * (-300.121) (-304.616) (-301.734) [-303.509] -- 0:00:06
889500 -- (-300.542) (-301.411) [-302.381] (-300.538) * (-302.713) [-302.577] (-299.961) (-301.535) -- 0:00:06
890000 -- (-298.346) (-301.405) [-298.719] (-299.289) * (-300.924) (-299.756) [-299.651] (-301.808) -- 0:00:06
Average standard deviation of split frequencies: 0.006598
890500 -- (-299.022) (-301.155) [-300.439] (-303.074) * [-300.838] (-301.216) (-301.990) (-300.643) -- 0:00:06
891000 -- (-299.096) [-299.015] (-301.306) (-305.654) * [-299.064] (-299.350) (-300.424) (-300.238) -- 0:00:06
891500 -- (-302.136) [-298.470] (-299.954) (-301.085) * [-299.009] (-300.135) (-304.742) (-304.795) -- 0:00:06
892000 -- (-302.249) (-303.560) [-300.416] (-299.063) * (-300.251) (-305.622) (-301.538) [-298.685] -- 0:00:06
892500 -- (-300.035) [-301.130] (-304.034) (-301.208) * (-301.922) [-299.608] (-300.786) (-303.450) -- 0:00:06
893000 -- (-305.073) (-299.651) (-300.411) [-299.362] * (-300.096) (-298.844) [-303.960] (-298.861) -- 0:00:06
893500 -- [-301.650] (-301.281) (-301.741) (-301.689) * (-300.361) [-299.018] (-303.933) (-299.039) -- 0:00:06
894000 -- (-301.125) (-299.242) (-300.876) [-303.912] * (-301.746) [-299.158] (-299.032) (-305.359) -- 0:00:06
894500 -- (-299.412) (-300.604) [-301.665] (-306.407) * (-301.144) (-303.438) (-300.841) [-299.235] -- 0:00:06
895000 -- (-298.619) [-301.498] (-298.513) (-299.530) * (-300.404) (-299.984) (-299.532) [-300.857] -- 0:00:06
Average standard deviation of split frequencies: 0.006699
895500 -- (-299.464) (-299.712) [-301.823] (-299.600) * [-300.491] (-299.401) (-300.338) (-299.513) -- 0:00:06
896000 -- (-298.516) (-299.497) [-300.264] (-300.340) * [-300.313] (-299.310) (-300.845) (-299.520) -- 0:00:06
896500 -- (-303.727) (-298.708) (-300.543) [-300.255] * (-300.539) (-299.717) (-299.334) [-302.007] -- 0:00:06
897000 -- [-300.176] (-299.816) (-303.414) (-301.950) * (-299.635) [-299.252] (-300.067) (-301.791) -- 0:00:06
897500 -- (-301.229) (-299.737) (-299.966) [-304.413] * [-299.700] (-298.871) (-299.464) (-301.967) -- 0:00:06
898000 -- (-302.776) (-302.637) [-302.372] (-305.964) * [-299.413] (-300.013) (-302.727) (-302.724) -- 0:00:06
898500 -- (-299.060) (-301.578) (-302.115) [-300.465] * (-300.541) (-300.664) (-302.119) [-300.410] -- 0:00:05
899000 -- (-299.791) [-299.626] (-299.618) (-298.602) * (-299.665) (-301.772) (-300.866) [-299.861] -- 0:00:05
899500 -- (-301.092) [-303.720] (-301.933) (-303.249) * [-301.127] (-302.415) (-299.326) (-299.141) -- 0:00:05
900000 -- (-298.668) (-304.556) [-299.460] (-306.835) * (-300.117) (-299.104) (-301.754) [-300.091] -- 0:00:05
Average standard deviation of split frequencies: 0.006560
900500 -- (-301.947) (-304.924) (-299.268) [-300.111] * [-300.950] (-303.435) (-302.772) (-301.655) -- 0:00:05
901000 -- [-301.230] (-304.542) (-302.306) (-301.345) * (-299.654) (-300.330) [-303.322] (-301.024) -- 0:00:05
901500 -- (-303.141) (-300.287) [-301.252] (-302.586) * (-302.019) (-299.512) (-300.604) [-300.548] -- 0:00:05
902000 -- (-300.239) [-299.321] (-301.274) (-301.134) * (-300.217) (-299.129) (-299.551) [-299.486] -- 0:00:05
902500 -- (-300.805) (-301.053) (-299.505) [-300.141] * [-298.868] (-301.213) (-299.124) (-299.796) -- 0:00:05
903000 -- (-299.118) (-299.856) (-300.618) [-300.374] * [-299.009] (-303.092) (-298.429) (-300.085) -- 0:00:05
903500 -- (-298.756) [-299.708] (-300.185) (-300.224) * (-298.922) [-302.454] (-299.433) (-298.334) -- 0:00:05
904000 -- (-299.580) (-298.568) [-300.280] (-301.734) * (-301.629) [-299.081] (-301.129) (-298.701) -- 0:00:05
904500 -- (-299.517) (-301.125) (-300.200) [-302.549] * [-299.700] (-298.692) (-301.654) (-300.770) -- 0:00:05
905000 -- [-302.075] (-300.174) (-300.331) (-302.428) * (-299.652) [-301.210] (-299.400) (-300.882) -- 0:00:05
Average standard deviation of split frequencies: 0.006972
905500 -- (-301.691) [-298.252] (-301.344) (-298.960) * (-300.458) (-298.798) (-298.440) [-301.378] -- 0:00:05
906000 -- (-299.807) (-300.282) [-301.237] (-301.941) * (-303.236) (-298.216) [-302.106] (-300.578) -- 0:00:05
906500 -- (-300.809) (-301.262) [-300.131] (-300.219) * (-300.324) (-300.254) [-299.010] (-299.250) -- 0:00:05
907000 -- (-299.860) (-299.220) [-300.960] (-300.692) * (-299.605) (-299.993) [-300.538] (-300.221) -- 0:00:05
907500 -- [-299.323] (-300.302) (-302.774) (-303.717) * (-300.413) (-302.106) [-299.115] (-298.488) -- 0:00:05
908000 -- (-300.544) (-303.228) (-301.442) [-301.806] * [-298.557] (-299.726) (-300.742) (-298.181) -- 0:00:05
908500 -- (-300.132) (-300.718) (-299.956) [-300.298] * (-303.231) (-301.692) [-300.514] (-302.053) -- 0:00:05
909000 -- (-299.699) (-303.971) [-300.438] (-299.815) * [-299.186] (-298.168) (-302.060) (-299.474) -- 0:00:05
909500 -- (-300.370) (-300.139) [-300.174] (-299.770) * [-299.558] (-299.613) (-299.621) (-303.670) -- 0:00:05
910000 -- (-302.221) [-304.543] (-306.507) (-298.550) * (-299.449) (-300.344) [-301.673] (-298.716) -- 0:00:05
Average standard deviation of split frequencies: 0.007385
910500 -- (-299.908) (-300.381) [-302.126] (-299.788) * (-299.130) (-300.702) (-299.746) [-299.180] -- 0:00:05
911000 -- [-299.906] (-298.527) (-300.413) (-301.689) * (-301.024) (-307.084) [-300.699] (-300.354) -- 0:00:05
911500 -- (-301.932) (-301.307) [-301.064] (-304.919) * (-303.112) (-300.614) [-300.018] (-299.244) -- 0:00:05
912000 -- (-298.860) [-299.444] (-301.315) (-299.844) * (-304.652) [-302.870] (-298.650) (-303.578) -- 0:00:05
912500 -- (-300.874) [-300.292] (-301.006) (-298.243) * [-300.530] (-299.151) (-303.220) (-300.624) -- 0:00:05
913000 -- (-300.251) (-302.819) [-298.225] (-299.325) * (-300.343) (-303.260) (-299.351) [-298.956] -- 0:00:05
913500 -- (-300.201) (-299.877) (-298.339) [-299.894] * (-301.513) (-301.327) (-301.921) [-299.187] -- 0:00:05
914000 -- (-299.003) (-299.184) [-300.107] (-300.746) * (-299.609) [-299.908] (-299.299) (-303.508) -- 0:00:05
914500 -- (-299.887) (-301.144) [-300.539] (-299.116) * (-302.236) (-300.129) [-298.964] (-302.595) -- 0:00:05
915000 -- (-301.208) (-300.993) [-301.291] (-306.524) * (-304.585) (-299.886) (-300.173) [-300.617] -- 0:00:05
Average standard deviation of split frequencies: 0.007617
915500 -- (-300.703) [-302.400] (-299.849) (-300.110) * (-300.703) (-298.601) (-308.171) [-299.980] -- 0:00:04
916000 -- (-303.948) (-299.353) [-302.684] (-300.105) * (-298.200) (-302.762) (-304.946) [-303.428] -- 0:00:04
916500 -- (-301.745) (-302.881) (-303.123) [-298.748] * [-299.583] (-300.617) (-301.141) (-302.607) -- 0:00:04
917000 -- (-298.819) (-306.623) (-298.838) [-298.986] * [-300.727] (-298.648) (-301.309) (-300.338) -- 0:00:04
917500 -- [-303.826] (-299.772) (-300.915) (-299.795) * (-301.131) (-299.016) [-299.842] (-299.845) -- 0:00:04
918000 -- (-301.747) (-301.503) [-298.846] (-299.329) * [-302.008] (-304.489) (-301.379) (-299.374) -- 0:00:04
918500 -- (-302.097) (-303.035) (-300.011) [-301.619] * [-299.163] (-301.945) (-299.592) (-302.849) -- 0:00:04
919000 -- (-298.723) (-300.159) [-300.000] (-300.862) * (-298.944) (-302.333) (-299.773) [-300.877] -- 0:00:04
919500 -- (-299.373) (-299.244) [-298.357] (-300.599) * (-298.528) (-302.571) [-300.172] (-299.610) -- 0:00:04
920000 -- (-303.211) (-304.283) (-300.862) [-302.765] * (-298.206) (-302.178) [-303.821] (-299.930) -- 0:00:04
Average standard deviation of split frequencies: 0.007441
920500 -- [-301.693] (-300.625) (-300.354) (-301.340) * (-299.870) [-298.778] (-301.183) (-304.469) -- 0:00:04
921000 -- (-298.576) (-299.549) [-298.910] (-300.291) * [-300.710] (-298.660) (-301.031) (-303.612) -- 0:00:04
921500 -- (-301.097) (-299.103) (-300.539) [-305.519] * (-301.988) [-300.913] (-300.227) (-302.900) -- 0:00:04
922000 -- (-298.701) (-300.525) (-301.061) [-302.965] * (-303.230) (-303.389) [-302.238] (-303.090) -- 0:00:04
922500 -- (-302.464) (-304.924) [-300.401] (-302.133) * (-300.617) (-301.693) [-299.462] (-300.227) -- 0:00:04
923000 -- (-301.093) [-303.562] (-300.317) (-303.716) * (-298.983) [-298.412] (-299.524) (-298.714) -- 0:00:04
923500 -- (-303.670) [-302.752] (-299.247) (-302.774) * (-299.485) (-299.005) [-300.796] (-301.185) -- 0:00:04
924000 -- (-300.231) (-307.568) [-298.288] (-301.581) * (-305.139) [-300.603] (-299.553) (-300.804) -- 0:00:04
924500 -- (-299.064) [-300.656] (-298.685) (-299.247) * (-299.494) [-300.228] (-299.553) (-302.258) -- 0:00:04
925000 -- (-300.462) (-300.108) [-301.838] (-299.520) * (-299.844) (-299.944) (-300.687) [-301.085] -- 0:00:04
Average standard deviation of split frequencies: 0.007772
925500 -- (-302.803) [-299.737] (-301.546) (-302.314) * (-301.448) [-300.130] (-302.622) (-299.161) -- 0:00:04
926000 -- (-300.858) (-298.061) (-302.946) [-299.185] * [-299.250] (-302.261) (-303.943) (-301.940) -- 0:00:04
926500 -- (-300.877) (-299.158) (-300.692) [-298.302] * (-302.065) (-306.185) (-301.235) [-303.424] -- 0:00:04
927000 -- (-299.354) (-300.419) (-303.350) [-300.364] * (-303.532) (-301.042) (-300.554) [-300.430] -- 0:00:04
927500 -- [-299.431] (-300.791) (-302.325) (-300.297) * [-301.930] (-299.392) (-302.426) (-300.371) -- 0:00:04
928000 -- (-301.200) (-302.921) (-301.160) [-301.535] * (-302.703) (-299.589) (-302.600) [-303.548] -- 0:00:04
928500 -- (-300.547) (-298.696) [-303.212] (-308.174) * (-302.180) (-299.471) (-298.526) [-299.695] -- 0:00:04
929000 -- (-300.795) [-303.270] (-303.506) (-302.884) * (-300.323) [-299.793] (-302.389) (-299.320) -- 0:00:04
929500 -- (-299.837) (-299.416) (-299.805) [-299.933] * (-300.659) [-299.317] (-301.448) (-307.656) -- 0:00:04
930000 -- (-300.065) (-300.840) (-304.297) [-299.083] * (-300.074) [-304.055] (-299.515) (-301.098) -- 0:00:04
Average standard deviation of split frequencies: 0.007834
930500 -- (-299.284) (-300.022) (-305.202) [-299.352] * (-300.637) [-302.431] (-302.868) (-304.888) -- 0:00:04
931000 -- [-298.868] (-300.093) (-300.529) (-300.194) * (-305.369) (-307.074) [-300.181] (-299.457) -- 0:00:04
931500 -- (-298.543) (-302.091) (-299.558) [-303.527] * (-301.299) [-301.236] (-299.515) (-299.017) -- 0:00:04
932000 -- (-299.909) [-300.211] (-299.934) (-299.976) * [-299.868] (-304.644) (-299.897) (-300.096) -- 0:00:04
932500 -- (-298.873) (-304.256) (-300.649) [-300.460] * [-300.771] (-299.977) (-299.002) (-298.890) -- 0:00:03
933000 -- [-298.943] (-306.249) (-304.796) (-299.418) * [-301.889] (-306.897) (-301.032) (-300.770) -- 0:00:03
933500 -- (-300.114) (-299.726) [-301.689] (-301.955) * (-302.484) [-310.385] (-299.403) (-300.139) -- 0:00:03
934000 -- [-300.376] (-299.281) (-301.710) (-298.608) * (-300.122) (-304.922) [-300.805] (-299.574) -- 0:00:03
934500 -- [-299.994] (-300.741) (-300.023) (-300.844) * [-300.013] (-299.557) (-300.904) (-299.094) -- 0:00:03
935000 -- (-300.606) (-298.717) (-300.115) [-302.792] * (-299.656) (-299.667) (-299.108) [-299.494] -- 0:00:03
Average standard deviation of split frequencies: 0.008058
935500 -- (-301.371) [-299.506] (-299.763) (-303.136) * [-300.248] (-299.550) (-299.537) (-300.707) -- 0:00:03
936000 -- [-301.162] (-300.073) (-301.826) (-299.919) * [-300.449] (-302.845) (-300.628) (-301.792) -- 0:00:03
936500 -- (-300.894) (-300.746) (-301.913) [-299.701] * (-301.112) (-301.430) [-300.532] (-301.323) -- 0:00:03
937000 -- [-301.885] (-300.045) (-300.178) (-301.849) * [-299.109] (-299.710) (-300.573) (-299.763) -- 0:00:03
937500 -- (-301.406) (-299.940) (-301.068) [-301.138] * [-300.614] (-301.153) (-302.957) (-299.296) -- 0:00:03
938000 -- [-299.412] (-302.240) (-301.185) (-301.347) * (-302.294) (-299.016) (-301.077) [-298.651] -- 0:00:03
938500 -- (-298.735) [-300.628] (-299.741) (-302.895) * (-302.826) (-299.189) [-301.851] (-298.508) -- 0:00:03
939000 -- (-301.332) (-298.266) (-301.515) [-299.375] * (-303.688) (-300.257) [-299.643] (-304.977) -- 0:00:03
939500 -- (-299.785) (-306.544) [-300.201] (-303.559) * (-301.874) [-301.608] (-300.578) (-302.477) -- 0:00:03
940000 -- (-298.771) [-303.023] (-302.261) (-304.757) * [-299.201] (-299.137) (-300.169) (-302.401) -- 0:00:03
Average standard deviation of split frequencies: 0.008152
940500 -- (-299.247) [-298.973] (-301.443) (-298.373) * (-300.255) [-302.099] (-301.798) (-301.546) -- 0:00:03
941000 -- (-301.874) (-300.114) (-300.517) [-300.117] * (-300.586) (-302.621) [-304.130] (-299.893) -- 0:00:03
941500 -- (-299.354) (-304.009) (-301.185) [-298.635] * (-300.272) (-301.671) [-301.441] (-300.440) -- 0:00:03
942000 -- (-298.994) (-307.322) (-303.674) [-300.955] * (-301.145) [-303.514] (-302.404) (-299.818) -- 0:00:03
942500 -- (-299.816) [-298.416] (-299.170) (-299.851) * [-300.404] (-300.964) (-299.188) (-299.054) -- 0:00:03
943000 -- (-299.125) (-298.403) [-300.946] (-298.549) * (-299.873) (-299.062) (-299.753) [-298.669] -- 0:00:03
943500 -- (-299.543) (-300.280) [-301.942] (-301.957) * (-303.358) [-301.081] (-306.834) (-301.659) -- 0:00:03
944000 -- (-299.047) (-300.178) (-301.914) [-303.951] * (-301.573) (-303.226) [-302.555] (-300.229) -- 0:00:03
944500 -- (-302.061) (-299.257) (-302.240) [-301.812] * (-300.771) (-304.249) [-304.418] (-299.275) -- 0:00:03
945000 -- (-301.617) [-301.435] (-301.708) (-299.545) * (-301.054) [-299.202] (-301.501) (-299.318) -- 0:00:03
Average standard deviation of split frequencies: 0.008139
945500 -- (-299.909) (-299.992) (-304.558) [-299.824] * [-300.717] (-299.136) (-304.211) (-302.873) -- 0:00:03
946000 -- [-298.759] (-300.550) (-301.160) (-301.996) * (-304.067) (-300.790) [-304.597] (-304.740) -- 0:00:03
946500 -- [-298.922] (-301.010) (-299.810) (-300.872) * (-301.164) [-300.699] (-304.558) (-306.048) -- 0:00:03
947000 -- [-300.555] (-299.299) (-301.540) (-302.574) * (-308.586) (-300.468) [-300.544] (-303.763) -- 0:00:03
947500 -- (-300.689) (-301.975) [-299.951] (-299.709) * (-298.334) [-302.939] (-299.077) (-303.811) -- 0:00:03
948000 -- (-299.468) (-304.447) [-301.871] (-300.102) * (-301.528) (-299.987) [-300.653] (-306.565) -- 0:00:03
948500 -- [-299.523] (-301.799) (-303.099) (-304.161) * (-301.624) (-301.668) [-300.672] (-301.360) -- 0:00:03
949000 -- (-303.459) (-302.931) [-301.430] (-303.832) * (-304.861) [-301.580] (-299.043) (-300.093) -- 0:00:03
949500 -- (-299.129) [-301.076] (-299.834) (-299.614) * (-300.315) (-301.481) [-299.531] (-299.232) -- 0:00:02
950000 -- [-298.878] (-298.701) (-301.463) (-298.682) * [-298.348] (-300.371) (-303.610) (-301.491) -- 0:00:02
Average standard deviation of split frequencies: 0.007438
950500 -- (-302.640) [-300.581] (-299.379) (-299.705) * (-298.293) (-299.063) (-304.547) [-302.446] -- 0:00:02
951000 -- (-298.862) (-304.001) [-299.842] (-298.679) * (-299.502) [-300.222] (-301.527) (-302.408) -- 0:00:02
951500 -- (-300.130) [-299.854] (-299.057) (-298.137) * [-300.654] (-303.507) (-300.103) (-299.690) -- 0:00:02
952000 -- (-299.991) (-303.899) (-299.374) [-299.859] * (-298.880) (-302.417) [-298.975] (-303.382) -- 0:00:02
952500 -- (-298.556) [-298.632] (-298.765) (-300.142) * [-299.187] (-299.789) (-300.977) (-305.134) -- 0:00:02
953000 -- (-300.922) (-300.541) (-302.595) [-299.616] * (-301.232) (-303.175) (-298.534) [-299.038] -- 0:00:02
953500 -- (-298.892) (-300.202) [-300.431] (-300.590) * (-301.256) (-300.847) (-299.651) [-301.812] -- 0:00:02
954000 -- (-299.426) [-300.191] (-298.549) (-303.120) * (-300.110) (-299.988) (-300.996) [-302.431] -- 0:00:02
954500 -- (-298.449) (-299.314) (-298.642) [-299.148] * (-300.427) (-299.598) (-306.248) [-303.101] -- 0:00:02
955000 -- (-299.018) [-300.153] (-301.983) (-300.789) * (-299.803) [-299.125] (-300.720) (-302.147) -- 0:00:02
Average standard deviation of split frequencies: 0.007462
955500 -- (-299.365) [-299.901] (-302.012) (-299.939) * [-298.488] (-300.514) (-299.004) (-301.103) -- 0:00:02
956000 -- [-299.574] (-300.433) (-300.682) (-300.793) * (-305.319) [-299.431] (-300.125) (-300.324) -- 0:00:02
956500 -- (-302.631) [-300.915] (-298.870) (-303.018) * (-300.115) (-299.080) [-298.559] (-303.228) -- 0:00:02
957000 -- (-305.995) [-299.996] (-304.307) (-299.468) * (-299.281) [-298.817] (-299.574) (-303.429) -- 0:00:02
957500 -- (-303.558) [-299.778] (-299.252) (-298.320) * [-298.116] (-299.152) (-299.220) (-301.529) -- 0:00:02
958000 -- [-300.212] (-300.850) (-300.289) (-300.133) * (-298.709) (-298.440) [-300.027] (-300.001) -- 0:00:02
958500 -- (-304.118) (-298.620) (-302.051) [-298.797] * [-298.897] (-299.621) (-303.646) (-304.868) -- 0:00:02
959000 -- (-299.023) [-300.184] (-300.100) (-299.216) * (-302.972) (-302.134) (-299.583) [-306.501] -- 0:00:02
959500 -- (-299.918) (-299.421) (-301.706) [-298.460] * (-300.569) (-300.159) [-298.868] (-301.104) -- 0:00:02
960000 -- [-304.530] (-304.434) (-299.642) (-298.187) * (-301.879) (-300.170) [-299.245] (-300.274) -- 0:00:02
Average standard deviation of split frequencies: 0.007328
960500 -- (-299.769) [-300.015] (-299.132) (-298.199) * (-300.782) (-299.291) (-299.065) [-300.414] -- 0:00:02
961000 -- (-302.073) (-302.976) (-303.356) [-298.767] * (-298.706) (-298.322) [-299.343] (-298.674) -- 0:00:02
961500 -- (-300.665) (-298.957) (-301.820) [-303.930] * [-299.168] (-299.102) (-299.470) (-301.454) -- 0:00:02
962000 -- (-299.030) (-298.230) [-299.492] (-301.035) * (-299.335) (-299.031) (-302.419) [-301.093] -- 0:00:02
962500 -- (-302.152) [-299.456] (-300.615) (-302.142) * [-300.447] (-300.513) (-299.311) (-298.657) -- 0:00:02
963000 -- (-301.458) (-300.275) (-302.533) [-300.676] * [-305.675] (-298.142) (-301.846) (-305.011) -- 0:00:02
963500 -- (-298.782) (-299.497) (-299.907) [-298.943] * (-301.189) [-299.790] (-303.680) (-302.462) -- 0:00:02
964000 -- (-299.497) (-300.698) (-299.958) [-298.996] * [-299.807] (-298.968) (-300.374) (-301.473) -- 0:00:02
964500 -- [-299.581] (-302.242) (-299.781) (-299.705) * [-306.456] (-308.181) (-299.919) (-299.514) -- 0:00:02
965000 -- (-298.964) (-300.064) (-298.674) [-298.948] * (-302.057) [-299.349] (-298.856) (-302.763) -- 0:00:02
Average standard deviation of split frequencies: 0.007418
965500 -- (-302.811) (-299.611) (-299.601) [-298.336] * (-301.903) (-298.302) [-300.378] (-300.492) -- 0:00:02
966000 -- (-305.483) [-299.576] (-302.128) (-301.728) * (-300.527) [-300.215] (-301.887) (-300.988) -- 0:00:02
966500 -- [-300.682] (-300.549) (-298.850) (-301.911) * (-299.681) (-300.624) (-300.263) [-301.173] -- 0:00:01
967000 -- (-302.506) (-300.481) (-305.229) [-298.471] * (-301.841) [-299.617] (-301.685) (-302.118) -- 0:00:01
967500 -- (-301.685) (-300.899) (-299.649) [-301.733] * (-300.271) [-301.351] (-299.227) (-302.018) -- 0:00:01
968000 -- (-300.155) (-300.134) [-298.890] (-299.522) * (-303.139) [-298.636] (-302.158) (-305.914) -- 0:00:01
968500 -- (-299.860) (-298.987) [-299.457] (-299.459) * (-298.739) (-299.098) (-301.181) [-300.569] -- 0:00:01
969000 -- (-300.895) [-298.139] (-304.333) (-298.738) * (-298.809) [-300.385] (-300.477) (-300.152) -- 0:00:01
969500 -- [-301.463] (-300.427) (-299.844) (-298.689) * (-302.266) (-300.502) (-298.594) [-300.751] -- 0:00:01
970000 -- (-305.804) [-299.196] (-298.622) (-300.893) * (-300.468) (-301.123) [-298.230] (-301.273) -- 0:00:01
Average standard deviation of split frequencies: 0.007123
970500 -- (-306.411) [-302.125] (-298.805) (-303.200) * (-298.805) (-299.636) [-298.927] (-299.841) -- 0:00:01
971000 -- (-301.122) (-302.236) [-299.225] (-303.348) * (-300.377) [-298.991] (-298.193) (-299.892) -- 0:00:01
971500 -- (-301.873) (-301.156) [-300.138] (-300.548) * [-300.963] (-299.961) (-300.507) (-303.101) -- 0:00:01
972000 -- [-299.203] (-299.861) (-300.379) (-302.777) * (-300.503) [-298.733] (-306.794) (-303.712) -- 0:00:01
972500 -- [-299.021] (-301.196) (-302.633) (-303.810) * (-301.508) (-299.730) [-303.770] (-302.878) -- 0:00:01
973000 -- (-300.120) [-299.748] (-302.463) (-300.702) * [-302.235] (-298.287) (-304.167) (-306.235) -- 0:00:01
973500 -- (-303.272) (-302.060) [-299.598] (-299.374) * (-301.463) (-300.494) (-299.771) [-302.209] -- 0:00:01
974000 -- (-299.840) (-300.350) (-299.988) [-300.253] * (-300.058) (-299.593) [-300.489] (-301.371) -- 0:00:01
974500 -- (-300.318) (-302.027) (-299.154) [-301.930] * [-303.043] (-303.878) (-301.774) (-304.494) -- 0:00:01
975000 -- [-299.993] (-302.276) (-300.797) (-299.317) * (-298.430) (-305.928) (-300.349) [-299.431] -- 0:00:01
Average standard deviation of split frequencies: 0.007181
975500 -- (-299.128) (-299.793) [-299.405] (-299.626) * (-300.998) (-300.262) [-302.172] (-300.228) -- 0:00:01
976000 -- (-300.198) (-299.728) [-302.210] (-300.400) * (-298.441) (-301.107) [-300.630] (-299.326) -- 0:00:01
976500 -- (-301.774) (-299.116) (-306.472) [-299.015] * (-300.114) (-300.110) [-298.923] (-303.941) -- 0:00:01
977000 -- [-305.643] (-299.634) (-302.382) (-300.928) * [-298.435] (-300.719) (-300.625) (-302.788) -- 0:00:01
977500 -- (-301.556) (-302.503) [-301.261] (-300.921) * (-300.230) (-301.279) (-301.346) [-300.111] -- 0:00:01
978000 -- (-301.960) [-301.143] (-303.006) (-300.077) * (-302.373) (-298.697) [-301.594] (-300.684) -- 0:00:01
978500 -- [-301.163] (-299.337) (-306.282) (-300.967) * (-301.319) [-301.687] (-300.805) (-300.745) -- 0:00:01
979000 -- (-300.453) [-300.076] (-303.580) (-302.479) * (-300.988) (-304.159) (-300.389) [-299.312] -- 0:00:01
979500 -- [-299.508] (-299.849) (-299.003) (-299.417) * (-301.019) (-299.358) [-299.417] (-298.462) -- 0:00:01
980000 -- [-300.510] (-299.814) (-301.652) (-305.134) * (-300.078) (-299.364) [-304.079] (-299.047) -- 0:00:01
Average standard deviation of split frequencies: 0.007467
980500 -- (-299.251) [-300.543] (-302.600) (-299.525) * [-301.007] (-298.522) (-304.892) (-298.609) -- 0:00:01
981000 -- (-298.640) (-298.309) [-299.938] (-300.131) * [-301.281] (-302.117) (-303.488) (-300.513) -- 0:00:01
981500 -- (-298.948) (-299.535) (-301.968) [-300.616] * (-303.178) [-302.539] (-300.831) (-302.080) -- 0:00:01
982000 -- (-300.713) [-300.262] (-301.121) (-299.268) * (-299.331) (-300.385) (-300.121) [-301.052] -- 0:00:01
982500 -- (-300.969) (-299.289) [-299.452] (-298.796) * [-298.911] (-299.389) (-300.501) (-301.388) -- 0:00:01
983000 -- (-300.051) [-299.186] (-299.405) (-303.674) * [-298.579] (-298.550) (-301.006) (-299.105) -- 0:00:01
983500 -- (-298.794) (-298.945) [-298.637] (-302.895) * (-306.407) (-302.303) [-299.951] (-301.146) -- 0:00:00
984000 -- (-298.316) (-299.579) [-301.502] (-302.976) * (-301.712) (-301.956) (-301.311) [-300.787] -- 0:00:00
984500 -- (-299.013) [-299.226] (-299.022) (-300.992) * (-303.278) (-303.743) (-300.663) [-298.954] -- 0:00:00
985000 -- [-300.559] (-300.951) (-299.640) (-299.825) * (-300.371) [-298.887] (-299.690) (-300.398) -- 0:00:00
Average standard deviation of split frequencies: 0.007426
985500 -- [-299.080] (-300.809) (-302.163) (-301.857) * (-299.303) (-300.789) (-301.678) [-299.016] -- 0:00:00
986000 -- (-299.911) (-300.971) [-303.395] (-299.935) * (-300.164) [-298.606] (-300.694) (-301.255) -- 0:00:00
986500 -- (-299.768) (-300.864) (-298.722) [-300.962] * [-299.754] (-298.901) (-299.388) (-298.785) -- 0:00:00
987000 -- [-299.182] (-301.788) (-299.554) (-299.138) * [-299.548] (-300.275) (-299.714) (-303.428) -- 0:00:00
987500 -- (-300.676) (-300.608) (-298.339) [-300.068] * [-300.099] (-302.177) (-302.183) (-303.502) -- 0:00:00
988000 -- [-300.153] (-298.753) (-307.544) (-300.002) * (-302.606) (-302.008) [-298.647] (-300.317) -- 0:00:00
988500 -- [-300.286] (-300.106) (-299.127) (-299.434) * (-302.535) [-302.645] (-302.412) (-298.804) -- 0:00:00
989000 -- [-300.189] (-298.593) (-300.403) (-304.833) * (-300.173) (-299.490) (-299.563) [-299.319] -- 0:00:00
989500 -- (-300.192) (-301.809) [-298.855] (-308.293) * (-305.670) (-299.908) [-300.017] (-298.891) -- 0:00:00
990000 -- (-298.862) (-302.411) (-300.361) [-300.051] * (-299.270) (-299.290) (-299.087) [-300.804] -- 0:00:00
Average standard deviation of split frequencies: 0.006947
990500 -- (-299.760) (-300.479) (-298.221) [-301.601] * (-306.528) (-299.499) [-300.598] (-305.595) -- 0:00:00
991000 -- [-299.083] (-301.155) (-299.450) (-300.648) * (-302.176) [-300.475] (-301.068) (-302.635) -- 0:00:00
991500 -- (-303.006) (-302.532) [-299.910] (-300.598) * (-301.347) (-302.080) [-303.236] (-301.849) -- 0:00:00
992000 -- (-300.700) (-303.222) [-302.847] (-299.305) * (-306.128) (-299.198) (-301.338) [-299.894] -- 0:00:00
992500 -- [-300.628] (-300.181) (-301.034) (-299.218) * (-302.614) (-300.882) [-300.022] (-300.216) -- 0:00:00
993000 -- [-303.520] (-300.918) (-299.114) (-300.058) * (-304.090) (-300.698) (-298.903) [-302.641] -- 0:00:00
993500 -- (-301.391) (-301.002) (-299.659) [-300.042] * (-301.194) [-298.716] (-298.958) (-299.347) -- 0:00:00
994000 -- (-303.675) (-300.707) [-298.877] (-298.193) * [-300.188] (-298.466) (-299.486) (-299.709) -- 0:00:00
994500 -- (-301.475) (-299.282) [-300.101] (-300.170) * (-301.921) (-299.150) (-299.905) [-299.352] -- 0:00:00
995000 -- (-302.166) [-301.450] (-299.924) (-301.430) * (-303.801) (-299.154) [-302.324] (-299.022) -- 0:00:00
Average standard deviation of split frequencies: 0.007036
995500 -- (-302.616) [-299.193] (-299.585) (-303.525) * (-303.091) (-299.808) (-300.824) [-299.155] -- 0:00:00
996000 -- (-301.509) (-299.128) (-299.241) [-300.405] * (-302.606) [-300.347] (-301.030) (-300.140) -- 0:00:00
996500 -- [-299.225] (-298.921) (-302.867) (-302.692) * (-302.517) (-301.026) [-299.511] (-299.383) -- 0:00:00
997000 -- (-299.145) [-301.451] (-301.519) (-299.589) * (-303.558) (-299.866) (-302.369) [-299.492] -- 0:00:00
997500 -- (-298.765) (-302.484) [-301.129] (-299.763) * (-299.186) (-302.002) [-302.255] (-300.111) -- 0:00:00
998000 -- (-301.767) (-299.121) (-302.329) [-301.862] * (-299.706) (-300.947) [-302.229] (-301.037) -- 0:00:00
998500 -- (-300.185) (-304.665) (-306.355) [-300.297] * [-300.435] (-303.048) (-299.609) (-299.216) -- 0:00:00
999000 -- (-299.465) (-303.962) [-303.559] (-301.079) * (-302.464) (-299.801) [-299.287] (-301.048) -- 0:00:00
999500 -- (-300.710) (-307.917) [-303.411] (-304.211) * (-300.393) (-304.202) [-298.932] (-301.011) -- 0:00:00
1000000 -- (-302.979) [-298.951] (-304.056) (-300.913) * (-298.952) (-301.553) [-298.122] (-302.921) -- 0:00:00
Average standard deviation of split frequencies: 0.007569
Analysis completed in 59 seconds
Analysis used 57.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -298.01
Likelihood of best state for "cold" chain of run 2 was -298.01
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 70 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
45.4 % ( 39 %) Dirichlet(Pi{all})
41.4 % ( 29 %) Slider(Pi{all})
78.5 % ( 47 %) Multiplier(Alpha{1,2})
78.5 % ( 51 %) Multiplier(Alpha{3})
27.1 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 84 %) ParsSPR(Tau{all},V{all})
28.3 % ( 21 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
45.3 % ( 35 %) Dirichlet(Pi{all})
42.2 % ( 30 %) Slider(Pi{all})
78.6 % ( 48 %) Multiplier(Alpha{1,2})
77.9 % ( 36 %) Multiplier(Alpha{3})
27.1 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.7 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166593 0.82 0.67
3 | 165968 167111 0.84
4 | 166464 166997 166867
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165954 0.82 0.67
3 | 166456 166963 0.84
4 | 166487 167726 166414
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -299.75
| 1 |
| 2 1 |
| 1 1 *1 1 11 1 * |
|2 1 1 2 1 1 2 22 2 |
| 11 2 1 1 2 2 |
| 2 2 2 2 2 2 2 12 12222 2|
| 1 1 * 2 2 21 * 1 1 2 1 1 |
| 2 22 1 2 2 *1 2* * *12 1 1 1|
| 2 1 1 11 2 2 2 11 2 2 1 |
|1 2 1 2 1 212 1 1 2 |
| 1 11 2 1 |
| 2 |
| 1 2 2 1 22 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -301.50
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -299.73 -304.35
2 -299.76 -304.86
--------------------------------------
TOTAL -299.74 -304.64
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890764 0.092913 0.353948 1.498383 0.857036 985.45 1155.75 1.000
r(A<->C){all} 0.161398 0.019002 0.000241 0.445400 0.122554 154.08 242.56 1.002
r(A<->G){all} 0.155840 0.017300 0.000017 0.428531 0.123309 241.47 263.96 1.005
r(A<->T){all} 0.161341 0.019683 0.000073 0.449915 0.122731 150.31 240.04 1.001
r(C<->G){all} 0.177878 0.021783 0.000010 0.479037 0.140752 224.22 275.43 1.003
r(C<->T){all} 0.168975 0.019754 0.000060 0.460891 0.131730 233.55 250.57 1.000
r(G<->T){all} 0.174568 0.020485 0.000015 0.453411 0.142246 167.49 186.77 1.000
pi(A){all} 0.179362 0.000634 0.132946 0.229383 0.178399 1047.94 1207.65 1.000
pi(C){all} 0.279830 0.000921 0.221273 0.338059 0.279344 1111.77 1306.02 1.000
pi(G){all} 0.379361 0.001060 0.315283 0.441176 0.379710 1299.09 1317.91 1.000
pi(T){all} 0.161447 0.000575 0.115984 0.210773 0.160676 1100.90 1172.06 1.000
alpha{1,2} 0.429383 0.251234 0.000173 1.450890 0.251630 1236.07 1256.70 1.001
alpha{3} 0.441567 0.240344 0.000124 1.396356 0.281277 1095.35 1181.10 1.000
pinvar{all} 0.992265 0.000092 0.975368 0.999997 0.995264 1171.63 1262.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .**...
9 -- .****.
10 -- .**.**
11 -- .*..*.
12 -- ..**..
13 -- .***.*
14 -- ..*.*.
15 -- .*.*..
16 -- .*...*
17 -- ....**
18 -- ..****
19 -- .*.***
20 -- ...**.
21 -- ..*..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.002827 0.150566 0.154564 2
8 455 0.151566 0.010835 0.143904 0.159227 2
9 454 0.151233 0.004711 0.147901 0.154564 2
10 442 0.147235 0.002827 0.145237 0.149234 2
11 438 0.145903 0.011306 0.137908 0.153897 2
12 431 0.143571 0.004240 0.140573 0.146569 2
13 429 0.142905 0.008951 0.136576 0.149234 2
14 425 0.141572 0.004240 0.138574 0.144570 2
15 420 0.139907 0.016017 0.128581 0.151233 2
16 419 0.139574 0.001413 0.138574 0.140573 2
17 418 0.139241 0.014133 0.129247 0.149234 2
18 418 0.139241 0.012248 0.130580 0.147901 2
19 413 0.137575 0.004240 0.134577 0.140573 2
20 402 0.133911 0.008480 0.127915 0.139907 2
21 381 0.126915 0.007066 0.121919 0.131912 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099864 0.009742 0.000022 0.295691 0.070279 1.000 2
length{all}[2] 0.098963 0.009807 0.000023 0.296449 0.068129 1.000 2
length{all}[3] 0.098196 0.009726 0.000042 0.301131 0.067634 1.000 2
length{all}[4] 0.100990 0.010333 0.000027 0.319313 0.069619 1.000 2
length{all}[5] 0.101172 0.010522 0.000019 0.301807 0.069189 1.000 2
length{all}[6] 0.097462 0.009456 0.000015 0.292882 0.066264 1.001 2
length{all}[7] 0.100525 0.009932 0.000014 0.305420 0.068691 1.005 2
length{all}[8] 0.099293 0.009109 0.000069 0.287752 0.072046 0.998 2
length{all}[9] 0.106244 0.013216 0.000235 0.333116 0.061549 1.000 2
length{all}[10] 0.097767 0.011440 0.000096 0.314667 0.060629 0.998 2
length{all}[11] 0.088049 0.008030 0.000479 0.264527 0.062409 0.998 2
length{all}[12] 0.099525 0.009264 0.000100 0.298117 0.069234 0.998 2
length{all}[13] 0.098633 0.007618 0.000090 0.273344 0.074717 0.999 2
length{all}[14] 0.102132 0.009712 0.000468 0.301956 0.073292 0.998 2
length{all}[15] 0.099190 0.008627 0.000156 0.279930 0.069268 0.999 2
length{all}[16] 0.100242 0.010773 0.000186 0.295635 0.067032 1.001 2
length{all}[17] 0.103367 0.010469 0.000021 0.292438 0.079057 1.001 2
length{all}[18] 0.100246 0.011317 0.000018 0.300046 0.068576 1.000 2
length{all}[19] 0.102337 0.010711 0.000056 0.306424 0.071553 1.000 2
length{all}[20] 0.094279 0.009086 0.000170 0.262274 0.069157 1.006 2
length{all}[21] 0.094615 0.007919 0.001081 0.304810 0.072792 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007569
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 225
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 36 patterns at 75 / 75 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 36 patterns at 75 / 75 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
35136 bytes for conP
3168 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035443 0.016510 0.017925 0.056300 0.025395 0.030736 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -304.267416
Iterating by ming2
Initial: fx= 304.267416
x= 0.03544 0.01651 0.01792 0.05630 0.02540 0.03074 0.30000 1.30000
1 h-m-p 0.0000 0.0002 180.7097 +++ 296.969636 m 0.0002 14 | 1/8
2 h-m-p 0.0017 0.0662 21.5767 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 165.4222 ++ 296.445997 m 0.0000 46 | 2/8
4 h-m-p 0.0002 0.0783 18.6575 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 147.8862 ++ 294.231964 m 0.0001 76 | 3/8
6 h-m-p 0.0008 0.0977 15.3042 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 128.1664 ++ 293.041955 m 0.0001 107 | 4/8
8 h-m-p 0.0006 0.1295 11.8896 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 104.6534 ++ 292.342185 m 0.0001 138 | 5/8
10 h-m-p 0.0006 0.1945 8.0772 -----------.. | 5/8
11 h-m-p 0.0000 0.0003 73.9148 +++ 290.786089 m 0.0003 170 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 290.786089 m 8.0000 181 | 6/8
13 h-m-p 0.2765 8.0000 0.0001 +++ 290.786089 m 8.0000 195 | 6/8
14 h-m-p 0.0017 0.8458 0.3651 --------Y 290.786089 0 0.0000 216 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 -----------Y 290.786089 0 0.0000 240 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 ---------Y 290.786089 0 0.0000 262
Out..
lnL = -290.786089
263 lfun, 263 eigenQcodon, 1578 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.043172 0.084549 0.020166 0.047598 0.089981 0.083656 0.300564 0.672342 0.444096
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.655292
np = 9
lnL0 = -317.201697
Iterating by ming2
Initial: fx= 317.201697
x= 0.04317 0.08455 0.02017 0.04760 0.08998 0.08366 0.30056 0.67234 0.44410
1 h-m-p 0.0000 0.0003 171.4279 +++ 308.746691 m 0.0003 15 | 1/9
2 h-m-p 0.0002 0.0009 118.5371 ++ 300.406203 m 0.0009 27 | 2/9
3 h-m-p 0.0000 0.0000 322.6169 ++ 299.210586 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0006 254.7806 ++ 291.310467 m 0.0006 51 | 4/9
5 h-m-p 0.0000 0.0000 2093.0072 ++ 291.180213 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 769.6610 ++ 290.786055 m 0.0001 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 290.786055 m 8.0000 87 | 6/9
8 h-m-p 0.0117 5.8738 0.1476 ----------C 290.786055 0 0.0000 112 | 6/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 290.786055 m 8.0000 130 | 6/9
10 h-m-p 0.0001 0.0629 7.0403 +++++ 290.786042 m 0.0629 148 | 7/9
11 h-m-p 0.0319 0.1593 0.1271 ++ 290.786042 m 0.1593 160 | 8/9
12 h-m-p 0.0213 0.6818 0.4933 +++ 290.785946 m 0.6818 175 | 9/9
13 h-m-p 0.0160 8.0000 0.0000 Y 290.785946 0 0.0160 188 | 9/9
14 h-m-p 0.0160 8.0000 0.0000 Y 290.785946 0 0.0160 200
Out..
lnL = -290.785946
201 lfun, 603 eigenQcodon, 2412 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.088393 0.040108 0.027734 0.102809 0.047318 0.044269 0.000100 0.950893 0.128909 0.262760 1.343778
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.483722
np = 11
lnL0 = -314.987380
Iterating by ming2
Initial: fx= 314.987380
x= 0.08839 0.04011 0.02773 0.10281 0.04732 0.04427 0.00011 0.95089 0.12891 0.26276 1.34378
1 h-m-p 0.0000 0.0000 159.6673 ++ 314.741038 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0017 92.6287 ++++ 303.334300 m 0.0017 32 | 2/11
3 h-m-p 0.0001 0.0003 116.8948 ++ 299.534666 m 0.0003 46 | 3/11
4 h-m-p 0.0002 0.0010 36.4506 ++ 298.235486 m 0.0010 60 | 4/11
5 h-m-p 0.0000 0.0000 254.4374 ++ 297.618991 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 1971.9401 ++ 296.024049 m 0.0000 88 | 6/11
7 h-m-p 0.0030 0.0295 7.6836 ------------.. | 6/11
8 h-m-p 0.0000 0.0004 96.3273 +++ 291.859444 m 0.0004 127 | 7/11
9 h-m-p 0.0160 8.0000 3.0754 -------------.. | 7/11
10 h-m-p 0.0000 0.0002 71.7909 +++ 290.786060 m 0.0002 167 | 8/11
11 h-m-p 0.5721 8.0000 0.0000 ++ 290.786060 m 8.0000 181 | 8/11
12 h-m-p 0.0160 8.0000 0.0093 ---------N 290.786060 0 0.0000 207 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 290.786060 m 8.0000 227 | 8/11
14 h-m-p 0.0160 8.0000 0.3469 ---------Y 290.786060 0 0.0000 253 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 ---Y 290.786060 0 0.0001 273 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 290.786060 m 8.0000 293 | 8/11
17 h-m-p 0.0006 0.3180 2.1571 +++++ 290.786056 m 0.3180 313 | 9/11
18 h-m-p 0.0938 8.0000 6.1176 -------------N 290.786056 0 0.0000 340 | 9/11
19 h-m-p 0.0160 8.0000 0.0000 N 290.786056 0 0.0040 354 | 9/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 290.786056 m 8.0000 373 | 9/11
21 h-m-p 0.0160 8.0000 1.0473 -------------.. | 9/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 290.786056 m 8.0000 417 | 9/11
23 h-m-p 0.0160 8.0000 0.0269 +++++ 290.786051 m 8.0000 436 | 9/11
24 h-m-p 0.1167 8.0000 1.8410 ------------C 290.786051 0 0.0000 464 | 9/11
25 h-m-p 0.0160 8.0000 0.0000 -N 290.786051 0 0.0010 479 | 9/11
26 h-m-p 0.0160 8.0000 0.0000 --N 290.786051 0 0.0003 497
Out..
lnL = -290.786051
498 lfun, 1992 eigenQcodon, 8964 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -290.791548 S = -290.785099 -0.002465
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 36 patterns 0:03
did 20 / 36 patterns 0:03
did 30 / 36 patterns 0:03
did 36 / 36 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074246 0.090586 0.010172 0.061395 0.091400 0.104191 0.000100 0.765901 1.222380
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.996017
np = 9
lnL0 = -320.233886
Iterating by ming2
Initial: fx= 320.233886
x= 0.07425 0.09059 0.01017 0.06139 0.09140 0.10419 0.00011 0.76590 1.22238
1 h-m-p 0.0000 0.0000 157.6881 ++ 320.115404 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0093 29.4764 +++++ 314.419619 m 0.0093 29 | 2/9
3 h-m-p 0.0007 0.0034 143.6216 ++ 307.989616 m 0.0034 41 | 3/9
4 h-m-p 0.0004 0.0020 94.9335 ++ 293.435479 m 0.0020 53 | 4/9
5 h-m-p 0.0008 0.0038 21.0032 ++ 292.222461 m 0.0038 65 | 5/9
6 h-m-p 0.0002 0.0010 229.2073 ++ 291.353140 m 0.0010 77 | 6/9
7 h-m-p 0.0002 0.0008 20.8652 ----------.. | 6/9
8 h-m-p 0.0000 0.0001 96.1348 ++ 290.836759 m 0.0001 109 | 7/9
9 h-m-p 0.0160 8.0000 0.9804 -------------.. | 7/9
10 h-m-p 0.0000 0.0000 68.2154 ++ 290.785946 m 0.0000 146 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 290.785946 0 1.6000 158 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 +Y 290.785946 0 0.0640 172
Out..
lnL = -290.785946
173 lfun, 1903 eigenQcodon, 10380 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.066782 0.069758 0.107289 0.039680 0.054225 0.084244 0.000100 0.900000 0.515841 1.825057 1.300091
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.448000
np = 11
lnL0 = -318.077081
Iterating by ming2
Initial: fx= 318.077081
x= 0.06678 0.06976 0.10729 0.03968 0.05422 0.08424 0.00011 0.90000 0.51584 1.82506 1.30009
1 h-m-p 0.0000 0.0000 143.8461 ++ 318.003171 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0023 92.9296 ++++ 303.213576 m 0.0023 32 | 2/11
3 h-m-p 0.0000 0.0000 12860.8424 ++ 298.457959 m 0.0000 46 | 3/11
4 h-m-p 0.0031 0.0155 16.2713 ++ 295.330068 m 0.0155 60 | 4/11
5 h-m-p 0.0000 0.0001 30.0304 ++ 294.964434 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0016 47.4921 +++ 294.428377 m 0.0016 89 | 6/11
7 h-m-p 0.0007 0.0035 45.1085 ++ 294.119732 m 0.0035 103 | 7/11
8 h-m-p 0.0000 0.0001 5427.5445 --------.. | 7/11
9 h-m-p 0.0000 0.0008 64.4905 ++++ 290.786028 m 0.0008 139 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 290.786028 m 8.0000 153 | 8/11
11 h-m-p 0.0160 8.0000 0.1845 -------------.. | 8/11
12 h-m-p 0.0160 8.0000 0.0003 +++++ 290.786027 m 8.0000 201 | 8/11
13 h-m-p 0.0132 4.9753 0.1710 ----------C 290.786027 0 0.0000 228 | 8/11
14 h-m-p 0.0160 8.0000 0.0002 -------N 290.786027 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0007 +++++ 290.786026 m 8.0000 272 | 8/11
16 h-m-p 0.0276 4.4960 0.2099 --------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0003 +++++ 290.786025 m 8.0000 321 | 8/11
18 h-m-p 0.0140 5.1190 0.1674 -----------Y 290.786025 0 0.0000 349 | 8/11
19 h-m-p 0.0160 8.0000 0.0001 --------N 290.786025 0 0.0000 374 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 290.786025 m 8.0000 394 | 8/11
21 h-m-p 0.0082 4.0954 0.2019 ----------C 290.786025 0 0.0000 421 | 8/11
22 h-m-p 0.0160 8.0000 0.0002 ------C 290.786025 0 0.0000 444 | 8/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 290.786025 m 8.0000 464 | 8/11
24 h-m-p 0.0081 4.0283 2.2234 -------------.. | 8/11
25 h-m-p 0.0160 8.0000 0.0003 +++++ 290.786024 m 8.0000 509 | 8/11
26 h-m-p 0.0147 5.3062 0.1620 -------------.. | 8/11
27 h-m-p 0.0160 8.0000 0.0003 +++++ 290.786024 m 8.0000 557 | 8/11
28 h-m-p 0.0147 5.2284 0.1648 -------------.. | 8/11
29 h-m-p 0.0160 8.0000 0.0003 +++++ 290.786023 m 8.0000 605 | 8/11
30 h-m-p 0.0150 5.2838 0.1636 ------------Y 290.786023 0 0.0000 634 | 8/11
31 h-m-p 0.0160 8.0000 0.0002 +++++ 290.786022 m 8.0000 654 | 8/11
32 h-m-p 0.0078 2.7015 0.2406 -----------Y 290.786022 0 0.0000 682 | 8/11
33 h-m-p 0.0160 8.0000 0.0002 ----C 290.786022 0 0.0000 703 | 8/11
34 h-m-p 0.0160 8.0000 0.0001 +++++ 290.786022 m 8.0000 723 | 8/11
35 h-m-p 0.0135 6.7404 0.1634 -------N 290.786022 0 0.0000 747 | 8/11
36 h-m-p 0.0160 8.0000 0.0001 ----Y 290.786022 0 0.0000 768 | 8/11
37 h-m-p 0.0160 8.0000 0.0000 -----Y 290.786022 0 0.0000 790
Out..
lnL = -290.786022
791 lfun, 9492 eigenQcodon, 52206 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -290.797200 S = -290.785416 -0.005172
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 36 patterns 0:19
did 20 / 36 patterns 0:19
did 30 / 36 patterns 0:19
did 36 / 36 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=75
NC_011896_1_WP_010907873_1_708_MLBR_RS03360 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
NC_002677_1_NP_301549_1_421_ML0679 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE
**************************************************
NC_011896_1_WP_010907873_1_708_MLBR_RS03360 LGVEALEDGVTALDDRGAGLDHPSQ
NC_002677_1_NP_301549_1_421_ML0679 LGVEALEDGVTALDDRGAGLDHPSQ
NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460 LGVEALEDGVTALDDRGAGLDHPSQ
NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405 LGVEALEDGVTALDDRGAGLDHPSQ
NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700 LGVEALEDGVTALDDRGAGLDHPSQ
NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775 LGVEALEDGVTALDDRGAGLDHPSQ
*************************
>NC_011896_1_WP_010907873_1_708_MLBR_RS03360 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG TGCGGGTCTTGACCATCCGTCGCAG >NC_002677_1_NP_301549_1_421_ML0679 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG TGCGGGTCTTGACCATCCGTCGCAG >NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG TGCGGGTCTTGACCATCCGTCGCAG >NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG TGCGGGTCTTGACCATCCGTCGCAG >NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG TGCGGGTCTTGACCATCCGTCGCAG >NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775 GTGACGGACCAAAAACGGGTCAGACTGGGGCCGCATGCCCGAGACAGGAT CAGGCTGTGGGGGTCGGGTAGCGGGCCAGCAGCGCCAGTGTGGCCTTACT ATAGCTGGATCCCAGCGGCGTCGTACCAGCCCTGGCCCGAGCAGCTCGAA CTGGGCGTCGAGGCGTTGGAGGACGGCGTTACGGCGCTTGACGATCGAGG TGCGGGTCTTGACCATCCGTCGCAG
>NC_011896_1_WP_010907873_1_708_MLBR_RS03360 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE LGVEALEDGVTALDDRGAGLDHPSQ >NC_002677_1_NP_301549_1_421_ML0679 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE LGVEALEDGVTALDDRGAGLDHPSQ >NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE LGVEALEDGVTALDDRGAGLDHPSQ >NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE LGVEALEDGVTALDDRGAGLDHPSQ >NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE LGVEALEDGVTALDDRGAGLDHPSQ >NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775 VTDQKRVRLGPHARDRIRLWGSGSGPAAPVWPYYSWIPAASYQPWPEQLE LGVEALEDGVTALDDRGAGLDHPSQ
#NEXUS
[ID: 0529448337]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907873_1_708_MLBR_RS03360
NC_002677_1_NP_301549_1_421_ML0679
NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460
NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405
NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700
NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907873_1_708_MLBR_RS03360,
2 NC_002677_1_NP_301549_1_421_ML0679,
3 NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460,
4 NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405,
5 NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700,
6 NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07027864,2:0.06812915,3:0.06763395,4:0.06961881,5:0.06918868,6:0.06626392);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07027864,2:0.06812915,3:0.06763395,4:0.06961881,5:0.06918868,6:0.06626392);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -299.73 -304.35
2 -299.76 -304.86
--------------------------------------
TOTAL -299.74 -304.64
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0679/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890764 0.092913 0.353948 1.498383 0.857036 985.45 1155.75 1.000
r(A<->C){all} 0.161398 0.019002 0.000241 0.445400 0.122554 154.08 242.56 1.002
r(A<->G){all} 0.155840 0.017300 0.000017 0.428531 0.123309 241.47 263.96 1.005
r(A<->T){all} 0.161341 0.019683 0.000073 0.449915 0.122731 150.31 240.04 1.001
r(C<->G){all} 0.177878 0.021783 0.000010 0.479037 0.140752 224.22 275.43 1.003
r(C<->T){all} 0.168975 0.019754 0.000060 0.460891 0.131730 233.55 250.57 1.000
r(G<->T){all} 0.174568 0.020485 0.000015 0.453411 0.142246 167.49 186.77 1.000
pi(A){all} 0.179362 0.000634 0.132946 0.229383 0.178399 1047.94 1207.65 1.000
pi(C){all} 0.279830 0.000921 0.221273 0.338059 0.279344 1111.77 1306.02 1.000
pi(G){all} 0.379361 0.001060 0.315283 0.441176 0.379710 1299.09 1317.91 1.000
pi(T){all} 0.161447 0.000575 0.115984 0.210773 0.160676 1100.90 1172.06 1.000
alpha{1,2} 0.429383 0.251234 0.000173 1.450890 0.251630 1236.07 1256.70 1.001
alpha{3} 0.441567 0.240344 0.000124 1.396356 0.281277 1095.35 1181.10 1.000
pinvar{all} 0.992265 0.000092 0.975368 0.999997 0.995264 1171.63 1262.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0679/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 75
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 0 0 0 0 0 0 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 0 0 0 0 0 0 | ACG 2 2 2 2 2 2 | AAG 0 0 0 0 0 0 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 1 1 1 1 1 1 | GAC 5 5 5 5 5 5 | GGC 2 2 2 2 2 2
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 6 6 6 6 6 6 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907873_1_708_MLBR_RS03360
position 1: T:0.14667 C:0.30667 A:0.13333 G:0.41333
position 2: T:0.18667 C:0.28000 A:0.26667 G:0.26667
position 3: T:0.14667 C:0.25333 A:0.13333 G:0.46667
Average T:0.16000 C:0.28000 A:0.17778 G:0.38222
#2: NC_002677_1_NP_301549_1_421_ML0679
position 1: T:0.14667 C:0.30667 A:0.13333 G:0.41333
position 2: T:0.18667 C:0.28000 A:0.26667 G:0.26667
position 3: T:0.14667 C:0.25333 A:0.13333 G:0.46667
Average T:0.16000 C:0.28000 A:0.17778 G:0.38222
#3: NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460
position 1: T:0.14667 C:0.30667 A:0.13333 G:0.41333
position 2: T:0.18667 C:0.28000 A:0.26667 G:0.26667
position 3: T:0.14667 C:0.25333 A:0.13333 G:0.46667
Average T:0.16000 C:0.28000 A:0.17778 G:0.38222
#4: NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405
position 1: T:0.14667 C:0.30667 A:0.13333 G:0.41333
position 2: T:0.18667 C:0.28000 A:0.26667 G:0.26667
position 3: T:0.14667 C:0.25333 A:0.13333 G:0.46667
Average T:0.16000 C:0.28000 A:0.17778 G:0.38222
#5: NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700
position 1: T:0.14667 C:0.30667 A:0.13333 G:0.41333
position 2: T:0.18667 C:0.28000 A:0.26667 G:0.26667
position 3: T:0.14667 C:0.25333 A:0.13333 G:0.46667
Average T:0.16000 C:0.28000 A:0.17778 G:0.38222
#6: NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775
position 1: T:0.14667 C:0.30667 A:0.13333 G:0.41333
position 2: T:0.18667 C:0.28000 A:0.26667 G:0.26667
position 3: T:0.14667 C:0.25333 A:0.13333 G:0.46667
Average T:0.16000 C:0.28000 A:0.17778 G:0.38222
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 0 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 18 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 0
CTC 6 | CCC 12 | CAC 0 | CGC 0
CTA 0 | CCA 18 | Gln Q CAA 6 | CGA 12
CTG 18 | CCG 12 | CAG 18 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 0
ATC 12 | ACC 0 | AAC 0 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 0 | ACG 12 | AAG 0 | AGG 12
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 18
GTC 12 | GCC 6 | GAC 30 | GGC 12
GTA 0 | GCA 6 | Glu E GAA 6 | GGA 0
GTG 12 | GCG 36 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14667 C:0.30667 A:0.13333 G:0.41333
position 2: T:0.18667 C:0.28000 A:0.26667 G:0.26667
position 3: T:0.14667 C:0.25333 A:0.13333 G:0.46667
Average T:0.16000 C:0.28000 A:0.17778 G:0.38222
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -290.786089 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300564 1.300091
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907873_1_708_MLBR_RS03360: 0.000004, NC_002677_1_NP_301549_1_421_ML0679: 0.000004, NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460: 0.000004, NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405: 0.000004, NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700: 0.000004, NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30056
omega (dN/dS) = 1.30009
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 174.1 50.9 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 174.1 50.9 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 174.1 50.9 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 174.1 50.9 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 174.1 50.9 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 174.1 50.9 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -290.785946 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907873_1_708_MLBR_RS03360: 0.000004, NC_002677_1_NP_301549_1_421_ML0679: 0.000004, NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460: 0.000004, NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405: 0.000004, NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700: 0.000004, NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -290.786051 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.588881 0.160747 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907873_1_708_MLBR_RS03360: 0.000004, NC_002677_1_NP_301549_1_421_ML0679: 0.000004, NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460: 0.000004, NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405: 0.000004, NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700: 0.000004, NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.58888 0.16075 0.25037
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.2 48.8 0.4111 0.0000 0.0000 0.0 0.0
7..2 0.000 176.2 48.8 0.4111 0.0000 0.0000 0.0 0.0
7..3 0.000 176.2 48.8 0.4111 0.0000 0.0000 0.0 0.0
7..4 0.000 176.2 48.8 0.4111 0.0000 0.0000 0.0 0.0
7..5 0.000 176.2 48.8 0.4111 0.0000 0.0000 0.0 0.0
7..6 0.000 176.2 48.8 0.4111 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907873_1_708_MLBR_RS03360)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -290.785946 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.219286
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907873_1_708_MLBR_RS03360: 0.000004, NC_002677_1_NP_301549_1_421_ML0679: 0.000004, NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460: 0.000004, NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405: 0.000004, NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700: 0.000004, NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.21929
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 176.2 48.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -290.786022 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.861704 0.005000 1.896300 1.548143
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907873_1_708_MLBR_RS03360: 0.000004, NC_002677_1_NP_301549_1_421_ML0679: 0.000004, NZ_LVXE01000001_1_WP_010907873_1_94_A3216_RS00460: 0.000004, NZ_LYPH01000001_1_WP_010907873_1_82_A8144_RS00405: 0.000004, NZ_CP029543_1_WP_010907873_1_726_DIJ64_RS03700: 0.000004, NZ_AP014567_1_WP_010907873_1_741_JK2ML_RS03775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.86170 p = 0.00500 q = 1.89630
(p1 = 0.13830) w = 1.54814
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08617 0.08617 0.08617 0.08617 0.08617 0.08617 0.08617 0.08617 0.08617 0.08617 0.13830
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.54814
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.2 48.8 0.2141 0.0000 0.0000 0.0 0.0
7..2 0.000 176.2 48.8 0.2141 0.0000 0.0000 0.0 0.0
7..3 0.000 176.2 48.8 0.2141 0.0000 0.0000 0.0 0.0
7..4 0.000 176.2 48.8 0.2141 0.0000 0.0000 0.0 0.0
7..5 0.000 176.2 48.8 0.2141 0.0000 0.0000 0.0 0.0
7..6 0.000 176.2 48.8 0.2141 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907873_1_708_MLBR_RS03360)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907873_1_708_MLBR_RS03360)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:19
Model 1: NearlyNeutral -290.785946 Model 2: PositiveSelection -290.786051 Model 0: one-ratio -290.786089 Model 7: beta -290.785946 Model 8: beta&w>1 -290.786022 Model 0 vs 1 2.8599999996004044E-4 Model 2 vs 1 2.0999999992454832E-4 Model 8 vs 7 1.519999999572974E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
