--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:35:21 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0757/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -942.71 -945.54
2 -942.66 -946.98
--------------------------------------
TOTAL -942.69 -946.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887379 0.088647 0.373058 1.474527 0.857295 1441.05 1471.02 1.000
r(A<->C){all} 0.175748 0.021344 0.000018 0.473965 0.136436 177.21 232.09 1.001
r(A<->G){all} 0.156525 0.020323 0.000014 0.455880 0.114931 175.23 183.69 1.001
r(A<->T){all} 0.168693 0.019608 0.000107 0.456742 0.129109 241.27 273.49 1.000
r(C<->G){all} 0.153153 0.017252 0.000317 0.416298 0.115214 292.09 293.13 1.000
r(C<->T){all} 0.168390 0.021203 0.000095 0.469610 0.126774 126.89 183.37 1.001
r(G<->T){all} 0.177491 0.023232 0.000054 0.484169 0.138758 192.48 208.90 1.006
pi(A){all} 0.216106 0.000239 0.185664 0.245908 0.215912 1132.13 1166.68 1.000
pi(C){all} 0.312987 0.000330 0.280179 0.349543 0.312382 1130.87 1207.14 1.000
pi(G){all} 0.288316 0.000311 0.254201 0.321129 0.287620 1392.77 1446.88 1.000
pi(T){all} 0.182590 0.000210 0.152976 0.208320 0.182432 1274.27 1338.67 1.000
alpha{1,2} 0.417395 0.213806 0.000121 1.373769 0.244972 782.60 1001.93 1.000
alpha{3} 0.449296 0.246273 0.000171 1.442283 0.288622 1200.42 1258.92 1.000
pinvar{all} 0.997866 0.000006 0.992907 1.000000 0.998690 1201.41 1245.68 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -911.865499
Model 2: PositiveSelection -911.865444
Model 0: one-ratio -911.865702
Model 7: beta -911.865444
Model 8: beta&w>1 -911.865444
Model 0 vs 1 4.060000001118169E-4
Model 2 vs 1 1.0999999994965037E-4
Model 8 vs 7 0.0
>C1
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C2
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C3
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C4
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C5
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C6
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=230
C1 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C2 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C3 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C4 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C5 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C6 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
**************************************************
C1 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C2 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C3 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C4 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C5 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C6 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
**************************************************
C1 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C2 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C3 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C4 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C5 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C6 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
**************************************************
C1 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C2 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C3 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C4 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C5 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C6 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
**************************************************
C1 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C2 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C3 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C4 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C5 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C6 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6900]--->[6900]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.483 Mb, Max= 30.774 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C2 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C3 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C4 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C5 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
C6 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
**************************************************
C1 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C2 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C3 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C4 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C5 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
C6 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
**************************************************
C1 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C2 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C3 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C4 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C5 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
C6 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
**************************************************
C1 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C2 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C3 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C4 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C5 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
C6 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
**************************************************
C1 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C2 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C3 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C4 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C5 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
C6 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
C2 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
C3 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
C4 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
C5 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
C6 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
**************************************************
C1 CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
C2 CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
C3 CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
C4 CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
C5 CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
C6 CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
**************************************************
C1 ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
C2 ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
C3 ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
C4 ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
C5 ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
C6 ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
**************************************************
C1 CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
C2 CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
C3 CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
C4 CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
C5 CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
C6 CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
**************************************************
C1 GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
C2 GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
C3 GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
C4 GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
C5 GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
C6 GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
**************************************************
C1 GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
C2 GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
C3 GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
C4 GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
C5 GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
C6 GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
**************************************************
C1 TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
C2 TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
C3 TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
C4 TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
C5 TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
C6 TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
**************************************************
C1 GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
C2 GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
C3 GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
C4 GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
C5 GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
C6 GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
**************************************************
C1 TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
C2 TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
C3 TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
C4 TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
C5 TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
C6 TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
**************************************************
C1 GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
C2 GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
C3 GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
C4 GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
C5 GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
C6 GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
**************************************************
C1 TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
C2 TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
C3 TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
C4 TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
C5 TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
C6 TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
**************************************************
C1 TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
C2 TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
C3 TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
C4 TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
C5 TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
C6 TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
**************************************************
C1 CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
C2 CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
C3 CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
C4 CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
C5 CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
C6 CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
**************************************************
C1 GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
C2 GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
C3 GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
C4 GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
C5 GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
C6 GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
****************************************
>C1
TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
>C2
TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
>C3
TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
>C4
TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
>C5
TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
>C6
TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT
CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG
ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG
CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC
GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC
GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG
TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA
GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT
TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA
GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG
TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC
TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC
CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC
GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
>C1
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C2
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C3
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C4
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C5
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
>C6
LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
PQSPLRIERFNTDMYHSYHARFQGLPPHAT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 690 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579797233
Setting output file names to "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1832303228
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0723475237
Seed = 1784491309
Swapseed = 1579797233
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1544.253083 -- -24.965149
Chain 2 -- -1544.252994 -- -24.965149
Chain 3 -- -1544.253083 -- -24.965149
Chain 4 -- -1544.253083 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1544.253083 -- -24.965149
Chain 2 -- -1544.252847 -- -24.965149
Chain 3 -- -1544.253083 -- -24.965149
Chain 4 -- -1544.252994 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1544.253] (-1544.253) (-1544.253) (-1544.253) * [-1544.253] (-1544.253) (-1544.253) (-1544.253)
500 -- [-950.220] (-954.271) (-956.395) (-956.117) * (-960.045) (-967.812) (-951.664) [-954.447] -- 0:00:00
1000 -- (-951.117) [-950.523] (-952.857) (-952.825) * [-951.946] (-951.050) (-952.325) (-957.836) -- 0:16:39
1500 -- [-953.505] (-952.125) (-948.587) (-957.564) * (-954.163) (-958.495) [-953.195] (-954.756) -- 0:11:05
2000 -- (-949.642) [-948.766] (-947.027) (-962.476) * (-957.931) (-952.451) [-949.286] (-951.774) -- 0:08:19
2500 -- (-958.683) (-948.541) (-953.872) [-952.273] * [-946.482] (-952.730) (-955.990) (-951.778) -- 0:06:39
3000 -- (-949.107) (-950.251) (-947.734) [-950.072] * (-957.242) [-949.142] (-950.213) (-955.625) -- 0:05:32
3500 -- [-947.309] (-957.738) (-950.062) (-953.928) * [-961.182] (-962.159) (-951.712) (-958.950) -- 0:04:44
4000 -- [-954.385] (-963.902) (-949.971) (-958.132) * [-950.852] (-948.623) (-955.140) (-948.918) -- 0:04:09
4500 -- (-952.019) (-948.428) (-958.599) [-952.866] * (-948.908) [-946.825] (-951.817) (-957.975) -- 0:03:41
5000 -- [-946.462] (-962.348) (-952.490) (-948.416) * (-953.757) [-950.502] (-955.156) (-950.992) -- 0:03:19
Average standard deviation of split frequencies: 0.104757
5500 -- [-946.585] (-954.137) (-948.488) (-951.411) * (-959.010) [-949.428] (-952.103) (-955.684) -- 0:03:00
6000 -- (-948.902) (-954.473) (-954.258) [-953.463] * (-951.822) (-962.132) [-949.459] (-955.019) -- 0:02:45
6500 -- [-950.105] (-962.847) (-954.055) (-949.907) * (-964.571) (-954.021) (-956.145) [-947.287] -- 0:02:32
7000 -- (-952.372) (-950.920) (-947.916) [-952.352] * (-960.031) [-948.263] (-951.749) (-955.487) -- 0:02:21
7500 -- (-952.356) (-954.343) (-952.748) [-949.466] * (-957.336) [-950.206] (-955.485) (-950.263) -- 0:02:12
8000 -- [-951.952] (-955.143) (-957.239) (-959.108) * (-947.736) [-947.146] (-950.557) (-954.266) -- 0:02:04
8500 -- (-951.701) (-955.139) (-957.991) [-952.167] * (-962.967) [-944.160] (-953.713) (-952.552) -- 0:01:56
9000 -- [-949.237] (-951.738) (-952.038) (-961.256) * [-959.667] (-957.679) (-950.773) (-952.212) -- 0:01:50
9500 -- (-956.230) [-945.698] (-953.112) (-951.546) * [-949.586] (-956.569) (-948.526) (-961.467) -- 0:01:44
10000 -- (-952.060) (-948.231) (-965.519) [-956.838] * (-954.470) [-949.041] (-960.277) (-955.484) -- 0:01:39
Average standard deviation of split frequencies: 0.062274
10500 -- [-948.531] (-951.136) (-963.213) (-963.304) * (-960.163) (-949.101) (-961.018) [-947.178] -- 0:01:34
11000 -- [-951.551] (-950.748) (-949.093) (-957.983) * (-951.251) (-949.584) (-958.147) [-952.300] -- 0:01:29
11500 -- (-949.681) [-951.060] (-944.991) (-955.251) * (-949.929) [-947.095] (-950.380) (-956.002) -- 0:01:25
12000 -- (-948.856) (-952.756) [-945.606] (-950.018) * [-944.558] (-954.715) (-957.116) (-951.325) -- 0:01:22
12500 -- [-949.085] (-955.671) (-942.820) (-951.591) * [-947.440] (-948.203) (-959.650) (-947.373) -- 0:01:19
13000 -- (-954.753) (-954.765) (-944.174) [-954.299] * [-951.799] (-950.022) (-951.034) (-952.595) -- 0:01:15
13500 -- (-955.492) [-946.985] (-943.369) (-947.680) * (-952.555) (-956.298) (-953.034) [-950.402] -- 0:01:13
14000 -- [-942.612] (-952.096) (-943.611) (-956.065) * [-954.461] (-954.497) (-951.034) (-951.423) -- 0:01:10
14500 -- (-943.331) (-962.628) [-945.473] (-957.201) * (-957.237) (-956.761) (-951.354) [-941.453] -- 0:01:07
15000 -- (-947.235) (-955.124) (-945.480) [-950.231] * (-954.404) (-955.187) [-948.259] (-942.602) -- 0:01:05
Average standard deviation of split frequencies: 0.062608
15500 -- [-942.972] (-949.473) (-944.198) (-960.069) * (-954.854) [-953.900] (-958.208) (-942.245) -- 0:02:07
16000 -- (-943.244) [-951.908] (-942.077) (-953.023) * [-960.959] (-954.310) (-952.581) (-943.841) -- 0:02:03
16500 -- (-943.287) [-951.939] (-942.686) (-946.594) * (-950.083) (-949.602) [-952.886] (-943.259) -- 0:01:59
17000 -- (-941.781) [-956.088] (-941.887) (-952.242) * (-948.040) (-948.010) [-950.263] (-944.406) -- 0:01:55
17500 -- (-944.459) (-951.999) [-942.061] (-952.720) * (-963.862) (-954.002) [-949.024] (-941.639) -- 0:01:52
18000 -- (-942.162) (-951.275) [-941.428] (-953.734) * [-948.973] (-955.329) (-950.917) (-943.352) -- 0:01:49
18500 -- (-943.970) (-955.061) (-943.989) [-957.043] * (-954.218) (-946.429) (-952.972) [-942.743] -- 0:01:46
19000 -- (-941.824) (-959.691) [-943.170] (-951.426) * (-953.836) (-952.193) [-945.392] (-942.875) -- 0:01:43
19500 -- (-941.731) (-959.438) (-941.433) [-952.269] * (-949.449) (-951.939) (-962.092) [-942.281] -- 0:01:40
20000 -- [-942.533] (-962.110) (-949.301) (-952.966) * [-952.730] (-960.277) (-955.625) (-942.733) -- 0:01:38
Average standard deviation of split frequencies: 0.057696
20500 -- (-945.104) (-947.038) (-945.479) [-956.153] * (-961.756) (-958.196) [-949.236] (-942.758) -- 0:01:35
21000 -- (-945.246) [-943.241] (-944.267) (-954.417) * (-964.345) (-958.402) (-957.405) [-942.760] -- 0:01:33
21500 -- (-944.760) (-942.755) [-942.195] (-951.136) * (-943.514) [-950.973] (-950.117) (-943.066) -- 0:01:31
22000 -- (-949.161) [-944.788] (-944.288) (-948.104) * [-941.738] (-964.666) (-948.464) (-942.340) -- 0:01:28
22500 -- (-943.566) (-945.265) [-947.099] (-950.661) * (-943.051) [-956.260] (-952.148) (-942.756) -- 0:01:26
23000 -- [-943.645] (-942.960) (-944.749) (-952.901) * [-941.503] (-942.454) (-950.850) (-946.519) -- 0:01:24
23500 -- (-943.573) (-941.569) (-941.278) [-953.753] * (-943.484) [-942.314] (-962.057) (-944.825) -- 0:01:23
24000 -- (-948.545) (-942.630) [-942.579] (-951.084) * (-943.308) (-942.351) [-955.646] (-945.125) -- 0:01:21
24500 -- (-945.440) (-941.674) [-944.886] (-958.006) * (-943.924) (-942.369) [-943.946] (-944.206) -- 0:01:19
25000 -- (-942.050) [-942.651] (-943.474) (-959.803) * (-943.171) (-942.159) [-942.916] (-942.899) -- 0:01:18
Average standard deviation of split frequencies: 0.040795
25500 -- (-941.703) (-944.190) [-944.538] (-948.981) * (-942.437) (-944.805) [-943.404] (-943.015) -- 0:01:16
26000 -- [-942.184] (-942.705) (-942.348) (-950.248) * (-944.870) (-942.104) [-942.863] (-947.202) -- 0:01:14
26500 -- [-942.101] (-943.691) (-946.211) (-953.364) * (-942.805) (-942.761) [-945.523] (-943.079) -- 0:01:13
27000 -- (-944.013) (-947.530) (-943.920) [-946.167] * (-944.063) [-942.248] (-943.743) (-942.263) -- 0:01:12
27500 -- (-941.645) [-946.757] (-944.934) (-951.685) * (-945.300) (-942.152) [-945.750] (-945.794) -- 0:01:10
28000 -- [-942.514] (-944.258) (-947.765) (-953.492) * (-944.983) (-944.011) [-941.705] (-945.472) -- 0:01:09
28500 -- (-944.141) [-941.439] (-951.060) (-957.508) * (-945.125) (-942.518) (-944.187) [-942.667] -- 0:01:08
29000 -- [-943.452] (-944.463) (-944.976) (-959.451) * (-949.837) (-945.106) [-943.381] (-943.614) -- 0:01:06
29500 -- (-945.594) [-945.190] (-944.654) (-961.164) * (-953.134) (-944.266) [-941.666] (-943.609) -- 0:01:05
30000 -- (-942.759) (-944.058) (-944.674) [-945.764] * (-954.143) [-943.227] (-943.795) (-945.176) -- 0:01:04
Average standard deviation of split frequencies: 0.027508
30500 -- (-942.601) [-943.709] (-943.578) (-950.381) * (-947.876) (-942.614) (-944.572) [-944.009] -- 0:01:03
31000 -- [-943.635] (-943.438) (-943.410) (-949.836) * (-946.084) (-943.258) (-944.514) [-942.650] -- 0:01:02
31500 -- (-945.150) (-943.672) [-942.069] (-955.595) * (-942.761) (-947.923) (-946.250) [-942.687] -- 0:01:01
32000 -- [-943.170] (-942.974) (-943.193) (-952.017) * (-942.224) (-943.393) (-944.034) [-943.181] -- 0:01:30
32500 -- (-941.761) (-942.710) [-946.546] (-950.762) * [-944.229] (-945.471) (-943.973) (-944.446) -- 0:01:29
33000 -- (-941.995) [-943.356] (-947.660) (-949.363) * (-942.810) (-943.160) (-948.228) [-941.414] -- 0:01:27
33500 -- (-941.929) (-942.871) [-945.590] (-951.473) * (-941.416) [-946.256] (-947.551) (-941.770) -- 0:01:26
34000 -- (-943.378) (-941.471) [-943.689] (-950.701) * [-942.387] (-945.952) (-947.928) (-942.388) -- 0:01:25
34500 -- [-943.581] (-941.899) (-943.257) (-948.943) * (-942.845) (-944.049) (-946.239) [-940.975] -- 0:01:23
35000 -- (-944.249) (-941.913) (-945.047) [-952.056] * (-942.186) (-944.511) (-944.492) [-941.752] -- 0:01:22
Average standard deviation of split frequencies: 0.031281
35500 -- (-944.609) [-948.546] (-944.076) (-955.421) * (-945.136) (-944.052) (-943.205) [-941.940] -- 0:01:21
36000 -- [-942.745] (-948.958) (-942.871) (-948.012) * (-943.663) [-941.783] (-943.286) (-947.274) -- 0:01:20
36500 -- (-943.140) (-945.760) [-948.338] (-951.384) * [-943.828] (-941.995) (-942.156) (-949.804) -- 0:01:19
37000 -- (-943.140) (-945.205) (-944.596) [-952.392] * [-941.807] (-941.921) (-945.262) (-946.247) -- 0:01:18
37500 -- (-945.344) (-945.135) [-944.623] (-954.566) * (-943.804) [-943.406] (-945.647) (-946.051) -- 0:01:17
38000 -- (-942.636) (-943.809) (-942.289) [-956.002] * (-945.044) (-942.671) [-944.601] (-945.488) -- 0:01:15
38500 -- (-945.543) (-943.837) [-944.130] (-958.087) * (-942.796) (-942.833) [-945.863] (-943.981) -- 0:01:14
39000 -- (-943.013) [-941.708] (-943.326) (-953.070) * (-944.778) (-946.813) [-944.217] (-942.448) -- 0:01:13
39500 -- [-944.271] (-942.031) (-947.220) (-947.813) * (-943.498) (-945.037) [-943.766] (-942.409) -- 0:01:12
40000 -- (-942.727) [-944.510] (-942.948) (-943.985) * (-943.237) (-945.871) (-946.614) [-943.584] -- 0:01:12
Average standard deviation of split frequencies: 0.031556
40500 -- (-942.874) (-944.822) [-942.396] (-943.974) * (-943.199) (-943.339) [-943.010] (-944.984) -- 0:01:11
41000 -- (-941.751) [-941.931] (-946.450) (-944.011) * [-944.079] (-942.484) (-941.895) (-944.884) -- 0:01:10
41500 -- [-942.380] (-941.058) (-947.523) (-944.071) * (-944.059) (-942.739) [-942.160] (-941.094) -- 0:01:09
42000 -- (-941.744) (-941.219) (-946.351) [-942.784] * [-942.798] (-943.979) (-944.841) (-942.173) -- 0:01:08
42500 -- [-944.052] (-941.259) (-950.162) (-943.130) * (-944.568) [-942.757] (-943.264) (-942.171) -- 0:01:07
43000 -- (-947.391) [-941.248] (-945.320) (-942.448) * [-944.965] (-942.355) (-942.216) (-945.237) -- 0:01:06
43500 -- [-944.930] (-944.176) (-947.215) (-946.069) * (-943.972) (-944.169) [-941.598] (-943.679) -- 0:01:05
44000 -- (-945.168) (-942.753) (-945.574) [-941.711] * (-943.900) (-944.488) [-943.141] (-947.023) -- 0:01:05
44500 -- (-943.965) [-944.717] (-942.842) (-944.050) * (-945.877) (-942.190) (-944.743) [-945.460] -- 0:01:04
45000 -- (-943.887) [-942.813] (-943.331) (-943.921) * (-944.783) (-943.660) [-943.527] (-944.336) -- 0:01:03
Average standard deviation of split frequencies: 0.026645
45500 -- (-942.079) (-944.607) [-944.597] (-956.226) * (-946.308) (-944.213) [-943.276] (-949.122) -- 0:01:02
46000 -- (-942.333) [-944.937] (-945.884) (-948.268) * (-942.955) (-948.318) [-943.165] (-945.976) -- 0:01:02
46500 -- (-942.134) (-944.831) (-942.938) [-947.263] * (-943.827) (-941.969) (-943.157) [-944.580] -- 0:01:01
47000 -- [-942.199] (-941.555) (-945.008) (-943.577) * (-946.855) (-943.118) (-949.249) [-944.025] -- 0:01:00
47500 -- [-945.682] (-941.603) (-942.546) (-942.712) * (-945.204) [-944.095] (-944.839) (-943.849) -- 0:01:00
48000 -- [-942.801] (-942.695) (-943.717) (-944.825) * [-944.805] (-944.111) (-943.209) (-942.521) -- 0:00:59
48500 -- [-946.748] (-944.125) (-944.088) (-944.903) * [-944.628] (-943.614) (-941.830) (-942.370) -- 0:00:58
49000 -- [-941.979] (-945.048) (-941.922) (-946.427) * [-944.226] (-943.291) (-942.609) (-942.417) -- 0:01:17
49500 -- (-941.853) (-942.070) [-943.021] (-942.231) * [-945.080] (-943.114) (-942.346) (-941.773) -- 0:01:16
50000 -- [-942.029] (-943.563) (-943.063) (-941.788) * (-946.020) (-943.622) (-945.740) [-942.288] -- 0:01:16
Average standard deviation of split frequencies: 0.026933
50500 -- (-942.009) [-943.188] (-948.078) (-945.706) * (-945.104) (-942.265) [-946.248] (-943.233) -- 0:01:15
51000 -- (-952.461) (-944.664) [-944.794] (-946.969) * (-944.188) (-942.873) (-949.516) [-943.834] -- 0:01:14
51500 -- [-945.153] (-942.685) (-941.263) (-942.611) * [-944.621] (-946.399) (-942.957) (-944.330) -- 0:01:13
52000 -- (-945.138) (-942.162) [-941.680] (-944.839) * (-945.488) (-942.314) [-941.121] (-942.239) -- 0:01:12
52500 -- (-943.534) (-942.051) (-942.779) [-943.192] * (-945.092) (-942.676) (-941.768) [-944.150] -- 0:01:12
53000 -- (-943.513) [-942.476] (-942.911) (-942.966) * (-945.894) (-942.555) [-941.833] (-944.084) -- 0:01:11
53500 -- (-943.477) [-942.041] (-942.374) (-943.378) * [-944.281] (-943.480) (-941.296) (-943.896) -- 0:01:10
54000 -- (-945.607) [-944.543] (-942.455) (-945.876) * (-945.045) (-942.843) [-942.015] (-943.271) -- 0:01:10
54500 -- [-943.925] (-942.075) (-942.850) (-943.682) * (-943.424) [-943.986] (-941.898) (-945.441) -- 0:01:09
55000 -- (-942.009) (-943.876) (-942.112) [-942.903] * (-942.812) (-946.041) [-945.442] (-943.028) -- 0:01:08
Average standard deviation of split frequencies: 0.022047
55500 -- (-942.331) (-942.705) [-944.836] (-942.686) * [-944.466] (-942.246) (-944.923) (-943.754) -- 0:01:08
56000 -- (-941.979) (-947.378) (-949.676) [-942.846] * (-942.924) (-942.841) [-945.793] (-943.114) -- 0:01:07
56500 -- [-946.081] (-943.075) (-944.127) (-944.733) * (-945.701) [-941.899] (-946.742) (-941.312) -- 0:01:06
57000 -- (-951.531) (-948.550) [-942.745] (-942.038) * (-942.899) (-941.845) (-948.948) [-943.837] -- 0:01:06
57500 -- (-945.156) [-942.512] (-942.745) (-944.311) * (-944.065) (-942.170) [-945.751] (-941.702) -- 0:01:05
58000 -- [-944.385] (-944.071) (-945.867) (-942.351) * (-944.132) (-942.476) (-954.002) [-941.705] -- 0:01:04
58500 -- (-945.011) (-942.646) (-943.894) [-942.771] * (-943.259) (-942.230) (-943.093) [-943.170] -- 0:01:04
59000 -- (-943.484) (-943.052) [-942.482] (-950.215) * [-941.601] (-945.737) (-944.229) (-943.475) -- 0:01:03
59500 -- (-943.814) (-942.016) (-944.665) [-941.985] * (-942.009) (-943.431) (-943.102) [-942.525] -- 0:01:03
60000 -- [-942.585] (-946.810) (-942.445) (-941.850) * (-944.050) (-944.855) (-947.357) [-942.466] -- 0:01:02
Average standard deviation of split frequencies: 0.022534
60500 -- (-942.244) (-946.717) (-941.842) [-942.096] * (-943.349) (-945.318) (-945.010) [-941.836] -- 0:01:02
61000 -- (-941.441) (-944.444) (-944.293) [-942.126] * (-942.997) (-943.268) [-944.261] (-942.525) -- 0:01:01
61500 -- (-941.354) (-942.894) [-941.695] (-942.600) * [-942.591] (-946.911) (-942.683) (-944.213) -- 0:01:01
62000 -- [-941.208] (-941.577) (-941.694) (-943.623) * (-942.504) (-947.024) (-942.166) [-941.961] -- 0:01:00
62500 -- (-943.406) [-941.025] (-942.330) (-946.018) * (-944.817) (-945.597) (-941.158) [-941.033] -- 0:01:00
63000 -- (-942.733) (-941.025) (-945.633) [-947.468] * (-945.642) (-941.936) [-941.992] (-941.806) -- 0:00:59
63500 -- (-942.511) [-941.073] (-942.115) (-946.745) * [-944.538] (-941.736) (-944.506) (-944.588) -- 0:00:58
64000 -- (-943.009) [-942.439] (-942.814) (-943.665) * [-942.855] (-941.386) (-949.329) (-941.695) -- 0:00:58
64500 -- (-944.840) [-941.854] (-941.522) (-943.178) * [-942.020] (-941.643) (-950.936) (-941.240) -- 0:00:58
65000 -- (-942.871) [-944.780] (-942.921) (-943.003) * (-942.801) (-941.319) (-946.467) [-941.231] -- 0:00:57
Average standard deviation of split frequencies: 0.022108
65500 -- (-943.842) (-944.559) [-942.051] (-942.274) * (-941.685) (-944.908) (-942.892) [-941.935] -- 0:01:11
66000 -- [-942.764] (-943.612) (-944.616) (-942.036) * (-942.619) (-943.023) [-941.880] (-941.449) -- 0:01:10
66500 -- [-942.145] (-946.318) (-943.893) (-943.110) * (-942.998) (-942.253) [-943.513] (-942.056) -- 0:01:10
67000 -- (-942.945) (-943.831) [-943.377] (-942.749) * [-942.426] (-943.334) (-942.864) (-944.648) -- 0:01:09
67500 -- (-943.789) (-945.110) (-942.332) [-941.632] * (-941.809) (-941.652) (-943.717) [-944.908] -- 0:01:09
68000 -- (-944.006) [-944.375] (-941.716) (-944.162) * [-942.253] (-941.161) (-943.120) (-943.234) -- 0:01:08
68500 -- [-942.967] (-942.255) (-943.348) (-941.687) * (-943.797) (-942.595) [-942.190] (-944.757) -- 0:01:07
69000 -- (-942.538) [-942.794] (-943.975) (-945.277) * (-947.273) [-941.043] (-942.637) (-946.579) -- 0:01:07
69500 -- (-942.474) [-944.974] (-941.771) (-944.848) * (-947.438) (-945.540) [-942.638] (-947.074) -- 0:01:06
70000 -- (-942.929) (-944.896) (-944.920) [-949.337] * [-947.319] (-942.293) (-944.561) (-947.243) -- 0:01:06
Average standard deviation of split frequencies: 0.021347
70500 -- (-942.613) (-948.409) [-948.446] (-946.259) * (-949.200) (-942.419) [-945.629] (-942.396) -- 0:01:05
71000 -- [-944.249] (-944.409) (-946.583) (-944.060) * (-945.765) (-943.246) (-942.867) [-943.745] -- 0:01:05
71500 -- (-946.347) (-946.801) (-948.968) [-945.208] * (-944.561) [-943.454] (-942.770) (-945.946) -- 0:01:04
72000 -- (-944.978) [-942.312] (-944.972) (-947.160) * (-947.450) (-945.922) (-944.044) [-941.547] -- 0:01:04
72500 -- (-946.606) (-942.247) (-943.651) [-944.297] * (-944.421) [-944.402] (-942.851) (-941.430) -- 0:01:03
73000 -- (-942.794) (-948.436) [-942.488] (-943.437) * [-943.842] (-946.650) (-943.734) (-943.230) -- 0:01:03
73500 -- (-944.376) (-944.908) (-942.380) [-944.481] * (-941.926) [-943.175] (-942.611) (-944.936) -- 0:01:03
74000 -- (-945.034) [-943.239] (-944.130) (-941.264) * (-943.566) (-941.370) (-941.984) [-943.468] -- 0:01:02
74500 -- (-944.433) (-945.930) (-943.781) [-944.349] * (-944.835) (-941.668) [-943.493] (-948.807) -- 0:01:02
75000 -- (-945.750) (-942.884) [-944.259] (-944.636) * (-945.094) [-941.710] (-944.052) (-947.264) -- 0:01:01
Average standard deviation of split frequencies: 0.021365
75500 -- (-943.852) (-942.770) [-942.027] (-943.244) * (-944.173) (-941.888) [-944.525] (-945.648) -- 0:01:01
76000 -- [-942.344] (-941.804) (-944.172) (-941.397) * (-943.840) [-941.671] (-944.149) (-943.318) -- 0:01:00
76500 -- (-944.509) (-943.171) (-944.061) [-943.079] * [-943.652] (-942.474) (-943.730) (-944.459) -- 0:01:00
77000 -- (-944.144) (-941.497) [-943.490] (-944.299) * (-945.367) (-944.812) [-943.816] (-945.090) -- 0:00:59
77500 -- [-944.007] (-941.920) (-943.644) (-943.762) * (-944.881) (-943.107) (-947.281) [-944.858] -- 0:00:59
78000 -- (-942.689) (-943.096) (-944.716) [-943.199] * [-944.519] (-943.752) (-942.202) (-941.935) -- 0:00:59
78500 -- [-943.183] (-945.914) (-945.074) (-945.194) * (-945.249) (-942.787) (-942.261) [-942.201] -- 0:00:58
79000 -- (-944.429) (-941.846) (-944.514) [-943.696] * [-943.680] (-942.006) (-944.885) (-941.561) -- 0:00:58
79500 -- [-942.667] (-941.876) (-942.389) (-943.167) * (-943.128) (-942.176) (-943.264) [-945.487] -- 0:00:57
80000 -- (-941.777) [-941.314] (-942.662) (-944.836) * [-942.402] (-942.540) (-943.226) (-948.490) -- 0:00:57
Average standard deviation of split frequencies: 0.014610
80500 -- (-942.739) [-943.468] (-942.431) (-943.376) * (-943.320) (-947.321) (-945.233) [-946.919] -- 0:00:57
81000 -- (-942.050) [-946.460] (-943.213) (-944.754) * (-942.691) [-943.760] (-942.807) (-945.680) -- 0:00:56
81500 -- (-946.401) (-948.212) [-943.125] (-945.567) * [-942.836] (-943.792) (-942.631) (-946.150) -- 0:00:56
82000 -- (-943.463) (-944.109) (-942.840) [-941.601] * (-943.338) [-942.970] (-945.463) (-942.563) -- 0:01:07
82500 -- (-942.044) (-947.062) (-942.620) [-941.892] * [-943.420] (-943.653) (-941.692) (-944.599) -- 0:01:06
83000 -- (-942.368) (-943.698) [-945.918] (-945.780) * (-941.852) (-943.508) [-943.925] (-943.785) -- 0:01:06
83500 -- [-942.508] (-942.469) (-945.311) (-941.502) * [-943.882] (-943.764) (-942.521) (-942.622) -- 0:01:05
84000 -- (-942.181) (-943.045) (-947.833) [-942.596] * (-941.877) (-948.652) [-942.798] (-945.474) -- 0:01:05
84500 -- (-941.571) [-942.364] (-943.935) (-942.970) * (-941.548) (-943.629) (-941.440) [-942.662] -- 0:01:05
85000 -- [-942.718] (-942.680) (-947.180) (-943.064) * (-946.948) (-944.325) (-945.323) [-942.242] -- 0:01:04
Average standard deviation of split frequencies: 0.014800
85500 -- (-942.341) (-943.997) [-941.627] (-941.988) * [-942.125] (-947.611) (-943.028) (-944.289) -- 0:01:04
86000 -- (-941.334) (-944.353) [-944.636] (-943.481) * [-941.963] (-945.597) (-943.293) (-942.105) -- 0:01:03
86500 -- (-944.274) [-943.686] (-943.097) (-942.635) * (-942.564) (-941.717) (-943.621) [-942.956] -- 0:01:03
87000 -- [-943.608] (-941.696) (-942.254) (-944.482) * (-942.582) (-944.282) [-942.789] (-943.766) -- 0:01:02
87500 -- (-944.298) (-943.399) (-943.558) [-949.463] * [-943.518] (-945.601) (-942.714) (-944.383) -- 0:01:02
88000 -- (-945.223) (-942.475) [-947.358] (-950.050) * (-943.606) (-943.845) [-953.660] (-942.143) -- 0:01:02
88500 -- (-945.319) (-941.776) (-943.051) [-944.051] * [-942.374] (-945.022) (-947.205) (-941.519) -- 0:01:01
89000 -- [-942.230] (-941.568) (-942.632) (-944.140) * (-944.187) [-943.338] (-943.856) (-943.238) -- 0:01:01
89500 -- (-943.653) [-942.697] (-943.674) (-941.765) * [-946.313] (-945.912) (-942.997) (-944.463) -- 0:01:01
90000 -- (-941.528) (-944.103) (-942.319) [-942.431] * [-942.041] (-945.140) (-943.214) (-943.313) -- 0:01:00
Average standard deviation of split frequencies: 0.017787
90500 -- (-946.540) (-944.538) [-942.101] (-951.411) * (-941.341) (-942.721) (-943.618) [-942.064] -- 0:01:00
91000 -- [-943.650] (-944.258) (-943.412) (-946.655) * (-943.026) (-942.533) (-942.019) [-945.369] -- 0:00:59
91500 -- (-942.402) (-949.000) (-944.085) [-949.551] * (-941.787) [-942.691] (-941.953) (-941.816) -- 0:00:59
92000 -- [-944.812] (-943.599) (-945.947) (-948.217) * (-945.295) (-943.595) (-944.213) [-941.433] -- 0:00:59
92500 -- [-947.193] (-945.682) (-942.533) (-945.666) * (-943.287) (-943.785) [-944.193] (-941.427) -- 0:00:58
93000 -- (-945.315) (-941.972) (-945.189) [-943.840] * (-942.026) [-942.340] (-942.756) (-943.101) -- 0:00:58
93500 -- (-948.582) (-947.781) (-945.785) [-943.792] * (-947.470) (-943.433) (-944.523) [-945.086] -- 0:00:58
94000 -- (-944.242) [-947.153] (-944.258) (-944.625) * (-946.000) [-942.671] (-946.299) (-945.599) -- 0:00:57
94500 -- [-946.960] (-941.345) (-946.395) (-941.561) * [-945.590] (-942.660) (-946.691) (-942.404) -- 0:00:57
95000 -- [-942.005] (-941.780) (-948.548) (-945.886) * [-941.791] (-944.838) (-945.057) (-943.484) -- 0:00:57
Average standard deviation of split frequencies: 0.016024
95500 -- (-942.208) (-943.747) [-946.815] (-943.349) * [-943.793] (-946.807) (-943.061) (-944.849) -- 0:00:56
96000 -- [-941.331] (-943.787) (-941.875) (-943.141) * (-943.448) (-945.170) [-943.667] (-945.695) -- 0:00:56
96500 -- (-944.236) [-943.073] (-945.306) (-942.270) * (-943.006) [-945.331] (-944.661) (-944.602) -- 0:00:56
97000 -- [-945.316] (-946.297) (-942.552) (-946.787) * (-941.654) (-944.592) (-944.009) [-942.632] -- 0:00:55
97500 -- (-945.482) (-941.877) [-944.804] (-945.573) * (-944.192) [-943.628] (-942.779) (-942.965) -- 0:00:55
98000 -- (-946.126) (-943.101) [-944.800] (-943.804) * (-941.751) (-947.851) [-944.401] (-941.238) -- 0:00:55
98500 -- [-945.406] (-944.416) (-942.382) (-944.820) * [-944.690] (-942.737) (-941.370) (-943.896) -- 0:01:04
99000 -- (-945.880) (-943.176) (-942.486) [-943.522] * (-945.641) (-942.203) [-942.006] (-943.712) -- 0:01:03
99500 -- (-949.950) (-943.286) (-944.275) [-944.787] * (-944.292) [-942.883] (-944.018) (-945.133) -- 0:01:03
100000 -- (-946.024) [-944.014] (-944.970) (-942.293) * (-943.522) [-943.545] (-944.045) (-943.113) -- 0:01:02
Average standard deviation of split frequencies: 0.017253
100500 -- (-942.551) (-942.380) (-941.652) [-943.939] * (-943.241) (-945.240) (-943.253) [-943.898] -- 0:01:02
101000 -- (-942.328) (-944.211) (-941.876) [-945.554] * (-946.128) [-944.199] (-944.382) (-941.948) -- 0:01:02
101500 -- [-941.978] (-943.354) (-944.513) (-945.953) * (-944.212) [-945.109] (-945.679) (-943.168) -- 0:01:01
102000 -- (-942.873) (-944.090) (-941.576) [-944.775] * (-946.331) (-945.579) (-947.444) [-943.124] -- 0:01:01
102500 -- (-942.735) (-946.368) (-943.219) [-942.071] * (-943.610) (-945.137) [-943.362] (-943.768) -- 0:01:01
103000 -- (-943.690) (-943.288) (-941.885) [-944.002] * (-943.296) (-945.518) (-945.733) [-943.312] -- 0:01:00
103500 -- (-944.317) (-943.170) [-943.552] (-944.390) * (-944.850) (-943.895) (-944.263) [-943.808] -- 0:01:00
104000 -- (-941.368) (-942.668) (-943.262) [-942.971] * (-946.114) [-943.134] (-946.237) (-945.670) -- 0:01:00
104500 -- (-942.175) [-943.005] (-942.027) (-945.272) * (-943.368) [-942.834] (-941.999) (-944.816) -- 0:00:59
105000 -- [-944.462] (-942.060) (-942.955) (-944.597) * (-947.859) (-944.834) [-943.008] (-945.307) -- 0:00:59
Average standard deviation of split frequencies: 0.022458
105500 -- (-941.984) (-941.518) (-942.116) [-944.192] * (-946.485) (-945.667) (-945.146) [-944.191] -- 0:00:59
106000 -- (-944.463) (-942.782) (-943.365) [-943.600] * (-949.253) (-941.782) (-942.571) [-943.299] -- 0:00:59
106500 -- (-942.753) (-942.958) (-943.239) [-943.553] * (-943.738) [-944.776] (-943.074) (-942.322) -- 0:00:58
107000 -- (-942.558) (-942.954) [-943.545] (-942.664) * (-942.050) (-945.822) (-941.325) [-942.875] -- 0:00:58
107500 -- (-941.933) (-945.443) [-943.031] (-942.774) * (-948.772) [-942.156] (-944.771) (-943.957) -- 0:00:58
108000 -- (-946.903) (-946.161) [-944.552] (-941.982) * (-945.755) [-943.653] (-947.857) (-942.684) -- 0:00:57
108500 -- (-946.097) (-943.314) [-943.950] (-944.319) * (-945.243) [-942.127] (-944.903) (-943.010) -- 0:00:57
109000 -- (-943.500) (-941.212) [-943.606] (-942.568) * (-941.652) (-945.580) [-942.249] (-942.567) -- 0:00:57
109500 -- (-944.281) (-943.766) (-941.930) [-945.268] * (-942.302) [-943.071] (-946.226) (-943.249) -- 0:00:56
110000 -- (-942.865) (-945.399) (-944.016) [-942.182] * (-941.953) [-942.913] (-942.702) (-942.411) -- 0:00:56
Average standard deviation of split frequencies: 0.023765
110500 -- (-943.032) (-944.487) (-944.206) [-943.978] * (-941.987) (-942.920) [-943.522] (-944.079) -- 0:00:56
111000 -- (-944.900) (-942.747) (-942.932) [-942.414] * (-942.097) [-943.204] (-942.707) (-947.674) -- 0:00:56
111500 -- (-946.023) (-941.259) (-942.430) [-944.972] * (-941.931) (-942.803) (-944.416) [-945.121] -- 0:00:55
112000 -- (-942.903) (-944.030) (-943.421) [-942.368] * (-941.093) (-947.485) [-944.679] (-944.218) -- 0:00:55
112500 -- (-945.881) [-941.691] (-942.185) (-945.842) * (-941.271) (-947.687) [-942.736] (-947.570) -- 0:00:55
113000 -- (-947.734) (-943.656) [-942.973] (-948.344) * (-942.780) (-946.729) [-943.635] (-947.905) -- 0:00:54
113500 -- (-949.287) (-941.080) [-941.358] (-943.083) * (-941.634) (-944.504) (-943.071) [-946.687] -- 0:00:54
114000 -- (-944.787) (-942.040) (-941.810) [-942.458] * (-941.609) (-945.549) (-942.622) [-943.584] -- 0:00:54
114500 -- (-943.647) (-943.314) (-942.579) [-942.628] * (-941.897) [-942.398] (-948.659) (-942.823) -- 0:00:54
115000 -- (-943.395) (-943.514) [-941.552] (-943.132) * (-942.148) (-945.672) [-946.033] (-942.044) -- 0:00:53
Average standard deviation of split frequencies: 0.028233
115500 -- (-944.389) (-942.239) [-942.424] (-946.473) * (-943.402) [-946.475] (-945.611) (-941.799) -- 0:01:01
116000 -- (-942.657) (-942.386) [-945.170] (-942.527) * [-944.645] (-944.073) (-946.124) (-944.947) -- 0:01:00
116500 -- (-944.358) (-942.979) (-949.687) [-942.860] * [-945.008] (-943.205) (-945.731) (-943.369) -- 0:01:00
117000 -- (-942.319) (-941.457) (-942.864) [-942.693] * (-943.838) (-945.924) [-942.787] (-942.141) -- 0:01:00
117500 -- (-944.954) (-941.822) [-942.344] (-941.827) * (-944.396) [-944.319] (-941.389) (-946.054) -- 0:01:00
118000 -- (-942.120) [-945.542] (-943.122) (-948.038) * [-943.187] (-946.110) (-945.475) (-942.007) -- 0:00:59
118500 -- (-944.076) (-946.259) (-944.116) [-947.652] * (-944.415) (-943.786) [-942.132] (-943.473) -- 0:00:59
119000 -- (-943.482) [-942.476] (-944.395) (-943.364) * (-942.342) [-942.782] (-943.964) (-945.330) -- 0:00:59
119500 -- (-942.061) [-947.148] (-947.715) (-941.841) * (-944.255) (-941.819) (-945.908) [-945.647] -- 0:00:58
120000 -- (-942.446) (-947.891) [-943.229] (-942.070) * (-945.715) [-943.500] (-947.472) (-943.355) -- 0:00:58
Average standard deviation of split frequencies: 0.024091
120500 -- [-944.549] (-945.044) (-941.668) (-942.082) * (-943.082) (-946.075) [-946.737] (-942.875) -- 0:00:58
121000 -- (-941.971) (-943.382) [-943.005] (-941.542) * (-942.551) (-944.262) (-943.842) [-945.520] -- 0:00:58
121500 -- (-943.660) (-945.140) (-943.397) [-945.788] * (-942.492) [-943.913] (-946.167) (-942.145) -- 0:00:57
122000 -- [-945.493] (-943.253) (-945.297) (-941.588) * (-942.845) (-942.814) [-941.823] (-945.773) -- 0:00:57
122500 -- (-945.657) (-942.629) (-951.027) [-941.832] * [-943.535] (-945.131) (-941.631) (-945.328) -- 0:00:57
123000 -- [-942.148] (-943.002) (-942.384) (-941.509) * [-942.541] (-943.311) (-943.464) (-946.252) -- 0:00:57
123500 -- (-941.338) (-942.775) [-945.991] (-946.017) * (-944.285) (-945.221) [-944.574] (-945.719) -- 0:00:56
124000 -- (-941.886) [-943.872] (-946.813) (-944.617) * (-944.051) (-945.230) (-943.570) [-941.339] -- 0:00:56
124500 -- [-946.725] (-942.581) (-946.866) (-943.613) * (-943.890) [-943.259] (-943.169) (-943.457) -- 0:00:56
125000 -- (-946.536) (-944.648) (-944.015) [-942.493] * [-943.372] (-944.827) (-941.748) (-943.471) -- 0:00:56
Average standard deviation of split frequencies: 0.022448
125500 -- (-950.667) (-943.942) (-945.630) [-945.217] * (-943.188) (-942.637) [-942.709] (-942.626) -- 0:00:55
126000 -- [-944.868] (-946.182) (-943.842) (-944.000) * (-942.748) [-942.845] (-944.604) (-944.920) -- 0:00:55
126500 -- (-943.398) [-944.865] (-944.728) (-943.087) * (-941.283) [-942.136] (-942.915) (-943.814) -- 0:00:55
127000 -- (-945.534) (-942.257) (-942.593) [-941.805] * (-941.420) (-948.034) [-943.831] (-942.505) -- 0:00:54
127500 -- (-942.284) (-942.221) (-942.771) [-944.938] * [-941.882] (-944.847) (-942.549) (-941.979) -- 0:00:54
128000 -- (-943.107) [-942.188] (-942.478) (-943.939) * (-941.328) (-942.423) [-941.543] (-941.407) -- 0:00:54
128500 -- (-943.544) [-945.197] (-944.688) (-946.435) * (-948.739) [-941.848] (-941.983) (-942.335) -- 0:00:54
129000 -- (-941.556) (-944.384) [-943.840] (-943.985) * (-944.188) (-941.853) (-943.391) [-943.148] -- 0:00:54
129500 -- [-941.240] (-944.531) (-943.690) (-944.375) * (-944.362) (-941.834) (-942.595) [-943.440] -- 0:00:53
130000 -- (-941.219) (-942.456) [-943.105] (-942.362) * (-949.600) [-945.983] (-941.731) (-950.097) -- 0:00:53
Average standard deviation of split frequencies: 0.020744
130500 -- (-943.381) (-941.563) (-943.203) [-942.254] * (-942.557) (-944.359) [-941.375] (-945.147) -- 0:00:53
131000 -- (-942.303) (-941.637) [-944.858] (-944.010) * (-943.610) [-945.202] (-945.635) (-949.766) -- 0:00:53
131500 -- [-944.474] (-943.382) (-945.056) (-942.980) * (-945.563) (-942.751) (-942.710) [-941.742] -- 0:00:52
132000 -- (-942.086) (-944.464) [-949.516] (-943.104) * (-942.006) (-946.513) [-946.042] (-943.137) -- 0:00:59
132500 -- (-942.525) (-943.085) [-941.013] (-944.118) * (-942.949) (-941.812) (-948.149) [-946.012] -- 0:00:58
133000 -- (-945.343) (-943.578) (-942.578) [-944.633] * (-942.274) (-941.692) [-942.014] (-948.945) -- 0:00:58
133500 -- (-945.206) (-941.514) [-944.077] (-944.692) * [-944.306] (-942.266) (-942.059) (-943.989) -- 0:00:58
134000 -- (-942.485) (-943.872) [-947.626] (-942.643) * (-944.602) (-942.311) (-943.664) [-942.854] -- 0:00:58
134500 -- (-943.053) (-945.820) [-943.978] (-943.097) * (-942.714) (-942.096) [-942.574] (-945.607) -- 0:00:57
135000 -- (-944.981) (-945.456) (-942.409) [-942.503] * (-941.563) [-944.140] (-941.858) (-945.080) -- 0:00:57
Average standard deviation of split frequencies: 0.021491
135500 -- (-945.319) (-943.959) [-943.129] (-944.828) * (-943.365) (-943.863) [-945.059] (-943.834) -- 0:00:57
136000 -- [-943.176] (-942.806) (-943.749) (-945.459) * [-944.621] (-943.981) (-941.815) (-942.156) -- 0:00:57
136500 -- (-942.896) (-943.051) [-944.559] (-944.952) * (-943.383) [-943.002] (-942.893) (-942.115) -- 0:00:56
137000 -- (-941.576) (-942.617) (-943.965) [-945.034] * [-942.119] (-944.596) (-945.587) (-942.257) -- 0:00:56
137500 -- (-945.119) (-945.980) [-941.881] (-942.132) * (-943.903) [-943.755] (-943.572) (-941.961) -- 0:00:56
138000 -- (-942.662) [-943.750] (-943.248) (-945.012) * (-944.420) (-943.395) [-945.620] (-942.876) -- 0:00:56
138500 -- (-941.508) (-941.596) (-942.096) [-941.628] * (-946.078) [-942.907] (-945.439) (-942.916) -- 0:00:55
139000 -- (-941.567) [-945.292] (-942.923) (-943.741) * (-943.168) (-942.795) [-945.305] (-941.881) -- 0:00:55
139500 -- (-942.114) (-946.599) (-943.794) [-941.381] * [-943.847] (-945.395) (-943.515) (-941.998) -- 0:00:55
140000 -- (-942.306) (-945.419) (-942.125) [-941.847] * [-944.449] (-941.777) (-943.377) (-942.987) -- 0:00:55
Average standard deviation of split frequencies: 0.022577
140500 -- (-942.152) [-941.751] (-942.804) (-943.387) * [-944.908] (-946.501) (-942.258) (-944.263) -- 0:00:55
141000 -- (-942.803) [-945.916] (-942.367) (-942.344) * (-943.099) [-944.356] (-943.713) (-942.776) -- 0:00:54
141500 -- [-941.896] (-944.483) (-943.905) (-943.935) * (-943.180) (-943.615) [-942.295] (-942.101) -- 0:00:54
142000 -- (-942.476) (-945.106) [-948.173] (-943.533) * (-942.411) [-942.666] (-942.559) (-942.715) -- 0:00:54
142500 -- (-942.170) (-945.964) (-947.393) [-943.300] * [-943.413] (-942.075) (-941.123) (-942.652) -- 0:00:54
143000 -- (-944.209) (-946.271) (-945.738) [-943.687] * (-942.613) (-943.825) [-943.079] (-943.728) -- 0:00:53
143500 -- (-943.843) [-941.666] (-942.789) (-944.873) * (-943.448) [-945.678] (-947.878) (-946.209) -- 0:00:53
144000 -- (-943.806) (-942.147) [-944.294] (-942.987) * (-941.926) (-945.043) (-942.314) [-943.276] -- 0:00:53
144500 -- (-943.943) (-943.272) (-945.026) [-943.919] * (-945.526) [-941.629] (-941.981) (-947.189) -- 0:00:53
145000 -- [-943.946] (-944.878) (-942.698) (-942.726) * [-942.871] (-942.817) (-941.590) (-945.672) -- 0:00:53
Average standard deviation of split frequencies: 0.019211
145500 -- (-942.723) (-945.722) (-943.332) [-941.911] * (-944.375) [-941.827] (-946.956) (-944.481) -- 0:00:52
146000 -- [-943.758] (-945.032) (-941.202) (-946.386) * (-944.812) [-945.275] (-942.244) (-941.831) -- 0:00:52
146500 -- [-943.127] (-943.597) (-942.444) (-943.455) * (-948.294) [-944.708] (-944.074) (-941.769) -- 0:00:52
147000 -- (-943.633) [-942.517] (-942.912) (-944.752) * (-952.199) [-942.808] (-945.940) (-944.330) -- 0:00:52
147500 -- [-944.643] (-942.963) (-947.292) (-942.569) * [-944.403] (-942.596) (-944.128) (-942.987) -- 0:00:52
148000 -- (-942.696) (-941.315) [-941.652] (-942.061) * [-942.513] (-942.547) (-944.576) (-943.113) -- 0:00:51
148500 -- (-943.788) [-942.158] (-943.530) (-944.880) * [-944.736] (-942.298) (-947.706) (-942.154) -- 0:00:57
149000 -- (-942.748) (-942.068) [-943.900] (-943.989) * (-942.787) [-944.044] (-945.894) (-942.953) -- 0:00:57
149500 -- (-944.199) [-943.885] (-942.870) (-944.480) * (-944.512) (-944.370) (-943.607) [-942.241] -- 0:00:56
150000 -- (-942.892) [-942.948] (-943.400) (-942.812) * (-945.372) (-945.021) (-947.909) [-946.290] -- 0:00:56
Average standard deviation of split frequencies: 0.019399
150500 -- (-943.583) [-941.879] (-943.179) (-943.796) * (-944.080) (-945.586) (-942.843) [-945.245] -- 0:00:56
151000 -- [-941.756] (-942.257) (-942.518) (-948.884) * (-942.693) (-944.992) (-944.673) [-941.885] -- 0:00:56
151500 -- [-942.299] (-945.457) (-943.078) (-945.881) * (-942.726) [-942.113] (-942.088) (-948.976) -- 0:00:56
152000 -- (-944.322) (-950.336) (-942.347) [-943.152] * [-941.667] (-942.291) (-942.019) (-941.684) -- 0:00:55
152500 -- [-942.628] (-942.904) (-943.446) (-943.828) * (-943.635) (-946.930) [-942.554] (-941.395) -- 0:00:55
153000 -- (-950.303) (-942.420) [-942.564] (-948.596) * (-945.066) (-945.518) (-945.461) [-943.095] -- 0:00:55
153500 -- (-945.466) (-942.030) [-942.564] (-945.403) * (-945.066) [-942.233] (-942.375) (-941.753) -- 0:00:55
154000 -- (-949.265) (-942.751) (-946.108) [-943.255] * (-946.207) [-943.707] (-944.166) (-941.820) -- 0:00:54
154500 -- [-945.297] (-944.423) (-944.777) (-941.981) * (-943.142) (-942.374) [-943.637] (-941.572) -- 0:00:54
155000 -- [-945.721] (-942.460) (-942.416) (-945.489) * (-942.186) (-947.901) (-942.609) [-943.021] -- 0:00:54
Average standard deviation of split frequencies: 0.018886
155500 -- (-944.506) (-942.813) (-942.014) [-943.265] * (-943.396) (-943.648) (-943.011) [-942.281] -- 0:00:54
156000 -- (-944.535) (-946.192) (-944.628) [-942.899] * (-947.386) (-941.612) [-943.584] (-942.206) -- 0:00:54
156500 -- (-944.598) (-942.656) [-942.698] (-944.203) * [-943.470] (-945.209) (-946.615) (-942.111) -- 0:00:53
157000 -- (-942.918) (-942.956) (-942.382) [-942.423] * (-943.036) [-945.715] (-946.569) (-942.131) -- 0:00:53
157500 -- (-944.830) [-947.140] (-941.553) (-941.669) * (-942.917) [-941.479] (-944.565) (-943.827) -- 0:00:53
158000 -- (-943.480) [-947.263] (-943.103) (-943.353) * [-943.078] (-943.990) (-944.073) (-942.521) -- 0:00:53
158500 -- (-949.143) (-945.952) (-941.547) [-943.004] * [-944.406] (-942.583) (-945.838) (-945.013) -- 0:00:53
159000 -- (-946.154) [-945.126] (-942.175) (-941.460) * (-943.657) [-945.268] (-946.979) (-945.494) -- 0:00:52
159500 -- [-944.332] (-946.422) (-943.542) (-941.723) * (-946.928) (-947.764) (-942.846) [-945.397] -- 0:00:52
160000 -- (-943.415) (-943.753) [-941.906] (-944.098) * (-945.578) [-942.605] (-943.189) (-942.006) -- 0:00:52
Average standard deviation of split frequencies: 0.018631
160500 -- (-941.982) [-942.885] (-944.430) (-945.011) * [-941.946] (-947.454) (-942.079) (-942.433) -- 0:00:52
161000 -- [-943.157] (-945.082) (-946.720) (-942.944) * (-945.224) [-943.286] (-942.379) (-942.372) -- 0:00:52
161500 -- (-942.966) (-948.119) (-946.580) [-944.593] * (-945.742) (-942.825) (-942.630) [-943.807] -- 0:00:51
162000 -- [-943.344] (-947.909) (-942.056) (-943.737) * [-945.229] (-942.328) (-943.637) (-942.262) -- 0:00:51
162500 -- (-942.511) [-945.914] (-941.440) (-943.974) * (-943.924) [-942.534] (-942.448) (-944.321) -- 0:00:51
163000 -- (-942.338) [-941.533] (-943.526) (-942.659) * [-943.620] (-942.977) (-943.774) (-943.901) -- 0:00:51
163500 -- (-948.213) (-942.957) (-942.901) [-942.829] * [-944.588] (-949.491) (-944.561) (-943.117) -- 0:00:51
164000 -- (-950.710) (-944.062) [-941.737] (-947.882) * [-945.384] (-947.571) (-945.416) (-942.644) -- 0:00:50
164500 -- [-944.261] (-943.985) (-942.080) (-944.442) * [-942.473] (-945.653) (-944.680) (-942.082) -- 0:00:50
165000 -- (-945.293) (-946.714) (-942.084) [-943.213] * (-943.873) (-952.561) (-943.773) [-942.049] -- 0:00:50
Average standard deviation of split frequencies: 0.019879
165500 -- (-945.204) (-942.054) [-941.885] (-943.514) * [-943.678] (-943.388) (-944.062) (-943.812) -- 0:00:55
166000 -- (-944.289) (-943.003) [-942.728] (-944.287) * [-944.458] (-942.863) (-945.299) (-942.639) -- 0:00:55
166500 -- (-947.298) (-942.169) (-944.031) [-944.160] * (-941.333) (-943.319) [-948.880] (-942.081) -- 0:00:55
167000 -- (-946.521) (-944.258) (-944.926) [-943.423] * (-942.182) (-942.802) (-950.357) [-944.284] -- 0:00:54
167500 -- (-944.477) [-943.337] (-942.239) (-943.834) * (-947.446) (-942.199) [-945.853] (-945.857) -- 0:00:54
168000 -- (-943.895) (-944.966) [-944.776] (-942.452) * (-943.241) (-943.350) (-942.574) [-945.112] -- 0:00:54
168500 -- (-943.896) [-943.280] (-944.790) (-941.424) * (-943.893) (-942.428) [-942.395] (-943.403) -- 0:00:54
169000 -- (-941.288) (-944.637) [-942.964] (-943.867) * (-942.458) (-943.834) [-943.075] (-943.034) -- 0:00:54
169500 -- (-945.059) (-942.861) [-943.933] (-942.934) * (-942.406) (-946.268) [-943.578] (-946.508) -- 0:00:53
170000 -- [-942.076] (-942.766) (-943.488) (-944.261) * (-945.065) (-946.381) (-942.770) [-949.965] -- 0:00:53
Average standard deviation of split frequencies: 0.020256
170500 -- (-942.970) (-942.825) [-943.737] (-941.364) * (-949.133) (-944.680) (-943.738) [-948.396] -- 0:00:53
171000 -- (-943.557) [-944.439] (-941.278) (-941.592) * [-943.281] (-945.937) (-943.084) (-946.079) -- 0:00:53
171500 -- [-942.806] (-945.150) (-942.191) (-942.796) * (-943.990) [-943.187] (-945.442) (-947.815) -- 0:00:53
172000 -- (-948.050) [-943.117] (-942.381) (-943.850) * (-944.410) [-943.135] (-944.050) (-942.092) -- 0:00:52
172500 -- (-944.372) [-943.177] (-945.149) (-943.861) * (-944.376) [-943.392] (-943.225) (-944.952) -- 0:00:52
173000 -- (-943.693) [-944.007] (-944.753) (-945.286) * (-945.771) (-943.296) (-943.290) [-944.276] -- 0:00:52
173500 -- (-946.387) [-942.171] (-943.157) (-944.550) * [-943.345] (-942.503) (-944.369) (-943.252) -- 0:00:52
174000 -- (-945.208) (-942.877) (-942.946) [-941.477] * (-941.596) (-942.710) [-941.593] (-941.943) -- 0:00:52
174500 -- (-942.586) (-948.722) (-941.873) [-941.720] * (-942.447) [-942.220] (-941.841) (-943.499) -- 0:00:52
175000 -- [-947.163] (-942.581) (-941.533) (-942.994) * [-942.405] (-943.789) (-942.897) (-942.342) -- 0:00:51
Average standard deviation of split frequencies: 0.020864
175500 -- (-941.943) (-943.522) (-953.238) [-942.624] * (-947.316) (-946.372) (-943.500) [-942.716] -- 0:00:51
176000 -- (-942.772) (-944.725) (-950.271) [-942.457] * (-945.601) (-942.834) (-945.852) [-941.484] -- 0:00:51
176500 -- (-943.911) (-942.458) (-943.690) [-942.178] * (-943.683) [-942.714] (-944.498) (-942.536) -- 0:00:51
177000 -- (-941.832) [-942.046] (-944.054) (-943.624) * (-944.485) (-942.794) (-946.168) [-944.649] -- 0:00:51
177500 -- (-943.057) [-941.578] (-944.534) (-944.123) * (-942.211) (-943.231) (-942.961) [-944.955] -- 0:00:50
178000 -- (-942.399) (-942.398) (-943.986) [-945.039] * (-941.723) [-943.185] (-943.824) (-944.427) -- 0:00:50
178500 -- [-942.423] (-942.151) (-945.628) (-946.782) * (-942.159) (-943.914) [-944.401] (-944.680) -- 0:00:50
179000 -- (-943.033) (-942.290) (-942.855) [-943.650] * (-942.327) [-942.572] (-941.380) (-946.864) -- 0:00:50
179500 -- (-942.238) (-941.787) [-942.402] (-943.419) * (-946.534) [-941.462] (-941.915) (-943.441) -- 0:00:50
180000 -- (-942.148) (-943.358) (-942.453) [-942.548] * (-942.599) [-940.999] (-942.767) (-944.562) -- 0:00:50
Average standard deviation of split frequencies: 0.022324
180500 -- (-943.576) (-944.161) (-942.223) [-942.420] * (-945.097) [-941.007] (-943.275) (-941.800) -- 0:00:49
181000 -- (-943.182) (-944.147) (-942.457) [-942.482] * (-945.993) [-942.794] (-942.953) (-943.247) -- 0:00:49
181500 -- [-945.365] (-946.461) (-943.651) (-945.191) * (-941.366) (-944.708) [-941.601] (-944.186) -- 0:00:49
182000 -- [-942.235] (-945.099) (-946.911) (-944.541) * (-941.277) (-946.905) [-944.610] (-941.878) -- 0:00:53
182500 -- (-942.703) [-946.890] (-942.326) (-945.542) * (-943.051) [-944.019] (-946.245) (-944.986) -- 0:00:53
183000 -- (-941.300) (-942.036) [-942.652] (-943.840) * [-942.234] (-943.105) (-947.765) (-945.828) -- 0:00:53
183500 -- (-942.505) (-942.425) [-943.616] (-943.654) * [-941.555] (-941.776) (-948.734) (-944.871) -- 0:00:53
184000 -- (-941.594) (-943.136) (-941.809) [-941.841] * (-941.737) [-943.241] (-946.664) (-942.502) -- 0:00:53
184500 -- (-945.646) (-942.728) (-942.706) [-941.485] * (-945.113) (-942.528) (-947.330) [-944.523] -- 0:00:53
185000 -- (-947.028) [-943.780] (-943.532) (-941.616) * (-943.492) (-943.954) [-943.363] (-941.854) -- 0:00:52
Average standard deviation of split frequencies: 0.022176
185500 -- (-945.691) [-943.103] (-944.053) (-943.092) * (-943.017) [-942.483] (-945.595) (-949.141) -- 0:00:52
186000 -- [-944.184] (-942.409) (-943.895) (-942.573) * (-943.578) (-942.445) (-943.316) [-942.832] -- 0:00:52
186500 -- [-942.313] (-943.497) (-943.330) (-942.039) * (-943.037) [-945.122] (-943.793) (-942.587) -- 0:00:52
187000 -- [-941.105] (-944.256) (-943.332) (-941.915) * (-942.917) (-945.006) (-947.180) [-945.281] -- 0:00:52
187500 -- (-941.238) [-944.070] (-941.333) (-943.165) * (-945.418) (-944.051) (-944.217) [-945.188] -- 0:00:52
188000 -- (-942.220) (-943.997) [-941.407] (-942.438) * (-941.259) (-943.535) (-949.565) [-943.221] -- 0:00:51
188500 -- (-947.558) (-948.327) [-943.665] (-946.236) * (-942.764) (-943.360) (-945.081) [-943.009] -- 0:00:51
189000 -- (-942.624) (-944.343) [-944.904] (-943.154) * (-946.561) (-944.361) [-942.734] (-942.487) -- 0:00:51
189500 -- (-943.859) (-943.812) [-942.842] (-943.248) * (-945.929) [-944.041] (-942.620) (-943.173) -- 0:00:51
190000 -- (-947.624) [-947.047] (-945.297) (-945.326) * (-947.185) (-942.583) (-942.574) [-943.956] -- 0:00:51
Average standard deviation of split frequencies: 0.023488
190500 -- (-949.761) [-945.030] (-945.975) (-941.848) * (-946.372) (-943.611) (-944.629) [-942.667] -- 0:00:50
191000 -- (-943.667) (-944.076) (-942.633) [-942.288] * (-943.772) (-943.115) (-942.355) [-942.909] -- 0:00:50
191500 -- [-943.740] (-945.443) (-942.218) (-943.011) * (-943.304) (-941.882) [-941.591] (-943.849) -- 0:00:50
192000 -- (-943.934) (-942.812) (-945.272) [-943.347] * [-943.863] (-946.440) (-941.151) (-948.210) -- 0:00:50
192500 -- (-943.213) (-944.906) [-944.097] (-942.523) * (-944.761) (-944.271) [-943.322] (-943.555) -- 0:00:50
193000 -- (-943.161) [-943.712] (-946.653) (-941.475) * (-941.164) (-945.332) [-942.126] (-942.037) -- 0:00:50
193500 -- (-942.658) [-944.979] (-943.848) (-942.121) * [-941.164] (-944.096) (-944.497) (-941.976) -- 0:00:50
194000 -- (-942.422) [-946.761] (-944.529) (-943.311) * (-944.680) (-941.614) [-945.127] (-944.397) -- 0:00:49
194500 -- (-944.509) (-947.683) (-943.503) [-942.035] * (-942.120) [-942.551] (-944.061) (-943.855) -- 0:00:49
195000 -- (-942.449) [-944.596] (-947.111) (-941.898) * [-942.276] (-942.551) (-943.513) (-943.286) -- 0:00:49
Average standard deviation of split frequencies: 0.023250
195500 -- (-942.640) (-941.185) (-942.216) [-941.235] * (-941.602) (-943.452) (-942.224) [-942.611] -- 0:00:49
196000 -- (-943.817) (-944.066) [-942.336] (-943.082) * [-941.341] (-945.811) (-943.727) (-946.689) -- 0:00:49
196500 -- (-945.541) (-944.123) [-941.601] (-944.867) * (-941.620) (-948.653) (-941.360) [-943.990] -- 0:00:49
197000 -- (-944.181) (-943.705) [-942.351] (-943.119) * (-942.444) (-947.248) [-942.281] (-942.564) -- 0:00:48
197500 -- (-945.832) (-943.607) [-941.479] (-944.870) * (-942.501) [-946.434] (-944.398) (-942.184) -- 0:00:48
198000 -- (-942.821) [-942.917] (-942.312) (-951.740) * (-947.265) (-949.410) (-944.273) [-942.119] -- 0:00:48
198500 -- (-944.682) (-943.070) [-943.406] (-948.008) * (-943.819) (-943.234) [-944.716] (-942.821) -- 0:00:48
199000 -- (-944.768) (-942.040) (-942.578) [-942.288] * (-946.521) (-943.597) (-945.112) [-942.625] -- 0:00:52
199500 -- (-943.033) [-945.652] (-944.704) (-942.416) * (-945.925) (-947.342) (-948.166) [-942.809] -- 0:00:52
200000 -- (-941.889) (-944.346) (-942.935) [-942.533] * (-945.450) (-942.125) (-943.166) [-943.046] -- 0:00:51
Average standard deviation of split frequencies: 0.023245
200500 -- (-945.141) (-946.440) (-942.671) [-941.928] * (-945.155) (-944.224) (-942.372) [-942.926] -- 0:00:51
201000 -- (-945.428) (-945.278) (-944.083) [-944.095] * (-945.248) (-942.286) [-941.815] (-945.871) -- 0:00:51
201500 -- (-947.611) [-942.202] (-944.449) (-943.134) * (-942.571) (-943.566) (-942.331) [-945.483] -- 0:00:51
202000 -- (-943.649) (-942.731) [-941.282] (-944.146) * [-943.776] (-942.300) (-942.663) (-944.500) -- 0:00:51
202500 -- (-944.155) (-942.600) [-942.495] (-948.657) * (-943.779) (-945.350) (-942.614) [-942.760] -- 0:00:51
203000 -- (-943.326) (-942.489) [-942.233] (-948.264) * (-947.080) (-943.119) [-942.659] (-946.560) -- 0:00:51
203500 -- (-942.417) [-944.109] (-942.143) (-941.669) * (-944.063) (-944.299) (-946.645) [-942.840] -- 0:00:50
204000 -- (-942.224) (-945.996) (-944.071) [-943.716] * (-944.193) (-943.010) (-948.260) [-942.772] -- 0:00:50
204500 -- [-941.171] (-947.634) (-950.454) (-941.149) * (-943.975) (-941.949) [-943.432] (-945.875) -- 0:00:50
205000 -- (-942.549) (-946.749) [-941.396] (-941.326) * (-943.978) (-944.897) (-943.357) [-945.415] -- 0:00:50
Average standard deviation of split frequencies: 0.022402
205500 -- (-942.549) (-942.880) (-941.396) [-941.160] * [-945.261] (-942.167) (-944.590) (-946.201) -- 0:00:50
206000 -- (-944.395) [-943.758] (-942.353) (-945.636) * [-944.182] (-944.593) (-941.546) (-947.593) -- 0:00:50
206500 -- (-944.034) (-942.314) (-941.764) [-944.163] * (-943.351) [-945.377] (-946.451) (-942.635) -- 0:00:49
207000 -- (-943.829) (-943.312) [-943.595] (-943.910) * (-943.179) [-943.932] (-944.049) (-943.446) -- 0:00:49
207500 -- [-944.119] (-943.690) (-942.796) (-944.530) * (-943.340) [-942.233] (-945.233) (-943.220) -- 0:00:49
208000 -- (-945.326) (-942.591) (-941.678) [-943.576] * [-941.608] (-944.325) (-942.901) (-943.985) -- 0:00:49
208500 -- (-942.135) (-943.311) [-943.392] (-943.649) * (-941.322) (-946.080) (-943.674) [-941.953] -- 0:00:49
209000 -- (-945.031) [-942.850] (-942.383) (-949.605) * (-942.212) (-944.969) (-942.302) [-943.782] -- 0:00:49
209500 -- (-942.381) [-943.439] (-942.849) (-945.036) * (-942.124) [-942.966] (-944.138) (-943.670) -- 0:00:49
210000 -- (-942.905) [-943.861] (-941.410) (-944.711) * [-942.943] (-943.238) (-943.616) (-946.173) -- 0:00:48
Average standard deviation of split frequencies: 0.022495
210500 -- (-945.087) (-946.404) [-942.537] (-944.720) * [-943.204] (-943.459) (-944.692) (-948.282) -- 0:00:48
211000 -- (-944.507) (-949.293) (-943.817) [-945.282] * [-942.861] (-945.898) (-943.230) (-945.483) -- 0:00:48
211500 -- [-943.919] (-947.813) (-944.477) (-947.461) * (-942.712) (-946.204) (-947.668) [-949.391] -- 0:00:48
212000 -- [-942.431] (-947.673) (-942.532) (-944.605) * (-942.798) (-944.065) [-942.822] (-942.910) -- 0:00:48
212500 -- (-947.965) (-942.682) (-942.545) [-944.634] * (-943.841) [-945.024] (-942.035) (-941.806) -- 0:00:48
213000 -- (-943.296) (-942.314) (-945.740) [-942.635] * (-942.086) (-945.371) (-942.558) [-942.964] -- 0:00:48
213500 -- [-942.458] (-943.258) (-944.320) (-943.997) * (-942.086) (-942.873) [-943.106] (-942.281) -- 0:00:47
214000 -- (-943.672) (-941.576) (-944.329) [-943.158] * (-941.730) [-941.360] (-942.380) (-944.474) -- 0:00:47
214500 -- (-944.570) [-946.163] (-950.536) (-943.783) * (-947.561) (-943.377) (-942.571) [-943.566] -- 0:00:47
215000 -- (-943.351) (-941.995) [-942.648] (-942.038) * (-943.980) [-941.869] (-944.368) (-942.815) -- 0:00:47
Average standard deviation of split frequencies: 0.022513
215500 -- (-948.568) (-941.526) (-943.624) [-941.331] * (-947.540) [-942.159] (-942.365) (-947.298) -- 0:00:50
216000 -- [-948.648] (-942.959) (-948.410) (-942.135) * [-945.667] (-942.385) (-942.109) (-954.319) -- 0:00:50
216500 -- (-943.304) (-941.678) [-942.366] (-941.709) * (-947.094) (-942.120) [-942.639] (-948.874) -- 0:00:50
217000 -- (-942.680) (-943.128) (-942.511) [-943.428] * (-945.044) (-942.125) [-943.047] (-946.210) -- 0:00:50
217500 -- [-944.031] (-942.523) (-943.076) (-941.777) * (-942.062) [-943.813] (-941.442) (-943.248) -- 0:00:50
218000 -- (-942.168) [-944.318] (-943.129) (-943.194) * (-945.361) (-942.302) (-943.326) [-945.870] -- 0:00:50
218500 -- (-945.320) (-942.232) (-941.626) [-942.663] * (-944.488) [-943.032] (-941.467) (-945.171) -- 0:00:50
219000 -- (-948.220) (-942.187) (-943.892) [-942.221] * [-944.205] (-942.103) (-944.426) (-943.597) -- 0:00:49
219500 -- (-944.627) (-943.584) (-943.145) [-943.194] * (-947.058) (-942.740) [-943.669] (-942.085) -- 0:00:49
220000 -- (-942.775) (-944.185) (-943.335) [-944.357] * [-942.565] (-941.781) (-942.698) (-942.311) -- 0:00:49
Average standard deviation of split frequencies: 0.023618
220500 -- (-943.435) (-942.172) (-944.200) [-943.185] * [-942.631] (-942.380) (-946.553) (-945.030) -- 0:00:49
221000 -- [-943.170] (-943.961) (-943.444) (-942.570) * (-943.710) [-942.749] (-945.355) (-942.931) -- 0:00:49
221500 -- (-942.791) [-945.129] (-943.730) (-942.278) * (-943.055) [-943.034] (-942.507) (-943.585) -- 0:00:49
222000 -- [-941.893] (-945.379) (-942.322) (-943.381) * (-943.376) (-944.069) [-941.636] (-942.415) -- 0:00:49
222500 -- (-942.790) (-942.065) [-943.724] (-943.506) * (-943.498) [-943.699] (-943.603) (-943.157) -- 0:00:48
223000 -- (-944.908) (-942.935) [-943.012] (-944.952) * (-941.840) (-944.750) [-944.569] (-945.141) -- 0:00:48
223500 -- (-942.020) (-942.445) (-944.477) [-941.675] * (-944.488) (-942.252) (-944.959) [-943.721] -- 0:00:48
224000 -- (-942.479) [-942.545] (-942.797) (-942.222) * (-944.827) [-942.310] (-943.631) (-942.568) -- 0:00:48
224500 -- [-941.579] (-944.041) (-942.749) (-943.613) * [-942.326] (-945.967) (-945.038) (-944.214) -- 0:00:48
225000 -- [-943.117] (-944.003) (-941.748) (-943.559) * (-944.956) [-943.090] (-943.866) (-942.473) -- 0:00:48
Average standard deviation of split frequencies: 0.022505
225500 -- (-941.765) (-943.008) (-945.113) [-943.636] * [-942.607] (-945.970) (-944.141) (-944.881) -- 0:00:48
226000 -- (-942.489) (-943.023) [-942.444] (-945.724) * (-944.867) (-943.601) (-942.970) [-944.391] -- 0:00:47
226500 -- (-942.763) (-942.715) (-945.538) [-945.248] * (-942.161) (-941.956) [-941.463] (-942.421) -- 0:00:47
227000 -- (-942.832) (-948.313) (-945.247) [-944.208] * [-943.116] (-942.025) (-944.219) (-947.830) -- 0:00:47
227500 -- (-944.443) (-944.711) (-943.235) [-942.312] * [-945.785] (-941.201) (-945.791) (-943.313) -- 0:00:47
228000 -- (-944.558) (-941.347) [-942.290] (-943.181) * (-948.214) (-941.369) (-942.395) [-944.596] -- 0:00:47
228500 -- (-943.155) (-941.683) [-944.737] (-942.248) * (-948.336) (-942.394) (-944.050) [-943.947] -- 0:00:47
229000 -- (-942.222) [-941.748] (-942.071) (-941.810) * (-944.121) [-942.740] (-941.860) (-945.418) -- 0:00:47
229500 -- (-942.791) (-942.616) (-944.745) [-942.961] * (-942.734) (-941.917) (-941.249) [-942.890] -- 0:00:47
230000 -- (-943.863) (-944.646) [-942.837] (-941.719) * (-945.761) [-943.476] (-942.162) (-943.061) -- 0:00:46
Average standard deviation of split frequencies: 0.022841
230500 -- (-942.232) (-944.603) (-942.549) [-945.362] * (-943.344) (-944.138) (-943.618) [-942.697] -- 0:00:46
231000 -- [-941.715] (-943.175) (-943.646) (-944.157) * (-943.455) (-945.048) (-943.611) [-942.963] -- 0:00:46
231500 -- (-941.292) (-946.601) [-942.510] (-943.552) * (-945.135) (-943.524) [-944.865] (-943.157) -- 0:00:46
232000 -- (-942.239) [-946.083] (-941.667) (-943.376) * (-942.291) [-943.130] (-944.132) (-942.837) -- 0:00:49
232500 -- [-943.657] (-944.599) (-942.637) (-941.954) * (-943.097) (-945.388) [-944.277] (-942.913) -- 0:00:49
233000 -- (-942.022) [-941.878] (-945.840) (-941.747) * (-944.922) [-944.455] (-945.183) (-945.097) -- 0:00:49
233500 -- (-942.087) (-941.971) [-947.673] (-941.363) * (-943.554) (-941.396) (-948.144) [-944.026] -- 0:00:49
234000 -- [-943.501] (-942.304) (-950.479) (-944.541) * (-943.579) (-944.489) (-942.322) [-943.044] -- 0:00:49
234500 -- (-943.335) [-945.580] (-944.690) (-943.977) * [-941.277] (-941.647) (-943.410) (-942.525) -- 0:00:48
235000 -- (-946.168) (-943.965) [-942.832] (-943.398) * (-945.240) (-941.274) (-948.128) [-944.889] -- 0:00:48
Average standard deviation of split frequencies: 0.022795
235500 -- (-945.438) (-942.145) [-941.425] (-941.637) * (-942.012) [-941.663] (-944.346) (-952.381) -- 0:00:48
236000 -- (-944.395) [-941.650] (-944.126) (-942.630) * [-945.958] (-942.270) (-946.703) (-949.779) -- 0:00:48
236500 -- (-945.339) (-942.410) [-942.367] (-942.710) * (-945.547) (-941.788) (-942.835) [-944.083] -- 0:00:48
237000 -- [-943.340] (-943.645) (-943.996) (-944.976) * [-946.063] (-942.624) (-948.951) (-942.123) -- 0:00:48
237500 -- (-944.004) (-942.141) [-943.459] (-942.135) * (-945.560) [-942.883] (-941.836) (-945.145) -- 0:00:48
238000 -- (-945.727) [-943.385] (-945.688) (-941.398) * [-941.923] (-943.624) (-943.411) (-942.070) -- 0:00:48
238500 -- (-942.900) (-944.169) (-942.639) [-943.610] * (-941.399) (-944.412) [-944.854] (-942.165) -- 0:00:47
239000 -- (-942.523) (-947.800) (-941.578) [-942.514] * (-942.649) (-942.806) [-942.281] (-944.047) -- 0:00:47
239500 -- (-944.076) (-944.886) (-941.145) [-941.853] * (-941.161) (-946.458) [-942.113] (-942.129) -- 0:00:47
240000 -- (-942.521) (-945.190) [-941.301] (-941.950) * (-941.347) (-941.236) [-942.318] (-943.744) -- 0:00:47
Average standard deviation of split frequencies: 0.021777
240500 -- (-944.714) (-942.218) (-945.053) [-941.510] * (-941.377) [-941.404] (-943.305) (-942.010) -- 0:00:47
241000 -- (-945.532) [-945.916] (-943.772) (-944.449) * (-943.999) [-941.742] (-941.783) (-944.670) -- 0:00:47
241500 -- (-944.836) (-942.850) (-943.764) [-944.331] * (-943.827) (-942.487) [-943.133] (-943.310) -- 0:00:47
242000 -- (-944.048) [-941.124] (-943.298) (-942.312) * [-944.814] (-944.093) (-943.826) (-943.833) -- 0:00:46
242500 -- (-942.549) [-941.705] (-942.650) (-943.750) * (-950.089) (-942.446) [-942.752] (-943.840) -- 0:00:46
243000 -- [-943.019] (-942.543) (-944.610) (-944.654) * (-947.411) [-942.671] (-942.251) (-943.210) -- 0:00:46
243500 -- (-946.820) [-946.056] (-948.612) (-941.878) * [-943.079] (-943.483) (-942.248) (-950.644) -- 0:00:46
244000 -- (-950.570) (-943.155) (-944.468) [-941.873] * (-944.083) [-944.227] (-943.177) (-955.678) -- 0:00:46
244500 -- (-945.697) (-941.775) [-947.082] (-946.489) * (-942.561) [-943.067] (-942.819) (-946.403) -- 0:00:46
245000 -- (-944.894) (-942.335) [-943.551] (-942.054) * (-943.263) [-947.298] (-943.367) (-945.207) -- 0:00:46
Average standard deviation of split frequencies: 0.020515
245500 -- (-943.618) (-944.027) (-947.009) [-941.729] * (-942.083) [-943.643] (-942.371) (-943.110) -- 0:00:46
246000 -- [-942.473] (-945.494) (-946.194) (-944.317) * (-943.987) (-949.231) [-941.681] (-942.512) -- 0:00:45
246500 -- (-944.150) (-942.251) (-946.789) [-943.950] * (-942.119) (-944.681) (-945.484) [-946.388] -- 0:00:45
247000 -- (-943.354) [-942.057] (-949.753) (-944.097) * (-941.776) (-943.549) [-943.507] (-944.201) -- 0:00:45
247500 -- (-942.616) [-941.570] (-945.206) (-943.762) * (-942.685) (-947.757) (-947.387) [-944.088] -- 0:00:45
248000 -- (-943.755) (-941.808) (-943.044) [-945.083] * (-944.942) (-946.342) (-944.528) [-943.644] -- 0:00:45
248500 -- (-943.239) (-941.978) (-944.826) [-941.690] * (-944.308) (-944.913) (-942.187) [-947.532] -- 0:00:48
249000 -- (-945.421) (-942.250) [-942.376] (-942.215) * (-943.849) (-945.916) (-941.842) [-943.835] -- 0:00:48
249500 -- (-943.563) (-942.113) (-941.922) [-943.269] * (-944.555) (-944.204) (-941.842) [-941.345] -- 0:00:48
250000 -- [-944.050] (-945.634) (-942.291) (-942.832) * (-944.357) (-944.333) (-943.881) [-941.592] -- 0:00:48
Average standard deviation of split frequencies: 0.019802
250500 -- (-948.664) (-945.576) (-949.590) [-942.208] * [-942.499] (-946.333) (-945.170) (-943.639) -- 0:00:47
251000 -- (-944.666) (-942.699) [-949.788] (-944.122) * (-942.498) [-945.061] (-946.710) (-943.972) -- 0:00:47
251500 -- (-942.831) (-942.639) (-948.429) [-942.912] * (-944.027) (-949.064) (-949.888) [-941.286] -- 0:00:47
252000 -- (-942.879) [-943.238] (-941.735) (-943.874) * (-944.238) [-949.733] (-948.008) (-941.551) -- 0:00:47
252500 -- (-943.765) (-942.629) [-942.795] (-943.140) * (-943.899) (-943.259) [-941.123] (-942.537) -- 0:00:47
253000 -- (-944.134) (-943.597) (-942.824) [-943.612] * (-942.549) (-944.592) (-943.260) [-946.763] -- 0:00:47
253500 -- (-941.614) (-942.278) (-942.520) [-943.329] * (-942.751) (-944.283) [-945.342] (-945.107) -- 0:00:47
254000 -- (-941.659) (-941.796) (-941.936) [-943.953] * [-941.764] (-943.208) (-942.369) (-942.881) -- 0:00:46
254500 -- (-941.809) (-943.142) [-942.863] (-942.475) * (-942.553) [-942.258] (-943.589) (-947.760) -- 0:00:46
255000 -- (-942.172) (-943.125) [-942.523] (-943.537) * (-943.024) [-944.733] (-943.097) (-944.927) -- 0:00:46
Average standard deviation of split frequencies: 0.018990
255500 -- (-941.814) (-943.566) [-945.945] (-945.016) * [-945.511] (-943.423) (-944.176) (-947.361) -- 0:00:46
256000 -- (-941.732) (-943.690) [-943.441] (-943.191) * (-944.867) (-943.527) (-943.159) [-943.224] -- 0:00:46
256500 -- (-943.569) (-944.765) (-942.466) [-943.730] * (-945.354) (-945.040) (-945.981) [-942.068] -- 0:00:46
257000 -- [-941.615] (-945.172) (-944.351) (-948.685) * (-944.103) (-949.312) (-945.706) [-942.149] -- 0:00:46
257500 -- (-942.496) [-942.910] (-945.611) (-946.154) * (-946.417) (-945.010) (-950.010) [-942.532] -- 0:00:46
258000 -- (-943.748) (-942.196) (-945.044) [-943.326] * [-943.963] (-942.778) (-941.798) (-946.142) -- 0:00:46
258500 -- (-943.207) (-942.436) [-946.694] (-942.739) * [-943.853] (-945.884) (-943.621) (-942.088) -- 0:00:45
259000 -- (-943.473) (-943.382) (-946.276) [-941.533] * [-945.182] (-942.523) (-946.321) (-942.160) -- 0:00:45
259500 -- (-944.510) [-942.865] (-944.862) (-943.720) * (-943.973) (-942.859) [-946.288] (-946.307) -- 0:00:45
260000 -- (-942.775) (-944.220) [-946.882] (-944.867) * (-944.735) (-944.532) [-941.954] (-944.544) -- 0:00:45
Average standard deviation of split frequencies: 0.018311
260500 -- (-942.823) (-943.124) (-942.479) [-944.089] * [-943.785] (-945.470) (-942.384) (-944.671) -- 0:00:45
261000 -- (-942.669) (-945.459) (-943.069) [-942.701] * (-943.111) (-942.803) [-942.529] (-944.648) -- 0:00:45
261500 -- [-943.215] (-947.459) (-943.836) (-944.252) * (-942.778) (-945.211) [-943.279] (-946.475) -- 0:00:45
262000 -- (-944.517) (-945.504) (-942.649) [-943.954] * (-946.205) (-941.574) [-941.675] (-944.513) -- 0:00:45
262500 -- (-941.968) [-942.590] (-945.364) (-945.207) * (-942.320) (-943.856) [-941.534] (-943.643) -- 0:00:44
263000 -- [-942.998] (-943.448) (-944.127) (-943.456) * (-942.197) (-943.973) [-942.341] (-942.849) -- 0:00:44
263500 -- (-942.926) (-942.619) [-942.154] (-946.820) * (-943.721) (-943.937) [-943.027] (-947.949) -- 0:00:44
264000 -- (-949.346) (-941.932) [-941.771] (-944.088) * (-941.377) (-942.248) [-942.600] (-943.479) -- 0:00:44
264500 -- (-945.056) (-942.089) (-941.882) [-941.870] * (-941.984) (-944.918) [-942.701] (-941.917) -- 0:00:44
265000 -- (-946.209) (-943.175) [-942.533] (-941.785) * [-941.805] (-947.647) (-943.553) (-944.037) -- 0:00:47
Average standard deviation of split frequencies: 0.019790
265500 -- (-945.461) (-943.762) (-944.449) [-945.728] * [-943.887] (-945.096) (-944.666) (-943.153) -- 0:00:47
266000 -- [-944.211] (-945.143) (-943.868) (-947.247) * (-943.637) (-942.415) [-944.128] (-945.446) -- 0:00:46
266500 -- (-946.208) [-944.964] (-944.804) (-942.983) * (-943.370) [-941.864] (-943.491) (-953.373) -- 0:00:46
267000 -- (-946.991) [-941.940] (-943.644) (-943.211) * (-944.863) [-942.003] (-942.091) (-945.274) -- 0:00:46
267500 -- (-941.801) (-943.323) [-944.937] (-943.418) * (-942.598) (-943.916) (-941.777) [-942.803] -- 0:00:46
268000 -- (-942.760) (-942.642) [-943.538] (-942.199) * (-941.971) [-943.456] (-945.135) (-943.427) -- 0:00:46
268500 -- (-941.911) (-942.961) [-944.066] (-942.406) * [-942.174] (-942.611) (-942.762) (-946.991) -- 0:00:46
269000 -- (-945.486) (-943.192) [-944.051] (-942.911) * (-943.020) (-944.541) (-948.630) [-943.940] -- 0:00:46
269500 -- [-941.592] (-942.673) (-944.703) (-941.645) * (-943.107) (-943.088) [-941.479] (-942.929) -- 0:00:46
270000 -- [-943.166] (-941.939) (-942.847) (-942.941) * (-943.262) (-944.669) [-942.424] (-945.542) -- 0:00:45
Average standard deviation of split frequencies: 0.019363
270500 -- (-943.582) [-941.819] (-942.334) (-943.377) * (-941.633) (-944.368) (-944.904) [-942.473] -- 0:00:45
271000 -- (-943.396) (-942.958) (-943.801) [-944.053] * [-941.833] (-945.052) (-942.171) (-944.078) -- 0:00:45
271500 -- [-943.473] (-944.685) (-947.799) (-942.100) * (-943.907) (-948.031) (-941.777) [-942.352] -- 0:00:45
272000 -- (-943.006) (-946.980) (-941.885) [-943.212] * [-942.176] (-943.345) (-941.207) (-942.979) -- 0:00:45
272500 -- (-946.069) (-943.149) [-941.246] (-944.361) * [-942.826] (-942.939) (-941.936) (-946.363) -- 0:00:45
273000 -- (-945.419) [-943.604] (-942.771) (-948.521) * (-943.606) [-942.234] (-943.538) (-944.268) -- 0:00:45
273500 -- (-945.577) [-943.324] (-942.900) (-943.768) * (-947.158) [-944.013] (-944.028) (-944.265) -- 0:00:45
274000 -- (-948.156) [-942.165] (-944.237) (-941.681) * [-942.135] (-942.853) (-942.425) (-942.435) -- 0:00:45
274500 -- (-947.353) (-943.003) [-944.035] (-942.428) * (-948.495) [-944.670] (-944.306) (-942.979) -- 0:00:44
275000 -- [-942.775] (-944.653) (-947.576) (-942.941) * (-946.166) (-946.107) (-947.272) [-944.146] -- 0:00:44
Average standard deviation of split frequencies: 0.018687
275500 -- (-942.293) [-947.109] (-947.043) (-945.870) * (-944.421) [-946.941] (-943.739) (-945.354) -- 0:00:44
276000 -- (-945.616) (-943.236) [-943.999] (-946.815) * [-941.784] (-945.028) (-944.522) (-947.182) -- 0:00:44
276500 -- (-942.734) [-941.672] (-943.905) (-941.926) * (-943.879) (-945.417) [-943.175] (-945.432) -- 0:00:44
277000 -- (-942.682) [-944.817] (-949.096) (-942.554) * (-943.784) [-942.111] (-941.690) (-942.084) -- 0:00:44
277500 -- (-942.398) (-941.361) (-941.283) [-942.479] * (-941.298) [-943.560] (-945.083) (-944.266) -- 0:00:44
278000 -- (-947.011) (-942.797) (-942.276) [-941.375] * (-944.731) (-944.621) (-943.919) [-943.404] -- 0:00:44
278500 -- (-945.022) (-945.304) (-942.656) [-943.402] * (-942.322) (-946.190) (-943.635) [-942.623] -- 0:00:44
279000 -- (-941.708) (-946.151) [-943.842] (-941.475) * (-943.062) [-942.472] (-943.500) (-941.336) -- 0:00:43
279500 -- (-941.817) (-941.335) (-945.006) [-941.935] * (-945.302) (-942.672) [-944.754] (-942.274) -- 0:00:43
280000 -- (-942.530) [-941.977] (-944.796) (-945.033) * (-942.828) [-941.981] (-946.733) (-943.016) -- 0:00:43
Average standard deviation of split frequencies: 0.018289
280500 -- (-942.352) (-944.271) [-942.343] (-943.682) * [-942.910] (-947.102) (-944.822) (-942.544) -- 0:00:43
281000 -- (-942.370) (-945.835) [-942.366] (-943.360) * (-943.724) [-944.910] (-947.826) (-942.243) -- 0:00:43
281500 -- (-942.498) (-944.389) (-941.634) [-942.407] * (-945.414) [-942.181] (-945.558) (-942.598) -- 0:00:43
282000 -- (-946.784) (-943.029) [-942.457] (-942.489) * (-946.948) [-944.113] (-942.353) (-942.076) -- 0:00:45
282500 -- (-943.061) [-942.883] (-944.316) (-946.202) * (-942.977) (-944.441) [-944.180] (-946.771) -- 0:00:45
283000 -- (-942.617) [-942.946] (-942.784) (-942.411) * [-944.717] (-943.593) (-944.025) (-947.300) -- 0:00:45
283500 -- (-944.010) (-943.440) (-946.880) [-941.761] * (-942.876) (-942.438) [-943.240] (-946.006) -- 0:00:45
284000 -- (-946.177) (-943.645) (-944.566) [-942.307] * (-944.137) (-945.119) [-941.075] (-944.373) -- 0:00:45
284500 -- (-942.811) [-944.156] (-945.635) (-943.111) * (-942.253) (-945.392) [-944.085] (-943.876) -- 0:00:45
285000 -- (-945.475) (-943.112) [-943.456] (-945.452) * [-944.267] (-942.810) (-944.047) (-943.517) -- 0:00:45
Average standard deviation of split frequencies: 0.017582
285500 -- [-942.588] (-942.692) (-942.782) (-947.659) * (-946.771) (-943.173) (-942.050) [-941.360] -- 0:00:45
286000 -- [-942.656] (-942.953) (-943.094) (-943.001) * [-943.761] (-941.758) (-946.811) (-941.514) -- 0:00:44
286500 -- (-942.385) (-943.055) (-945.170) [-942.260] * (-942.316) [-941.271] (-944.856) (-942.381) -- 0:00:44
287000 -- (-942.201) (-944.585) [-948.638] (-945.649) * (-942.660) [-942.056] (-944.274) (-942.511) -- 0:00:44
287500 -- (-941.933) (-944.477) [-942.248] (-943.748) * (-945.313) [-943.057] (-942.909) (-944.128) -- 0:00:44
288000 -- (-942.108) (-944.871) (-943.076) [-942.017] * (-942.509) [-942.897] (-944.781) (-942.122) -- 0:00:44
288500 -- (-942.106) [-944.060] (-942.058) (-941.983) * (-941.991) [-945.251] (-944.590) (-942.622) -- 0:00:44
289000 -- (-942.413) [-943.105] (-941.694) (-941.393) * (-941.945) [-943.646] (-942.633) (-943.689) -- 0:00:44
289500 -- (-941.446) (-941.310) [-944.824] (-945.075) * [-943.136] (-944.551) (-943.636) (-943.340) -- 0:00:44
290000 -- [-941.773] (-941.338) (-943.643) (-943.540) * [-942.105] (-943.528) (-948.295) (-942.829) -- 0:00:44
Average standard deviation of split frequencies: 0.018110
290500 -- (-941.978) (-944.443) [-945.193] (-941.605) * (-947.352) (-942.797) (-944.655) [-942.788] -- 0:00:43
291000 -- [-942.114] (-943.000) (-944.304) (-943.108) * [-943.535] (-942.306) (-945.596) (-942.162) -- 0:00:43
291500 -- (-941.725) (-945.187) (-945.449) [-942.611] * [-943.534] (-942.528) (-944.865) (-941.227) -- 0:00:43
292000 -- (-942.830) (-941.188) [-942.426] (-942.506) * (-941.657) (-942.353) (-946.423) [-943.771] -- 0:00:43
292500 -- (-943.132) (-943.154) [-941.737] (-943.213) * [-942.451] (-945.091) (-943.631) (-942.330) -- 0:00:43
293000 -- (-944.097) [-944.586] (-941.982) (-945.576) * [-943.141] (-945.136) (-942.889) (-941.632) -- 0:00:43
293500 -- (-943.017) (-946.199) (-942.265) [-945.366] * [-941.916] (-943.091) (-945.100) (-943.242) -- 0:00:43
294000 -- (-943.395) (-944.343) (-941.940) [-943.776] * (-941.651) (-941.993) [-945.020] (-942.449) -- 0:00:43
294500 -- [-941.845] (-945.286) (-943.046) (-949.874) * (-942.425) (-942.413) (-946.849) [-941.731] -- 0:00:43
295000 -- (-947.732) [-946.306] (-944.296) (-943.478) * (-941.749) (-943.011) (-942.757) [-942.289] -- 0:00:43
Average standard deviation of split frequencies: 0.017695
295500 -- (-944.255) (-945.734) [-943.391] (-946.677) * (-941.923) (-943.057) (-946.346) [-945.015] -- 0:00:42
296000 -- (-943.002) (-945.980) [-944.052] (-945.531) * (-943.121) [-942.570] (-942.687) (-943.941) -- 0:00:42
296500 -- (-942.245) (-943.882) (-945.821) [-943.951] * (-943.150) [-942.655] (-950.624) (-942.160) -- 0:00:42
297000 -- (-941.992) (-943.868) (-943.610) [-942.026] * [-941.371] (-946.317) (-942.980) (-944.802) -- 0:00:42
297500 -- (-947.064) [-943.043] (-942.245) (-945.343) * (-946.053) (-942.785) (-945.150) [-943.385] -- 0:00:42
298000 -- (-946.848) [-943.492] (-942.732) (-942.673) * (-944.473) (-942.354) (-945.347) [-942.064] -- 0:00:42
298500 -- (-944.966) (-941.924) (-943.907) [-943.187] * [-947.237] (-944.110) (-944.949) (-943.957) -- 0:00:44
299000 -- (-942.334) (-941.705) (-944.186) [-942.603] * (-944.177) [-942.521] (-942.969) (-944.795) -- 0:00:44
299500 -- (-942.404) (-943.904) [-942.248] (-944.521) * (-941.998) [-944.047] (-942.365) (-944.553) -- 0:00:44
300000 -- (-942.689) (-942.679) (-944.624) [-942.175] * [-942.156] (-944.395) (-942.200) (-945.574) -- 0:00:44
Average standard deviation of split frequencies: 0.017339
300500 -- (-943.425) [-942.947] (-949.498) (-946.654) * (-943.364) [-947.454] (-945.428) (-945.092) -- 0:00:44
301000 -- (-942.244) (-942.898) [-943.552] (-942.612) * (-943.467) (-947.922) [-942.434] (-942.350) -- 0:00:44
301500 -- (-943.000) (-945.302) (-943.350) [-941.884] * (-943.022) (-942.184) (-942.869) [-942.306] -- 0:00:44
302000 -- (-946.731) [-944.498] (-943.235) (-944.146) * (-941.660) [-943.334] (-943.684) (-945.291) -- 0:00:43
302500 -- (-942.598) (-948.978) [-943.105] (-942.163) * (-944.384) [-945.734] (-942.675) (-942.579) -- 0:00:43
303000 -- (-944.439) (-946.302) (-942.411) [-941.220] * (-943.941) (-942.808) (-942.901) [-945.061] -- 0:00:43
303500 -- (-941.579) (-942.149) [-942.577] (-943.195) * (-944.297) [-945.608] (-943.279) (-944.999) -- 0:00:43
304000 -- (-942.112) (-945.162) [-943.032] (-942.809) * [-943.212] (-942.692) (-949.319) (-946.176) -- 0:00:43
304500 -- (-942.247) (-947.346) (-944.236) [-943.480] * (-946.459) (-941.959) (-942.688) [-944.662] -- 0:00:43
305000 -- (-943.486) (-942.419) [-943.114] (-945.952) * (-944.334) (-943.003) [-944.219] (-942.697) -- 0:00:43
Average standard deviation of split frequencies: 0.017117
305500 -- (-944.122) (-942.411) (-941.421) [-944.537] * (-943.009) (-945.918) (-941.679) [-942.849] -- 0:00:43
306000 -- (-942.212) (-941.487) [-944.540] (-946.814) * (-945.217) (-945.021) [-941.679] (-943.360) -- 0:00:43
306500 -- [-944.137] (-941.029) (-942.077) (-942.104) * (-943.191) [-944.841] (-945.802) (-944.320) -- 0:00:42
307000 -- (-947.096) (-942.058) [-943.066] (-948.200) * (-943.618) [-942.802] (-944.418) (-944.278) -- 0:00:42
307500 -- (-943.475) (-942.723) [-943.455] (-952.980) * (-946.779) (-944.338) (-943.905) [-942.916] -- 0:00:42
308000 -- [-943.136] (-941.757) (-945.015) (-950.520) * [-944.995] (-941.700) (-947.217) (-943.417) -- 0:00:42
308500 -- (-945.127) (-941.895) [-947.360] (-944.447) * (-944.789) (-942.190) (-946.234) [-942.252] -- 0:00:42
309000 -- (-945.245) (-941.880) [-945.283] (-942.873) * (-945.328) [-943.109] (-944.836) (-942.523) -- 0:00:42
309500 -- [-944.874] (-942.036) (-946.898) (-943.120) * [-944.062] (-942.278) (-946.242) (-943.278) -- 0:00:42
310000 -- (-944.104) [-943.869] (-946.372) (-944.938) * (-943.240) (-944.038) (-946.081) [-944.233] -- 0:00:42
Average standard deviation of split frequencies: 0.017619
310500 -- [-942.647] (-942.039) (-944.618) (-946.769) * (-943.209) [-943.046] (-947.097) (-943.368) -- 0:00:42
311000 -- (-943.524) [-942.626] (-943.211) (-942.312) * (-945.292) (-942.702) (-947.446) [-942.038] -- 0:00:42
311500 -- (-943.594) [-941.929] (-942.675) (-943.585) * (-944.540) [-941.615] (-942.667) (-942.785) -- 0:00:41
312000 -- (-943.519) (-942.633) (-942.921) [-945.336] * [-942.848] (-943.840) (-945.881) (-943.451) -- 0:00:41
312500 -- [-947.154] (-943.692) (-941.938) (-943.788) * (-946.196) (-942.619) (-941.653) [-943.439] -- 0:00:41
313000 -- (-946.491) (-942.533) (-942.781) [-942.182] * (-942.947) (-942.502) (-941.987) [-941.803] -- 0:00:41
313500 -- (-943.422) (-945.245) [-942.147] (-941.709) * (-943.630) (-941.853) [-942.598] (-944.491) -- 0:00:41
314000 -- (-947.177) (-943.130) [-945.281] (-941.709) * (-944.461) [-943.143] (-944.321) (-941.722) -- 0:00:41
314500 -- (-944.636) (-943.084) [-942.160] (-942.628) * (-946.706) (-948.315) (-948.282) [-942.752] -- 0:00:41
315000 -- (-942.170) [-948.794] (-942.337) (-944.712) * (-943.367) (-945.689) [-942.566] (-942.704) -- 0:00:43
Average standard deviation of split frequencies: 0.018316
315500 -- (-945.516) (-945.985) [-943.036] (-945.813) * [-941.309] (-944.101) (-943.048) (-942.415) -- 0:00:43
316000 -- (-942.852) (-942.683) (-945.361) [-943.096] * (-941.676) (-944.018) [-942.365] (-943.376) -- 0:00:43
316500 -- (-943.530) (-944.944) [-945.580] (-945.367) * (-943.658) (-944.230) [-941.191] (-948.473) -- 0:00:43
317000 -- (-943.916) (-943.340) (-942.603) [-946.664] * (-942.482) (-944.240) [-941.586] (-943.984) -- 0:00:43
317500 -- (-944.399) (-944.297) [-941.975] (-948.339) * (-943.003) [-943.119] (-946.354) (-944.567) -- 0:00:42
318000 -- (-944.452) (-943.365) [-941.938] (-943.736) * [-942.596] (-946.082) (-946.596) (-944.632) -- 0:00:42
318500 -- (-943.011) (-943.634) (-941.711) [-945.914] * (-944.170) (-944.788) (-947.573) [-941.946] -- 0:00:42
319000 -- (-941.931) [-945.688] (-941.277) (-942.516) * [-943.604] (-945.530) (-945.237) (-944.219) -- 0:00:42
319500 -- (-943.954) (-941.884) [-941.697] (-950.511) * (-941.840) [-942.599] (-943.738) (-943.728) -- 0:00:42
320000 -- (-942.708) [-942.550] (-944.675) (-943.650) * (-944.548) (-944.850) [-943.438] (-946.459) -- 0:00:42
Average standard deviation of split frequencies: 0.018621
320500 -- [-942.609] (-943.834) (-942.992) (-942.384) * [-942.410] (-946.835) (-946.732) (-944.665) -- 0:00:42
321000 -- [-943.861] (-942.480) (-943.681) (-942.800) * (-941.560) [-944.521] (-942.252) (-943.269) -- 0:00:42
321500 -- (-942.490) (-942.202) (-946.409) [-944.498] * [-941.852] (-944.265) (-943.283) (-947.223) -- 0:00:42
322000 -- (-941.723) [-942.155] (-943.856) (-944.369) * [-943.556] (-942.899) (-943.075) (-943.941) -- 0:00:42
322500 -- [-942.529] (-943.233) (-947.843) (-944.833) * (-944.268) (-941.495) (-943.137) [-944.016] -- 0:00:42
323000 -- (-942.679) (-944.917) [-944.208] (-945.455) * (-949.498) [-943.504] (-945.880) (-946.768) -- 0:00:41
323500 -- (-944.486) (-944.822) (-942.455) [-943.261] * [-942.263] (-946.523) (-944.848) (-952.371) -- 0:00:41
324000 -- (-945.877) (-945.331) (-944.127) [-943.099] * [-943.177] (-944.348) (-942.891) (-944.716) -- 0:00:41
324500 -- [-944.500] (-945.175) (-942.097) (-943.668) * (-944.243) (-944.015) (-945.630) [-944.272] -- 0:00:41
325000 -- [-945.675] (-943.432) (-945.563) (-942.872) * (-943.187) [-941.785] (-943.569) (-943.701) -- 0:00:41
Average standard deviation of split frequencies: 0.019200
325500 -- [-941.866] (-942.539) (-943.670) (-943.133) * (-941.508) (-945.300) [-943.824] (-943.880) -- 0:00:41
326000 -- (-942.634) [-942.300] (-945.067) (-945.028) * (-943.476) [-945.569] (-943.480) (-945.016) -- 0:00:41
326500 -- (-941.988) (-943.863) [-944.520] (-947.103) * (-944.888) (-944.105) [-943.556] (-946.839) -- 0:00:41
327000 -- (-942.711) (-943.727) (-944.435) [-941.596] * (-942.222) (-945.304) (-942.533) [-947.923] -- 0:00:41
327500 -- (-941.808) [-941.750] (-943.798) (-943.357) * (-941.441) (-945.247) [-944.313] (-948.300) -- 0:00:41
328000 -- (-945.320) [-941.853] (-949.307) (-943.513) * (-943.290) [-943.098] (-944.416) (-945.066) -- 0:00:40
328500 -- (-943.873) (-943.632) [-942.129] (-943.363) * (-943.108) [-944.431] (-946.719) (-944.160) -- 0:00:40
329000 -- (-945.902) (-948.510) [-944.045] (-945.899) * (-943.723) (-942.211) (-942.530) [-943.624] -- 0:00:40
329500 -- [-943.429] (-942.334) (-941.552) (-944.000) * (-944.695) [-944.676] (-945.902) (-944.823) -- 0:00:40
330000 -- [-942.724] (-943.791) (-941.390) (-946.254) * (-946.156) [-941.181] (-943.118) (-947.299) -- 0:00:40
Average standard deviation of split frequencies: 0.018533
330500 -- (-945.570) (-942.124) [-941.352] (-943.468) * (-942.437) (-941.563) [-941.550] (-943.707) -- 0:00:40
331000 -- (-943.533) (-942.064) [-943.313] (-943.372) * [-943.418] (-941.814) (-941.618) (-941.914) -- 0:00:40
331500 -- [-944.400] (-941.957) (-942.460) (-944.301) * [-943.269] (-943.691) (-942.507) (-941.701) -- 0:00:42
332000 -- (-942.388) [-942.126] (-942.874) (-947.549) * [-943.480] (-946.247) (-944.111) (-943.158) -- 0:00:42
332500 -- (-942.926) (-941.905) (-942.024) [-945.587] * (-942.170) (-943.451) (-944.585) [-942.327] -- 0:00:42
333000 -- (-943.191) (-942.375) [-945.006] (-943.152) * [-942.299] (-942.440) (-944.732) (-943.669) -- 0:00:42
333500 -- (-945.778) [-942.810] (-942.936) (-943.791) * (-942.220) (-942.072) [-947.030] (-941.971) -- 0:00:41
334000 -- (-945.177) (-942.563) [-943.279] (-949.410) * (-944.492) [-941.558] (-944.778) (-942.167) -- 0:00:41
334500 -- (-946.783) (-945.098) [-941.839] (-941.850) * (-942.229) (-942.227) (-943.216) [-942.004] -- 0:00:41
335000 -- (-944.032) (-942.750) [-942.424] (-942.746) * [-945.187] (-942.305) (-947.188) (-942.630) -- 0:00:41
Average standard deviation of split frequencies: 0.018074
335500 -- (-943.116) (-943.707) (-941.479) [-943.062] * (-943.285) (-942.431) (-943.930) [-943.529] -- 0:00:41
336000 -- (-943.677) (-944.679) (-942.994) [-943.491] * (-946.868) (-945.440) [-944.234] (-941.956) -- 0:00:41
336500 -- (-945.199) (-948.471) (-942.910) [-942.877] * [-945.971] (-946.463) (-941.821) (-944.919) -- 0:00:41
337000 -- [-946.709] (-942.617) (-945.366) (-943.333) * [-942.119] (-944.070) (-941.466) (-942.563) -- 0:00:41
337500 -- (-945.866) [-942.163] (-946.673) (-943.831) * (-943.345) (-945.784) [-948.975] (-945.068) -- 0:00:41
338000 -- (-945.535) (-944.029) [-944.559] (-941.402) * (-946.561) [-942.160] (-945.878) (-945.595) -- 0:00:41
338500 -- (-944.154) (-942.102) (-944.334) [-942.214] * (-941.891) (-948.572) [-943.763] (-947.780) -- 0:00:41
339000 -- (-946.293) [-942.591] (-941.024) (-941.882) * (-942.251) (-942.492) (-942.781) [-942.643] -- 0:00:40
339500 -- (-946.602) (-944.115) [-942.620] (-944.411) * (-946.612) [-942.472] (-941.382) (-948.505) -- 0:00:40
340000 -- [-943.191] (-941.680) (-944.605) (-944.788) * [-944.415] (-944.141) (-944.285) (-943.641) -- 0:00:40
Average standard deviation of split frequencies: 0.018315
340500 -- (-941.290) [-943.607] (-944.605) (-944.264) * [-941.817] (-945.490) (-943.717) (-943.753) -- 0:00:40
341000 -- (-943.189) [-943.785] (-942.515) (-944.865) * (-942.162) (-947.792) [-943.492] (-945.952) -- 0:00:40
341500 -- (-943.189) (-943.254) [-942.283] (-942.956) * (-943.216) (-944.683) (-942.378) [-941.838] -- 0:00:40
342000 -- (-944.019) (-944.123) [-944.694] (-941.963) * (-944.026) (-943.946) [-944.931] (-942.800) -- 0:00:40
342500 -- (-945.940) (-945.537) (-943.863) [-943.803] * (-941.909) (-945.443) (-943.810) [-942.797] -- 0:00:40
343000 -- [-942.938] (-949.570) (-944.311) (-942.809) * [-942.011] (-942.899) (-942.943) (-945.817) -- 0:00:40
343500 -- (-941.703) (-942.551) [-943.292] (-941.968) * (-944.293) (-942.428) [-943.910] (-943.459) -- 0:00:40
344000 -- [-942.491] (-941.937) (-943.863) (-945.395) * (-943.410) (-947.094) [-943.012] (-941.490) -- 0:00:40
344500 -- (-943.038) [-942.426] (-944.142) (-945.780) * (-944.968) (-943.132) (-943.210) [-944.460] -- 0:00:39
345000 -- (-945.182) (-946.669) (-943.985) [-944.843] * (-945.948) (-941.482) [-943.164] (-944.556) -- 0:00:39
Average standard deviation of split frequencies: 0.017787
345500 -- (-942.454) (-943.028) [-943.101] (-944.013) * (-944.289) [-941.620] (-942.469) (-942.825) -- 0:00:39
346000 -- (-945.104) [-945.567] (-942.556) (-944.060) * (-947.356) (-942.424) (-944.252) [-944.125] -- 0:00:39
346500 -- (-944.933) (-943.778) [-944.532] (-943.011) * (-944.081) (-946.225) (-945.578) [-945.353] -- 0:00:39
347000 -- (-943.227) (-941.745) [-943.565] (-942.231) * [-944.135] (-942.881) (-941.608) (-941.922) -- 0:00:39
347500 -- (-942.246) (-942.796) [-943.258] (-941.862) * (-945.121) [-942.550] (-946.045) (-943.295) -- 0:00:39
348000 -- [-942.835] (-942.069) (-947.236) (-942.713) * (-946.552) (-943.490) (-944.209) [-942.430] -- 0:00:41
348500 -- (-941.772) (-943.137) [-942.896] (-943.212) * (-943.457) (-941.543) (-944.570) [-945.168] -- 0:00:41
349000 -- (-941.962) (-942.213) (-944.105) [-941.466] * [-942.707] (-944.360) (-944.983) (-944.591) -- 0:00:41
349500 -- (-941.408) (-942.176) [-942.563] (-941.533) * [-942.574] (-944.064) (-943.109) (-943.422) -- 0:00:40
350000 -- (-941.498) (-943.134) (-945.159) [-941.453] * [-943.149] (-943.361) (-944.235) (-950.202) -- 0:00:40
Average standard deviation of split frequencies: 0.017401
350500 -- (-942.441) (-944.864) [-942.429] (-941.708) * (-941.605) (-942.682) [-942.614] (-942.732) -- 0:00:40
351000 -- (-943.883) (-945.611) (-942.611) [-943.617] * (-941.936) (-941.421) (-942.748) [-945.393] -- 0:00:40
351500 -- (-944.165) (-942.766) (-946.607) [-942.150] * [-942.579] (-941.625) (-944.749) (-946.464) -- 0:00:40
352000 -- (-943.090) [-942.792] (-942.601) (-944.828) * (-941.853) (-942.939) [-944.748] (-945.255) -- 0:00:40
352500 -- (-942.927) (-945.256) [-943.376] (-944.853) * (-942.446) (-943.029) (-945.337) [-944.300] -- 0:00:40
353000 -- (-943.615) (-946.073) (-941.983) [-944.751] * (-942.465) [-943.513] (-945.280) (-941.655) -- 0:00:40
353500 -- [-943.815] (-951.303) (-946.911) (-945.922) * (-946.072) (-943.415) (-943.608) [-945.852] -- 0:00:40
354000 -- (-942.236) (-945.212) [-946.911] (-944.572) * [-942.279] (-944.170) (-942.248) (-943.633) -- 0:00:40
354500 -- [-945.971] (-944.288) (-946.459) (-945.295) * (-943.807) (-942.544) (-946.761) [-942.923] -- 0:00:40
355000 -- [-941.832] (-945.410) (-942.955) (-943.236) * (-943.740) (-941.886) (-942.719) [-944.028] -- 0:00:39
Average standard deviation of split frequencies: 0.018686
355500 -- [-942.913] (-943.378) (-948.822) (-945.192) * (-947.183) (-941.648) (-943.568) [-945.053] -- 0:00:39
356000 -- (-945.657) [-941.652] (-946.307) (-946.169) * (-948.826) (-943.660) (-943.151) [-945.460] -- 0:00:39
356500 -- (-945.657) (-943.710) (-943.640) [-943.535] * (-946.812) (-943.718) (-945.174) [-943.560] -- 0:00:39
357000 -- (-945.641) (-943.402) [-944.540] (-941.726) * (-944.026) (-943.297) [-943.082] (-944.699) -- 0:00:39
357500 -- (-952.098) (-943.645) (-943.460) [-944.004] * [-943.754] (-945.399) (-946.375) (-944.826) -- 0:00:39
358000 -- (-948.895) (-943.839) [-942.945] (-943.383) * (-943.135) (-944.872) [-942.857] (-942.792) -- 0:00:39
358500 -- (-945.481) [-945.063] (-943.590) (-943.099) * (-945.838) [-942.568] (-942.412) (-944.837) -- 0:00:39
359000 -- (-946.275) [-942.328] (-942.936) (-943.427) * (-942.193) (-943.216) [-943.524] (-942.757) -- 0:00:39
359500 -- (-942.850) (-945.676) [-942.540] (-946.558) * (-942.225) (-943.269) (-943.804) [-942.357] -- 0:00:39
360000 -- (-947.570) [-941.878] (-942.131) (-941.654) * (-943.168) [-943.984] (-943.323) (-942.321) -- 0:00:39
Average standard deviation of split frequencies: 0.018153
360500 -- (-943.398) [-943.998] (-944.388) (-941.672) * (-943.007) [-943.040] (-945.195) (-945.244) -- 0:00:39
361000 -- (-943.147) (-948.530) [-944.328] (-943.314) * (-943.587) (-944.015) (-953.929) [-944.423] -- 0:00:38
361500 -- (-942.152) (-941.774) (-941.886) [-947.798] * [-942.851] (-943.592) (-945.919) (-943.122) -- 0:00:38
362000 -- (-945.278) (-942.339) (-942.845) [-942.566] * [-942.569] (-944.631) (-942.807) (-943.085) -- 0:00:38
362500 -- (-945.271) [-944.496] (-944.011) (-943.030) * [-941.441] (-944.404) (-946.825) (-941.765) -- 0:00:38
363000 -- (-942.550) (-943.320) (-944.295) [-944.107] * (-942.180) (-943.554) [-943.671] (-942.216) -- 0:00:38
363500 -- (-945.487) [-944.692] (-945.332) (-943.490) * (-946.893) [-945.471] (-942.750) (-942.114) -- 0:00:38
364000 -- [-943.875] (-948.250) (-942.167) (-945.065) * (-945.151) (-942.798) [-941.373] (-943.596) -- 0:00:38
364500 -- (-944.530) (-946.978) [-944.093] (-943.626) * (-943.466) [-941.552] (-943.873) (-945.631) -- 0:00:38
365000 -- [-944.078] (-946.148) (-945.484) (-945.385) * (-942.030) (-941.844) [-942.522] (-945.822) -- 0:00:40
Average standard deviation of split frequencies: 0.018604
365500 -- (-943.024) [-947.081] (-942.991) (-942.467) * (-942.764) [-945.979] (-944.400) (-942.536) -- 0:00:39
366000 -- [-943.583] (-946.183) (-941.743) (-942.819) * (-943.841) (-945.133) [-941.436] (-942.252) -- 0:00:39
366500 -- (-942.922) [-942.367] (-941.899) (-943.868) * (-942.340) (-945.243) [-947.014] (-943.758) -- 0:00:39
367000 -- [-941.754] (-944.204) (-942.804) (-942.850) * [-941.941] (-945.624) (-945.660) (-942.763) -- 0:00:39
367500 -- (-943.052) (-944.246) (-941.990) [-944.029] * (-943.263) (-948.961) (-943.796) [-946.663] -- 0:00:39
368000 -- (-943.560) [-941.807] (-942.334) (-941.252) * (-942.505) [-943.108] (-948.536) (-947.029) -- 0:00:39
368500 -- (-941.773) (-944.643) [-942.256] (-944.428) * (-942.468) (-944.750) [-943.222] (-945.646) -- 0:00:39
369000 -- [-941.377] (-943.704) (-942.061) (-942.010) * [-943.488] (-944.470) (-944.457) (-945.061) -- 0:00:39
369500 -- (-942.753) [-944.258] (-942.034) (-942.056) * (-944.062) [-943.057] (-943.251) (-942.969) -- 0:00:39
370000 -- (-942.923) (-942.291) (-945.848) [-942.098] * (-947.533) (-943.037) [-943.033] (-942.083) -- 0:00:39
Average standard deviation of split frequencies: 0.018582
370500 -- (-943.007) (-942.463) (-947.842) [-942.252] * (-943.419) (-942.294) [-945.294] (-941.657) -- 0:00:39
371000 -- (-945.692) [-945.959] (-943.205) (-943.298) * (-942.078) (-941.682) (-943.669) [-944.012] -- 0:00:38
371500 -- (-944.296) (-943.225) [-943.614] (-943.273) * [-942.161] (-941.171) (-949.158) (-944.124) -- 0:00:38
372000 -- [-944.882] (-943.092) (-943.378) (-941.365) * (-941.943) (-943.198) [-945.504] (-946.432) -- 0:00:38
372500 -- (-946.147) (-943.310) [-948.839] (-946.957) * (-943.610) (-943.917) (-943.269) [-942.401] -- 0:00:38
373000 -- (-941.373) (-943.070) [-943.922] (-941.409) * (-944.122) (-946.300) (-944.143) [-943.426] -- 0:00:38
373500 -- (-941.529) (-946.263) [-947.744] (-946.376) * (-942.241) [-946.669] (-943.646) (-943.176) -- 0:00:38
374000 -- [-944.648] (-947.458) (-945.998) (-945.800) * [-942.611] (-942.771) (-943.730) (-945.475) -- 0:00:38
374500 -- (-945.069) [-944.975] (-942.504) (-948.746) * (-942.711) (-945.989) (-942.028) [-943.284] -- 0:00:38
375000 -- [-945.094] (-945.202) (-942.826) (-944.054) * [-942.410] (-946.077) (-943.282) (-942.692) -- 0:00:38
Average standard deviation of split frequencies: 0.017901
375500 -- [-945.728] (-944.952) (-941.469) (-944.000) * (-944.487) (-947.872) (-944.961) [-943.995] -- 0:00:38
376000 -- (-940.984) (-945.111) (-941.903) [-943.782] * (-947.364) (-941.625) (-943.596) [-942.993] -- 0:00:38
376500 -- (-943.305) (-943.918) (-943.024) [-942.623] * (-944.516) (-943.693) [-942.574] (-945.538) -- 0:00:38
377000 -- [-941.977] (-942.055) (-942.290) (-943.284) * (-943.371) (-942.904) [-944.008] (-942.788) -- 0:00:38
377500 -- (-947.769) [-942.259] (-943.006) (-944.109) * (-945.789) (-943.018) (-942.982) [-941.902] -- 0:00:37
378000 -- [-949.795] (-946.108) (-943.941) (-941.772) * (-945.268) (-942.586) [-942.577] (-943.358) -- 0:00:37
378500 -- (-947.832) (-944.133) (-942.308) [-941.574] * (-942.118) (-943.855) [-942.193] (-945.233) -- 0:00:37
379000 -- (-942.965) [-943.701] (-941.515) (-943.229) * (-942.614) (-944.779) (-943.363) [-942.587] -- 0:00:37
379500 -- (-942.671) (-942.596) (-943.478) [-942.857] * (-944.435) (-943.547) (-945.706) [-942.411] -- 0:00:37
380000 -- [-941.823] (-944.684) (-944.151) (-942.720) * (-941.710) [-944.368] (-944.491) (-942.048) -- 0:00:37
Average standard deviation of split frequencies: 0.016973
380500 -- (-942.301) [-942.757] (-942.800) (-943.199) * (-946.689) [-943.734] (-945.004) (-943.593) -- 0:00:37
381000 -- [-942.455] (-942.456) (-950.175) (-943.175) * (-942.652) [-942.346] (-944.411) (-943.176) -- 0:00:37
381500 -- [-945.147] (-942.864) (-945.605) (-942.974) * (-947.620) (-944.469) (-943.093) [-943.988] -- 0:00:38
382000 -- (-942.769) (-943.414) [-946.162] (-941.251) * (-942.607) (-948.281) [-943.219] (-943.948) -- 0:00:38
382500 -- (-943.274) (-943.995) (-943.159) [-941.820] * (-942.615) [-944.872] (-947.399) (-943.111) -- 0:00:38
383000 -- (-942.326) (-945.107) (-943.826) [-943.320] * (-946.248) (-943.643) [-942.777] (-942.443) -- 0:00:38
383500 -- [-942.289] (-943.579) (-942.977) (-944.160) * (-947.500) (-947.538) (-942.395) [-943.302] -- 0:00:38
384000 -- [-943.577] (-945.498) (-941.920) (-946.889) * (-943.671) (-947.526) (-943.500) [-944.068] -- 0:00:38
384500 -- [-942.530] (-945.096) (-943.113) (-945.270) * (-942.300) [-944.455] (-942.369) (-943.674) -- 0:00:38
385000 -- (-942.488) (-941.136) (-943.462) [-943.637] * [-943.009] (-943.415) (-942.193) (-943.074) -- 0:00:38
Average standard deviation of split frequencies: 0.016840
385500 -- (-942.364) [-941.153] (-946.253) (-943.477) * (-943.627) (-941.914) [-941.599] (-948.099) -- 0:00:38
386000 -- (-942.759) [-942.424] (-946.615) (-942.790) * (-948.175) (-942.051) [-941.153] (-945.289) -- 0:00:38
386500 -- (-942.069) (-941.403) (-947.963) [-946.434] * (-946.221) (-942.119) (-942.396) [-943.135] -- 0:00:38
387000 -- [-944.297] (-942.177) (-942.322) (-944.808) * (-942.808) (-942.332) [-944.475] (-944.993) -- 0:00:38
387500 -- (-941.171) (-943.490) (-943.960) [-942.823] * (-942.741) (-941.960) [-943.981] (-942.313) -- 0:00:37
388000 -- (-945.600) [-944.447] (-942.745) (-944.516) * (-944.115) [-942.471] (-943.213) (-944.194) -- 0:00:37
388500 -- (-944.819) [-943.821] (-944.188) (-945.734) * (-943.721) [-942.721] (-943.965) (-943.254) -- 0:00:37
389000 -- (-945.855) (-943.909) [-943.918] (-945.408) * (-944.273) [-946.306] (-942.241) (-943.144) -- 0:00:37
389500 -- (-946.831) (-941.444) [-944.275] (-947.419) * [-943.720] (-945.578) (-942.003) (-944.698) -- 0:00:37
390000 -- (-941.979) (-941.551) [-941.741] (-944.485) * (-945.283) (-948.592) [-941.736] (-944.783) -- 0:00:37
Average standard deviation of split frequencies: 0.016022
390500 -- [-943.012] (-941.551) (-944.557) (-945.389) * [-943.879] (-944.501) (-942.695) (-942.248) -- 0:00:37
391000 -- (-944.516) (-943.810) [-944.593] (-941.838) * [-945.192] (-944.324) (-942.725) (-944.347) -- 0:00:37
391500 -- (-948.709) (-945.920) [-944.077] (-942.094) * (-943.458) [-944.169] (-943.342) (-943.446) -- 0:00:37
392000 -- (-944.718) (-942.499) (-943.696) [-943.317] * (-944.628) [-941.916] (-942.182) (-945.746) -- 0:00:37
392500 -- (-942.278) [-941.283] (-943.456) (-942.440) * (-945.871) (-941.489) [-944.836] (-943.814) -- 0:00:37
393000 -- [-941.335] (-943.461) (-942.478) (-942.312) * [-943.911] (-943.046) (-944.021) (-944.196) -- 0:00:37
393500 -- (-941.874) [-941.806] (-941.999) (-941.237) * (-944.731) [-942.859] (-945.076) (-942.821) -- 0:00:36
394000 -- [-941.891] (-944.059) (-942.930) (-941.682) * (-943.295) (-942.464) [-946.271] (-945.041) -- 0:00:36
394500 -- (-944.204) [-945.115] (-943.084) (-942.180) * (-942.274) [-943.552] (-946.500) (-941.507) -- 0:00:36
395000 -- (-945.198) (-944.853) (-946.420) [-941.874] * (-945.422) [-942.103] (-943.924) (-941.462) -- 0:00:36
Average standard deviation of split frequencies: 0.014845
395500 -- (-943.476) (-944.495) (-945.521) [-945.875] * (-942.583) (-944.867) (-942.928) [-942.538] -- 0:00:36
396000 -- (-942.703) (-941.359) (-942.952) [-945.114] * (-944.841) (-944.777) [-942.720] (-943.502) -- 0:00:36
396500 -- [-942.630] (-943.417) (-943.766) (-941.958) * (-943.598) (-945.204) (-944.251) [-943.891] -- 0:00:36
397000 -- (-942.280) (-943.384) [-943.958] (-943.254) * [-943.057] (-944.666) (-945.306) (-943.056) -- 0:00:36
397500 -- [-943.106] (-943.383) (-944.653) (-942.940) * (-942.908) (-942.757) (-945.119) [-944.796] -- 0:00:36
398000 -- [-941.992] (-941.598) (-946.466) (-941.791) * [-943.218] (-945.873) (-945.436) (-943.825) -- 0:00:37
398500 -- (-942.857) [-946.189] (-942.417) (-943.559) * (-942.144) (-942.679) (-943.920) [-944.012] -- 0:00:37
399000 -- (-943.565) (-942.473) (-943.060) [-944.092] * (-941.786) (-943.330) (-943.473) [-944.602] -- 0:00:37
399500 -- (-942.243) [-942.370] (-944.993) (-946.668) * (-943.427) (-945.271) [-945.323] (-945.023) -- 0:00:37
400000 -- [-945.435] (-943.512) (-942.342) (-945.140) * (-942.395) (-951.628) [-942.071] (-942.545) -- 0:00:37
Average standard deviation of split frequencies: 0.013163
400500 -- (-945.473) (-944.763) [-943.026] (-941.333) * (-942.119) (-947.682) [-941.563] (-943.600) -- 0:00:37
401000 -- (-942.661) (-945.130) (-942.882) [-944.695] * (-942.675) [-944.908] (-944.929) (-943.405) -- 0:00:37
401500 -- (-942.008) (-941.522) (-941.406) [-944.924] * [-942.149] (-945.928) (-945.382) (-944.300) -- 0:00:37
402000 -- (-943.385) (-947.847) (-941.535) [-942.668] * (-943.620) [-943.493] (-944.549) (-945.278) -- 0:00:37
402500 -- (-944.618) (-941.987) [-943.287] (-943.954) * (-945.591) (-942.721) [-944.135] (-944.206) -- 0:00:37
403000 -- (-942.971) (-944.762) [-942.441] (-942.441) * (-945.155) (-942.755) (-948.585) [-943.283] -- 0:00:37
403500 -- (-945.357) (-941.831) (-943.993) [-941.433] * (-945.825) (-941.948) (-951.936) [-942.400] -- 0:00:36
404000 -- (-945.878) (-943.548) (-944.872) [-943.554] * (-943.805) (-943.856) [-941.846] (-941.923) -- 0:00:36
404500 -- (-945.141) (-943.116) (-941.932) [-944.180] * (-944.382) (-943.369) [-942.918] (-944.450) -- 0:00:36
405000 -- (-942.962) (-942.319) [-942.849] (-945.772) * [-942.720] (-943.062) (-941.998) (-943.829) -- 0:00:36
Average standard deviation of split frequencies: 0.013425
405500 -- (-942.455) [-942.782] (-942.202) (-948.416) * [-945.096] (-943.453) (-944.096) (-942.936) -- 0:00:36
406000 -- [-942.233] (-943.442) (-942.433) (-941.813) * [-947.170] (-942.546) (-944.583) (-944.305) -- 0:00:36
406500 -- (-942.598) (-941.946) (-943.266) [-942.526] * [-944.930] (-942.382) (-943.719) (-943.647) -- 0:00:36
407000 -- (-942.669) (-942.619) (-948.016) [-943.136] * (-944.689) (-942.380) [-947.224] (-942.070) -- 0:00:36
407500 -- (-941.764) (-947.966) (-948.272) [-943.312] * (-941.233) [-942.040] (-951.390) (-941.720) -- 0:00:36
408000 -- (-941.509) (-944.161) [-943.157] (-944.336) * (-945.489) [-941.925] (-944.076) (-945.035) -- 0:00:36
408500 -- [-942.415] (-945.615) (-943.528) (-944.765) * (-944.655) (-942.566) [-941.949] (-945.691) -- 0:00:36
409000 -- [-941.825] (-943.925) (-943.398) (-944.017) * (-943.483) (-943.846) (-941.663) [-942.186] -- 0:00:36
409500 -- (-942.263) (-943.203) (-945.490) [-945.333] * (-943.152) (-942.516) [-942.436] (-943.473) -- 0:00:36
410000 -- (-941.738) (-946.696) (-944.032) [-944.485] * [-942.130] (-942.475) (-945.568) (-948.362) -- 0:00:35
Average standard deviation of split frequencies: 0.013488
410500 -- [-941.972] (-944.451) (-943.210) (-948.589) * (-944.049) (-943.839) (-942.033) [-944.214] -- 0:00:35
411000 -- (-941.904) (-944.700) (-942.282) [-944.424] * (-945.507) (-942.351) [-942.728] (-944.097) -- 0:00:35
411500 -- (-941.727) (-943.529) (-945.947) [-943.931] * (-947.800) [-948.902] (-945.706) (-943.920) -- 0:00:35
412000 -- (-941.547) [-945.300] (-944.251) (-943.086) * (-942.586) (-943.311) (-941.820) [-942.739] -- 0:00:35
412500 -- (-944.153) (-948.199) (-944.926) [-942.998] * (-943.218) (-941.770) [-944.324] (-945.261) -- 0:00:35
413000 -- (-943.727) (-944.788) [-942.741] (-947.255) * (-944.393) (-944.370) [-943.604] (-945.408) -- 0:00:35
413500 -- (-945.564) (-944.701) [-941.303] (-942.647) * (-942.067) [-944.509] (-941.891) (-947.850) -- 0:00:35
414000 -- (-941.828) [-943.464] (-941.592) (-944.304) * (-941.942) [-946.722] (-942.248) (-943.493) -- 0:00:35
414500 -- [-942.192] (-945.148) (-948.576) (-943.033) * (-943.032) (-944.297) [-941.694] (-945.871) -- 0:00:36
415000 -- (-942.936) (-946.457) (-944.464) [-942.178] * (-942.729) (-943.839) (-944.249) [-945.999] -- 0:00:36
Average standard deviation of split frequencies: 0.013032
415500 -- [-942.846] (-943.611) (-941.191) (-942.499) * (-942.980) [-942.114] (-946.046) (-942.532) -- 0:00:36
416000 -- (-942.544) (-945.746) [-941.101] (-947.266) * [-943.870] (-942.114) (-941.445) (-943.595) -- 0:00:36
416500 -- (-944.481) [-943.497] (-942.428) (-942.074) * (-944.754) (-943.095) [-941.505] (-944.347) -- 0:00:36
417000 -- (-943.914) [-943.185] (-943.209) (-942.820) * [-943.025] (-942.095) (-942.584) (-944.195) -- 0:00:36
417500 -- [-945.588] (-944.293) (-945.392) (-942.472) * [-945.689] (-943.564) (-942.336) (-942.886) -- 0:00:36
418000 -- (-944.414) (-943.398) (-942.141) [-943.809] * (-946.121) (-944.332) [-942.929] (-943.172) -- 0:00:36
418500 -- (-942.510) [-943.525] (-941.460) (-943.983) * (-945.086) (-942.263) [-945.653] (-945.959) -- 0:00:36
419000 -- (-943.039) [-943.338] (-945.269) (-943.117) * (-944.146) [-945.831] (-946.444) (-942.101) -- 0:00:36
419500 -- [-941.920] (-943.718) (-944.690) (-944.595) * (-945.682) [-942.739] (-943.302) (-941.945) -- 0:00:35
420000 -- (-942.613) (-942.190) (-942.591) [-941.951] * (-943.121) (-943.453) [-945.472] (-941.458) -- 0:00:35
Average standard deviation of split frequencies: 0.013587
420500 -- (-942.527) (-942.116) (-942.247) [-943.862] * (-941.841) (-944.106) [-943.907] (-942.699) -- 0:00:35
421000 -- (-942.134) (-943.448) (-942.008) [-943.875] * (-944.102) (-949.477) (-941.752) [-941.591] -- 0:00:35
421500 -- (-944.439) (-943.550) (-942.161) [-943.434] * (-944.071) (-953.191) [-942.991] (-943.325) -- 0:00:35
422000 -- (-945.991) (-942.277) [-943.124] (-946.309) * (-942.897) (-943.506) [-943.140] (-941.750) -- 0:00:35
422500 -- (-944.963) (-942.087) [-944.292] (-943.952) * (-945.130) [-941.561] (-941.870) (-941.943) -- 0:00:35
423000 -- [-941.819] (-944.585) (-944.545) (-945.262) * (-941.559) (-942.460) [-943.758] (-943.787) -- 0:00:35
423500 -- (-941.524) (-944.204) [-946.038] (-944.473) * [-942.199] (-944.590) (-942.383) (-943.647) -- 0:00:35
424000 -- (-944.492) (-943.046) (-945.404) [-946.267] * [-944.999] (-942.191) (-943.363) (-945.459) -- 0:00:35
424500 -- (-942.716) (-943.932) [-942.335] (-945.760) * (-943.593) (-944.850) [-943.767] (-943.054) -- 0:00:35
425000 -- [-941.666] (-946.646) (-944.564) (-943.827) * (-945.607) (-941.665) (-943.571) [-943.678] -- 0:00:35
Average standard deviation of split frequencies: 0.013694
425500 -- (-942.323) (-941.719) (-941.396) [-943.318] * (-945.885) (-941.052) [-942.717] (-944.322) -- 0:00:35
426000 -- (-943.541) [-943.161] (-942.201) (-943.658) * (-945.800) (-944.475) [-942.231] (-946.105) -- 0:00:35
426500 -- (-943.400) (-942.411) (-941.708) [-943.169] * [-943.306] (-942.475) (-944.464) (-947.378) -- 0:00:34
427000 -- (-943.000) [-942.122] (-941.702) (-942.249) * (-941.900) (-949.563) (-942.294) [-943.324] -- 0:00:34
427500 -- (-945.480) (-941.973) (-942.317) [-942.049] * [-943.374] (-943.932) (-945.579) (-943.512) -- 0:00:34
428000 -- (-942.176) (-944.801) [-941.808] (-943.775) * (-945.171) [-942.118] (-944.729) (-941.109) -- 0:00:34
428500 -- [-944.598] (-942.303) (-941.859) (-943.348) * (-941.797) (-942.499) (-946.426) [-943.518] -- 0:00:34
429000 -- (-947.397) (-943.431) [-941.687] (-944.117) * (-943.026) (-942.757) [-941.729] (-942.469) -- 0:00:34
429500 -- (-942.369) (-943.918) (-942.420) [-942.567] * (-943.699) (-942.665) [-943.085] (-951.598) -- 0:00:34
430000 -- (-943.858) (-942.219) [-944.192] (-944.170) * (-947.452) (-944.105) (-946.165) [-942.066] -- 0:00:34
Average standard deviation of split frequencies: 0.013614
430500 -- (-942.166) [-942.743] (-945.019) (-942.301) * (-943.615) [-944.057] (-943.004) (-942.939) -- 0:00:34
431000 -- (-943.685) (-942.841) (-947.004) [-942.769] * (-943.749) (-942.516) (-942.099) [-944.136] -- 0:00:35
431500 -- (-943.214) (-942.683) [-944.949] (-943.037) * (-943.287) [-942.112] (-945.040) (-945.955) -- 0:00:35
432000 -- (-944.231) [-945.445] (-942.790) (-945.961) * (-943.389) [-941.107] (-942.778) (-941.772) -- 0:00:35
432500 -- (-942.393) (-946.213) [-944.435] (-947.597) * (-944.372) (-944.364) (-942.949) [-941.969] -- 0:00:35
433000 -- (-943.157) (-944.880) [-942.560] (-943.325) * (-943.035) (-943.400) [-942.996] (-942.112) -- 0:00:35
433500 -- (-943.021) [-942.924] (-946.096) (-942.839) * (-943.630) (-942.724) (-942.457) [-944.838] -- 0:00:35
434000 -- (-943.712) [-942.782] (-943.289) (-945.394) * [-941.665] (-944.005) (-943.978) (-945.767) -- 0:00:35
434500 -- (-943.511) [-943.344] (-943.565) (-942.679) * (-944.519) (-949.335) (-945.732) [-945.473] -- 0:00:35
435000 -- (-942.625) (-944.629) (-947.890) [-941.451] * [-943.992] (-942.478) (-944.782) (-945.440) -- 0:00:35
Average standard deviation of split frequencies: 0.013380
435500 -- (-943.244) (-944.485) [-943.616] (-944.943) * (-942.833) (-942.791) [-941.573] (-944.784) -- 0:00:34
436000 -- (-941.026) (-945.912) (-949.553) [-941.089] * (-944.138) (-945.266) (-943.685) [-945.163] -- 0:00:34
436500 -- (-949.654) (-945.998) (-944.245) [-942.740] * [-942.015] (-943.659) (-941.046) (-944.349) -- 0:00:34
437000 -- (-947.835) (-942.907) (-949.454) [-946.818] * (-942.553) [-942.074] (-942.373) (-944.875) -- 0:00:34
437500 -- (-943.389) (-941.649) (-946.226) [-943.636] * (-948.888) (-949.663) (-941.292) [-941.500] -- 0:00:34
438000 -- [-943.302] (-943.559) (-944.459) (-943.588) * (-944.806) (-942.207) (-942.486) [-945.109] -- 0:00:34
438500 -- [-942.065] (-942.634) (-946.397) (-943.254) * (-941.977) (-946.154) (-942.024) [-942.849] -- 0:00:34
439000 -- (-941.944) (-942.174) (-942.687) [-942.731] * (-941.869) (-942.601) (-946.832) [-941.812] -- 0:00:34
439500 -- (-947.816) [-941.757] (-942.538) (-942.482) * (-942.602) (-943.415) (-943.436) [-941.858] -- 0:00:34
440000 -- (-947.254) (-944.149) [-943.160] (-951.108) * (-942.686) [-942.386] (-943.548) (-942.927) -- 0:00:34
Average standard deviation of split frequencies: 0.012585
440500 -- (-946.600) (-943.656) (-946.370) [-944.883] * (-943.685) (-942.382) (-944.316) [-943.289] -- 0:00:34
441000 -- [-942.483] (-941.831) (-943.900) (-947.426) * (-944.286) (-942.751) [-943.139] (-942.739) -- 0:00:34
441500 -- [-944.702] (-941.968) (-949.673) (-944.538) * (-946.558) (-942.143) (-944.020) [-945.579] -- 0:00:34
442000 -- (-943.639) (-942.102) (-945.857) [-943.508] * (-945.280) (-943.913) [-944.108] (-947.202) -- 0:00:34
442500 -- (-945.012) [-944.994] (-942.697) (-944.445) * (-943.119) (-942.922) [-941.998] (-945.577) -- 0:00:34
443000 -- (-945.911) (-942.487) (-942.947) [-942.872] * (-942.028) [-942.891] (-943.839) (-947.871) -- 0:00:33
443500 -- (-944.645) [-942.591] (-942.701) (-942.818) * (-942.684) (-942.305) [-944.574] (-942.483) -- 0:00:33
444000 -- [-944.200] (-946.227) (-943.199) (-947.812) * [-941.858] (-946.069) (-942.230) (-942.589) -- 0:00:33
444500 -- [-941.212] (-942.621) (-943.633) (-945.361) * (-942.966) (-946.160) (-943.798) [-944.392] -- 0:00:33
445000 -- (-941.298) [-945.069] (-944.406) (-945.068) * [-941.520] (-941.917) (-942.826) (-943.845) -- 0:00:33
Average standard deviation of split frequencies: 0.011627
445500 -- [-944.738] (-945.564) (-946.507) (-945.531) * (-941.489) (-942.136) [-941.878] (-944.758) -- 0:00:33
446000 -- (-941.721) [-943.907] (-946.814) (-943.694) * [-942.202] (-944.600) (-943.175) (-946.006) -- 0:00:33
446500 -- (-942.095) (-945.806) (-947.113) [-942.920] * (-942.008) (-944.265) [-946.655] (-948.131) -- 0:00:33
447000 -- (-942.555) (-942.857) (-944.796) [-944.080] * (-941.688) [-942.012] (-947.530) (-945.801) -- 0:00:33
447500 -- (-944.262) (-946.066) (-944.771) [-943.551] * [-942.100] (-942.237) (-942.990) (-943.485) -- 0:00:34
448000 -- (-943.669) (-942.973) [-943.518] (-942.404) * [-942.110] (-951.031) (-941.783) (-942.761) -- 0:00:34
448500 -- (-943.695) [-943.320] (-942.669) (-943.617) * (-944.509) (-949.399) (-944.349) [-945.718] -- 0:00:34
449000 -- [-945.820] (-946.898) (-945.321) (-945.153) * (-942.240) (-944.235) (-943.767) [-945.158] -- 0:00:34
449500 -- [-945.050] (-944.049) (-943.905) (-942.738) * [-941.943] (-942.373) (-943.610) (-944.666) -- 0:00:34
450000 -- (-944.811) [-941.719] (-944.265) (-943.806) * [-944.530] (-943.747) (-948.192) (-942.750) -- 0:00:34
Average standard deviation of split frequencies: 0.011075
450500 -- (-941.576) (-943.148) [-945.242] (-944.089) * (-946.552) (-942.993) (-942.120) [-944.271] -- 0:00:34
451000 -- (-942.381) [-942.668] (-943.977) (-943.482) * (-947.502) [-944.544] (-942.167) (-943.057) -- 0:00:34
451500 -- (-943.234) [-941.717] (-948.999) (-943.199) * (-942.788) [-946.825] (-946.801) (-947.520) -- 0:00:34
452000 -- (-943.557) [-942.084] (-946.394) (-941.033) * (-943.192) (-942.860) (-946.146) [-944.161] -- 0:00:33
452500 -- [-943.638] (-943.441) (-944.972) (-941.037) * (-942.538) (-943.571) [-942.574] (-942.870) -- 0:00:33
453000 -- [-947.779] (-944.434) (-943.291) (-943.993) * (-942.919) (-946.276) [-943.133] (-944.034) -- 0:00:33
453500 -- [-942.850] (-945.625) (-945.754) (-943.930) * (-943.177) (-946.079) (-942.177) [-941.549] -- 0:00:33
454000 -- (-949.204) (-942.911) (-944.818) [-941.419] * (-942.570) (-944.205) [-942.772] (-942.941) -- 0:00:33
454500 -- [-943.420] (-945.116) (-943.616) (-946.061) * (-942.306) (-943.935) (-943.266) [-944.836] -- 0:00:33
455000 -- (-941.339) [-946.995] (-942.289) (-944.335) * (-941.643) (-941.341) (-943.760) [-945.390] -- 0:00:33
Average standard deviation of split frequencies: 0.010797
455500 -- (-941.615) (-949.694) (-943.695) [-943.491] * [-942.950] (-944.224) (-943.970) (-943.892) -- 0:00:33
456000 -- [-941.001] (-945.745) (-941.572) (-942.930) * (-942.889) (-944.044) [-944.560] (-943.028) -- 0:00:33
456500 -- (-943.095) (-943.580) (-942.266) [-946.048] * [-943.121] (-941.595) (-946.542) (-943.914) -- 0:00:33
457000 -- [-942.775] (-943.184) (-943.133) (-945.690) * (-943.515) (-945.799) [-942.361] (-944.381) -- 0:00:33
457500 -- (-944.115) (-944.022) (-945.021) [-943.191] * (-942.675) (-942.675) (-942.819) [-943.327] -- 0:00:33
458000 -- (-942.428) [-944.367] (-943.442) (-944.937) * (-946.431) (-943.129) [-941.978] (-944.125) -- 0:00:33
458500 -- [-944.540] (-947.506) (-942.744) (-945.538) * (-945.873) [-941.338] (-941.798) (-942.568) -- 0:00:33
459000 -- [-942.765] (-943.985) (-943.122) (-945.501) * (-945.759) (-941.620) [-942.423] (-943.369) -- 0:00:33
459500 -- (-942.680) [-944.226] (-942.691) (-942.664) * (-946.600) (-943.159) (-943.102) [-944.777] -- 0:00:32
460000 -- (-942.321) (-944.593) (-944.552) [-943.251] * (-952.875) (-942.792) [-944.082] (-942.312) -- 0:00:32
Average standard deviation of split frequencies: 0.010775
460500 -- [-947.748] (-942.736) (-943.668) (-944.398) * (-945.666) (-945.891) [-944.688] (-941.338) -- 0:00:32
461000 -- [-942.591] (-941.863) (-950.977) (-944.125) * (-943.491) (-945.254) [-944.248] (-944.618) -- 0:00:32
461500 -- (-943.118) (-943.592) [-945.803] (-944.418) * (-943.125) (-945.294) (-944.262) [-942.256] -- 0:00:32
462000 -- (-942.843) (-945.302) [-946.776] (-944.548) * (-944.742) (-943.195) (-944.038) [-941.735] -- 0:00:32
462500 -- (-945.204) (-943.822) [-943.684] (-948.064) * [-942.730] (-943.468) (-945.236) (-942.215) -- 0:00:32
463000 -- (-942.996) (-941.877) [-941.530] (-944.034) * (-942.217) [-943.712] (-942.544) (-941.489) -- 0:00:32
463500 -- (-946.354) (-944.067) [-943.325] (-945.692) * [-942.368] (-945.408) (-944.033) (-941.889) -- 0:00:32
464000 -- [-942.908] (-943.128) (-944.568) (-944.008) * (-942.272) (-944.360) [-943.788] (-941.889) -- 0:00:33
464500 -- (-942.378) [-942.931] (-943.147) (-943.016) * (-943.831) (-947.490) (-942.713) [-941.166] -- 0:00:33
465000 -- (-944.731) (-941.820) [-942.263] (-942.943) * (-942.998) (-944.311) (-943.221) [-942.985] -- 0:00:33
Average standard deviation of split frequencies: 0.010949
465500 -- (-943.972) [-943.082] (-945.105) (-944.760) * (-944.154) (-949.971) [-942.516] (-941.985) -- 0:00:33
466000 -- [-941.793] (-942.970) (-945.491) (-943.012) * (-944.009) (-943.504) [-942.398] (-944.180) -- 0:00:33
466500 -- (-941.357) (-945.201) (-944.987) [-942.529] * (-944.476) (-944.966) [-943.607] (-948.690) -- 0:00:33
467000 -- (-942.202) (-943.538) [-943.187] (-942.014) * (-945.481) [-941.836] (-944.712) (-944.766) -- 0:00:33
467500 -- (-941.746) (-942.102) [-941.979] (-943.829) * (-942.067) (-944.062) [-942.702] (-942.781) -- 0:00:33
468000 -- (-942.485) [-944.212] (-943.159) (-946.048) * (-942.879) (-944.260) [-942.170] (-946.169) -- 0:00:32
468500 -- (-943.556) (-943.890) [-943.491] (-942.279) * (-943.066) [-943.521] (-947.933) (-946.372) -- 0:00:32
469000 -- (-946.658) (-943.246) (-942.225) [-945.686] * (-943.440) (-942.579) (-945.438) [-944.209] -- 0:00:32
469500 -- (-945.140) (-946.797) [-944.590] (-944.229) * (-947.416) [-945.183] (-945.337) (-943.430) -- 0:00:32
470000 -- [-943.258] (-942.405) (-943.743) (-947.491) * (-945.321) (-942.389) [-943.460] (-943.256) -- 0:00:32
Average standard deviation of split frequencies: 0.010487
470500 -- [-941.985] (-944.439) (-943.529) (-944.297) * (-943.324) (-942.306) [-941.264] (-941.780) -- 0:00:32
471000 -- (-942.983) (-941.922) (-946.058) [-943.657] * (-945.035) (-944.219) [-943.270] (-941.325) -- 0:00:32
471500 -- (-942.319) (-943.511) [-942.971] (-944.242) * (-949.129) (-943.512) [-946.741] (-944.340) -- 0:00:32
472000 -- (-944.190) [-943.846] (-946.596) (-944.160) * [-945.667] (-945.682) (-942.153) (-944.313) -- 0:00:32
472500 -- (-944.911) [-946.673] (-945.008) (-943.239) * (-945.659) (-943.016) [-943.781] (-943.878) -- 0:00:32
473000 -- [-944.822] (-944.903) (-942.054) (-942.052) * (-946.057) [-944.328] (-942.334) (-946.438) -- 0:00:32
473500 -- [-941.134] (-943.489) (-943.314) (-941.831) * (-943.951) (-943.235) (-947.333) [-941.607] -- 0:00:32
474000 -- (-942.774) (-943.346) [-945.872] (-943.279) * [-942.994] (-943.199) (-943.872) (-943.303) -- 0:00:32
474500 -- (-942.971) (-943.682) (-942.785) [-945.638] * (-946.271) (-945.546) (-944.138) [-941.181] -- 0:00:32
475000 -- (-943.580) [-944.332] (-944.488) (-947.437) * (-945.728) [-945.075] (-946.002) (-942.811) -- 0:00:32
Average standard deviation of split frequencies: 0.010544
475500 -- (-943.639) (-945.841) (-944.384) [-945.920] * (-942.026) [-942.459] (-944.888) (-942.947) -- 0:00:31
476000 -- [-944.423] (-942.133) (-947.473) (-944.681) * (-941.736) (-942.348) [-943.352] (-943.786) -- 0:00:31
476500 -- [-942.181] (-947.926) (-948.038) (-943.572) * (-945.119) (-941.911) [-942.919] (-945.434) -- 0:00:31
477000 -- (-942.720) (-942.815) [-944.228] (-945.617) * (-942.313) (-941.927) [-944.103] (-944.611) -- 0:00:31
477500 -- [-943.117] (-942.100) (-944.517) (-946.534) * (-943.740) [-941.019] (-942.762) (-942.222) -- 0:00:31
478000 -- [-941.706] (-941.992) (-941.778) (-945.258) * (-943.504) (-942.221) [-945.431] (-942.460) -- 0:00:31
478500 -- (-941.581) (-942.726) [-941.113] (-944.844) * (-943.372) [-942.360] (-946.663) (-943.030) -- 0:00:31
479000 -- [-943.771] (-944.777) (-940.984) (-943.366) * [-943.393] (-944.192) (-945.320) (-944.103) -- 0:00:31
479500 -- (-941.603) [-942.782] (-945.050) (-943.712) * (-944.143) (-943.911) [-942.654] (-943.784) -- 0:00:31
480000 -- (-941.603) (-941.739) [-941.326] (-947.053) * (-947.781) (-943.904) [-942.147] (-946.182) -- 0:00:31
Average standard deviation of split frequencies: 0.011076
480500 -- [-943.017] (-943.519) (-941.829) (-945.476) * (-943.444) [-942.794] (-942.068) (-946.214) -- 0:00:31
481000 -- (-947.707) [-941.665] (-944.948) (-943.542) * (-942.611) [-943.756] (-949.980) (-945.175) -- 0:00:32
481500 -- (-943.730) (-943.115) [-945.376] (-941.773) * (-942.539) (-943.397) (-942.814) [-943.672] -- 0:00:32
482000 -- (-942.101) (-942.993) (-945.514) [-941.931] * (-944.444) (-944.238) (-943.635) [-943.878] -- 0:00:32
482500 -- (-945.140) (-943.761) [-944.400] (-941.679) * [-942.765] (-943.374) (-947.092) (-942.918) -- 0:00:32
483000 -- (-945.652) [-942.273] (-942.497) (-944.041) * (-944.689) (-947.693) (-947.164) [-943.388] -- 0:00:32
483500 -- [-945.578] (-944.502) (-944.050) (-942.321) * (-943.857) (-943.477) (-944.506) [-942.147] -- 0:00:32
484000 -- (-947.019) (-942.730) [-942.860] (-941.857) * (-944.793) (-943.471) (-942.795) [-941.773] -- 0:00:31
484500 -- (-945.103) [-942.537] (-943.425) (-941.646) * [-942.249] (-945.452) (-943.796) (-944.593) -- 0:00:31
485000 -- (-943.189) (-942.752) (-942.892) [-943.983] * (-945.528) [-944.350] (-949.313) (-945.643) -- 0:00:31
Average standard deviation of split frequencies: 0.012096
485500 -- (-947.768) (-943.152) (-942.648) [-942.252] * (-944.194) (-943.210) (-942.380) [-942.422] -- 0:00:31
486000 -- (-944.460) (-943.844) [-943.092] (-941.699) * [-941.521] (-944.683) (-943.054) (-942.932) -- 0:00:31
486500 -- (-946.510) [-943.890] (-942.284) (-942.696) * (-945.580) [-943.539] (-944.464) (-944.923) -- 0:00:31
487000 -- (-941.828) (-943.604) (-942.507) [-943.680] * (-946.434) [-941.815] (-944.288) (-947.476) -- 0:00:31
487500 -- (-943.635) (-944.238) [-943.566] (-943.186) * (-944.236) [-943.420] (-946.452) (-947.002) -- 0:00:31
488000 -- (-942.996) [-942.886] (-943.576) (-944.837) * (-943.328) [-941.941] (-948.797) (-944.723) -- 0:00:31
488500 -- (-945.106) (-941.534) (-943.448) [-943.184] * (-943.807) (-943.381) (-948.861) [-945.113] -- 0:00:31
489000 -- (-944.941) (-944.957) [-941.626] (-943.234) * [-942.578] (-944.057) (-943.015) (-945.552) -- 0:00:31
489500 -- (-943.409) [-944.587] (-944.741) (-942.147) * (-941.746) [-943.347] (-941.919) (-947.028) -- 0:00:31
490000 -- (-942.059) [-942.607] (-941.295) (-947.949) * (-942.257) [-942.869] (-944.531) (-948.011) -- 0:00:31
Average standard deviation of split frequencies: 0.012207
490500 -- (-944.439) [-941.879] (-946.911) (-941.864) * (-944.238) (-943.175) [-944.476] (-941.721) -- 0:00:31
491000 -- (-944.095) (-942.560) (-943.015) [-942.172] * (-946.895) (-947.813) (-942.226) [-945.581] -- 0:00:31
491500 -- [-943.583] (-945.888) (-942.333) (-941.871) * (-941.026) (-944.139) [-944.945] (-942.553) -- 0:00:31
492000 -- [-942.260] (-948.197) (-945.930) (-943.664) * (-943.873) [-942.831] (-943.709) (-944.431) -- 0:00:30
492500 -- [-943.490] (-941.326) (-944.951) (-941.350) * (-943.171) (-943.464) [-946.982] (-945.378) -- 0:00:30
493000 -- [-942.536] (-942.445) (-947.998) (-941.353) * (-941.534) (-942.741) [-944.023] (-946.320) -- 0:00:30
493500 -- (-941.915) [-941.623] (-945.312) (-941.519) * (-943.461) [-945.051] (-945.166) (-943.903) -- 0:00:30
494000 -- (-943.046) (-945.392) (-944.867) [-943.325] * (-941.325) [-943.205] (-942.512) (-941.615) -- 0:00:30
494500 -- [-949.148] (-943.512) (-944.766) (-945.857) * [-941.609] (-944.495) (-943.057) (-943.902) -- 0:00:30
495000 -- [-945.827] (-941.986) (-943.322) (-944.790) * [-941.668] (-944.370) (-942.172) (-945.105) -- 0:00:30
Average standard deviation of split frequencies: 0.012771
495500 -- (-942.697) (-947.338) [-945.682] (-944.508) * (-942.338) (-942.380) [-942.404] (-943.902) -- 0:00:30
496000 -- (-944.355) (-944.088) (-944.253) [-945.104] * [-943.166] (-942.115) (-941.669) (-944.496) -- 0:00:30
496500 -- (-944.327) (-942.354) (-944.938) [-942.921] * (-941.258) (-944.947) (-946.835) [-944.533] -- 0:00:30
497000 -- (-943.292) [-943.106] (-946.742) (-945.304) * (-946.266) [-944.109] (-947.684) (-942.036) -- 0:00:30
497500 -- (-942.132) (-941.395) (-943.309) [-946.347] * (-943.886) (-943.379) (-942.766) [-941.466] -- 0:00:31
498000 -- (-942.235) [-943.004] (-943.340) (-945.276) * (-946.010) [-943.486] (-948.138) (-942.067) -- 0:00:31
498500 -- (-942.179) [-944.175] (-942.797) (-947.385) * (-945.285) (-945.181) (-942.814) [-942.403] -- 0:00:31
499000 -- (-941.608) (-944.355) [-942.961] (-943.937) * [-941.975] (-943.279) (-943.045) (-942.689) -- 0:00:31
499500 -- (-942.039) (-942.149) [-941.896] (-941.182) * (-943.375) [-943.418] (-943.819) (-942.722) -- 0:00:31
500000 -- (-946.052) [-944.290] (-945.614) (-946.645) * (-941.998) (-942.675) [-942.749] (-943.800) -- 0:00:31
Average standard deviation of split frequencies: 0.012652
500500 -- (-943.662) (-943.970) (-948.878) [-946.897] * [-942.808] (-942.914) (-945.194) (-941.926) -- 0:00:30
501000 -- (-944.781) (-943.539) (-943.505) [-947.857] * (-943.192) (-942.120) (-946.105) [-942.784] -- 0:00:30
501500 -- [-943.665] (-944.097) (-943.379) (-944.667) * (-942.392) [-945.764] (-944.215) (-947.022) -- 0:00:30
502000 -- (-943.344) (-942.867) (-941.849) [-942.482] * (-941.440) (-941.553) (-946.806) [-944.626] -- 0:00:30
502500 -- (-942.746) (-946.927) [-941.739] (-942.823) * (-942.060) (-943.026) (-945.661) [-945.843] -- 0:00:30
503000 -- (-943.450) (-944.305) [-941.639] (-943.257) * (-941.638) [-945.217] (-943.102) (-943.619) -- 0:00:30
503500 -- (-943.990) (-943.697) (-942.245) [-944.209] * (-943.580) (-943.430) [-944.387] (-953.944) -- 0:00:30
504000 -- (-943.604) (-941.388) (-943.838) [-944.816] * (-948.712) (-942.012) (-943.554) [-946.677] -- 0:00:30
504500 -- (-943.628) [-943.266] (-942.759) (-943.693) * (-945.323) (-941.922) (-943.897) [-944.317] -- 0:00:30
505000 -- (-943.320) (-943.551) [-942.076] (-946.884) * (-946.566) (-943.448) (-944.015) [-941.890] -- 0:00:30
Average standard deviation of split frequencies: 0.012111
505500 -- [-941.672] (-944.115) (-941.439) (-943.362) * (-943.054) (-944.779) (-941.974) [-941.725] -- 0:00:30
506000 -- (-943.007) [-944.407] (-941.393) (-945.828) * (-945.174) (-943.215) [-945.286] (-943.061) -- 0:00:30
506500 -- (-945.292) (-944.397) [-943.249] (-945.164) * (-941.529) (-945.748) [-944.697] (-944.970) -- 0:00:30
507000 -- (-942.787) [-945.153] (-944.275) (-944.755) * (-946.002) (-943.318) [-942.573] (-942.429) -- 0:00:30
507500 -- (-945.385) (-946.493) [-942.167] (-943.810) * [-945.283] (-941.850) (-942.785) (-945.343) -- 0:00:30
508000 -- (-941.745) (-943.792) (-945.240) [-943.958] * (-942.870) (-941.218) (-944.635) [-943.333] -- 0:00:30
508500 -- (-943.818) (-942.567) (-945.529) [-943.781] * (-945.640) [-941.766] (-942.015) (-941.263) -- 0:00:29
509000 -- [-942.545] (-942.386) (-949.573) (-944.724) * [-942.915] (-942.636) (-943.564) (-943.340) -- 0:00:29
509500 -- [-941.551] (-942.887) (-942.302) (-945.477) * (-943.112) (-941.910) (-941.928) [-943.920] -- 0:00:29
510000 -- (-941.929) [-946.579] (-944.546) (-945.969) * [-944.618] (-944.356) (-943.537) (-942.174) -- 0:00:29
Average standard deviation of split frequencies: 0.011077
510500 -- [-944.375] (-942.669) (-947.979) (-943.156) * (-947.696) (-943.083) [-942.723] (-943.752) -- 0:00:29
511000 -- [-943.485] (-941.636) (-944.974) (-941.924) * (-943.231) (-951.122) (-943.446) [-942.842] -- 0:00:29
511500 -- (-943.824) [-944.521] (-944.653) (-941.299) * (-947.477) (-942.106) [-942.370] (-942.716) -- 0:00:29
512000 -- (-945.348) (-943.684) (-945.045) [-943.394] * (-943.743) (-942.253) (-943.395) [-942.627] -- 0:00:29
512500 -- (-943.576) [-944.379] (-944.162) (-943.240) * (-943.125) (-943.113) [-944.312] (-944.640) -- 0:00:29
513000 -- (-943.209) (-943.644) [-941.882] (-946.296) * (-942.403) (-942.979) (-942.346) [-944.169] -- 0:00:29
513500 -- (-943.461) (-941.949) (-943.002) [-942.693] * (-948.369) [-941.381] (-943.179) (-942.176) -- 0:00:29
514000 -- (-944.187) (-941.949) (-942.878) [-942.276] * (-944.383) (-944.409) [-944.034] (-943.896) -- 0:00:30
514500 -- (-943.858) (-941.173) (-943.678) [-943.552] * (-946.152) [-943.427] (-941.706) (-944.689) -- 0:00:30
515000 -- (-943.760) [-942.552] (-943.861) (-943.170) * (-944.151) (-941.918) [-946.259] (-943.082) -- 0:00:30
Average standard deviation of split frequencies: 0.010164
515500 -- [-947.125] (-942.551) (-943.418) (-943.170) * (-944.577) [-942.316] (-943.320) (-950.539) -- 0:00:30
516000 -- (-958.191) (-944.969) [-942.167] (-944.630) * (-942.533) [-943.323] (-941.825) (-945.453) -- 0:00:30
516500 -- (-944.353) (-948.348) [-943.397] (-949.492) * (-943.909) [-942.177] (-941.825) (-945.640) -- 0:00:29
517000 -- (-945.681) [-943.346] (-942.437) (-941.470) * (-945.853) [-944.542] (-943.536) (-942.448) -- 0:00:29
517500 -- (-943.231) (-944.164) [-942.394] (-941.295) * (-942.916) (-951.184) [-945.318] (-941.705) -- 0:00:29
518000 -- (-942.897) [-943.872] (-946.002) (-946.279) * [-942.644] (-944.727) (-944.038) (-944.304) -- 0:00:29
518500 -- (-946.361) (-944.238) [-943.098] (-950.654) * [-941.756] (-944.550) (-942.976) (-943.317) -- 0:00:29
519000 -- (-944.297) (-945.044) (-946.816) [-946.662] * (-943.827) (-941.533) (-943.305) [-946.065] -- 0:00:29
519500 -- (-947.831) (-947.754) [-945.476] (-941.959) * (-945.239) [-943.789] (-941.480) (-946.669) -- 0:00:29
520000 -- (-948.911) (-944.802) [-942.223] (-946.227) * (-946.655) [-942.255] (-941.308) (-945.246) -- 0:00:29
Average standard deviation of split frequencies: 0.010129
520500 -- [-945.756] (-941.957) (-943.350) (-945.193) * (-949.217) (-942.095) [-941.422] (-945.609) -- 0:00:29
521000 -- (-945.686) [-941.905] (-946.960) (-943.427) * [-945.310] (-942.310) (-945.025) (-943.454) -- 0:00:29
521500 -- (-944.866) [-944.569] (-946.472) (-942.490) * (-943.804) (-942.986) [-943.435] (-943.149) -- 0:00:29
522000 -- (-946.000) [-943.452] (-949.119) (-943.646) * [-945.634] (-942.255) (-944.665) (-943.228) -- 0:00:29
522500 -- [-946.902] (-942.512) (-941.853) (-942.875) * (-942.602) (-946.177) (-944.692) [-941.660] -- 0:00:29
523000 -- (-946.495) (-941.481) [-945.736] (-941.230) * [-943.867] (-941.662) (-943.128) (-941.757) -- 0:00:29
523500 -- (-941.438) (-943.351) (-944.735) [-941.836] * [-945.946] (-943.571) (-943.430) (-943.745) -- 0:00:29
524000 -- [-943.220] (-942.471) (-942.969) (-943.501) * (-946.029) [-944.638] (-943.840) (-945.163) -- 0:00:29
524500 -- [-942.806] (-949.028) (-943.076) (-944.819) * (-943.516) (-943.423) (-943.798) [-942.360] -- 0:00:29
525000 -- (-942.792) [-943.228] (-943.222) (-944.224) * [-941.941] (-943.247) (-946.285) (-942.901) -- 0:00:28
Average standard deviation of split frequencies: 0.009970
525500 -- (-942.410) [-942.245] (-945.638) (-944.506) * (-945.056) (-950.025) [-941.653] (-944.894) -- 0:00:28
526000 -- (-943.844) [-943.807] (-942.532) (-943.318) * (-942.277) (-944.553) (-941.738) [-944.205] -- 0:00:28
526500 -- (-944.672) (-943.779) (-942.304) [-943.250] * [-942.570] (-943.049) (-942.287) (-944.641) -- 0:00:28
527000 -- (-945.074) (-942.143) [-941.239] (-942.588) * [-942.164] (-945.369) (-942.161) (-944.320) -- 0:00:28
527500 -- (-946.086) (-942.285) (-942.712) [-941.911] * (-944.413) (-944.657) (-945.071) [-942.146] -- 0:00:28
528000 -- (-942.585) (-942.850) [-945.751] (-943.100) * (-945.990) (-946.108) [-943.000] (-942.544) -- 0:00:28
528500 -- (-945.306) (-947.534) [-942.434] (-942.343) * (-942.144) (-941.273) [-942.032] (-946.512) -- 0:00:28
529000 -- (-941.797) (-944.027) [-943.714] (-944.935) * (-941.657) (-946.964) [-943.615] (-943.658) -- 0:00:28
529500 -- (-943.634) (-942.299) [-943.724] (-948.311) * (-941.426) (-943.977) [-945.186] (-945.503) -- 0:00:28
530000 -- [-943.416] (-945.869) (-947.859) (-945.426) * [-943.105] (-943.939) (-946.096) (-943.280) -- 0:00:28
Average standard deviation of split frequencies: 0.009994
530500 -- (-942.857) [-941.779] (-945.104) (-943.553) * (-941.418) [-943.896] (-943.820) (-944.209) -- 0:00:29
531000 -- (-943.308) [-942.207] (-945.314) (-943.939) * (-941.381) (-942.569) [-944.287] (-942.729) -- 0:00:29
531500 -- (-943.014) (-943.035) (-943.410) [-944.459] * (-942.184) (-942.172) (-944.148) [-943.872] -- 0:00:29
532000 -- (-943.712) (-942.224) [-943.693] (-946.673) * (-942.107) [-943.445] (-944.201) (-942.278) -- 0:00:29
532500 -- [-941.272] (-944.681) (-946.327) (-943.493) * (-942.691) [-941.317] (-946.447) (-944.069) -- 0:00:28
533000 -- (-945.073) (-942.584) [-949.424] (-943.766) * (-941.943) [-941.743] (-944.017) (-943.444) -- 0:00:28
533500 -- (-944.486) (-949.334) (-947.689) [-943.666] * (-942.168) [-941.683] (-942.840) (-943.480) -- 0:00:28
534000 -- (-942.757) [-943.788] (-942.584) (-944.505) * (-943.970) (-945.235) (-942.703) [-944.822] -- 0:00:28
534500 -- (-942.717) [-941.749] (-945.759) (-943.048) * (-944.477) (-942.171) (-941.801) [-942.599] -- 0:00:28
535000 -- [-943.263] (-943.560) (-947.690) (-944.133) * (-942.998) (-944.883) (-941.788) [-943.917] -- 0:00:28
Average standard deviation of split frequencies: 0.009619
535500 -- (-941.056) [-942.704] (-945.526) (-945.036) * (-945.203) (-948.775) [-943.318] (-941.970) -- 0:00:28
536000 -- (-941.004) (-946.068) [-944.399] (-944.851) * (-944.951) (-949.477) (-944.258) [-947.244] -- 0:00:28
536500 -- (-942.788) (-943.015) (-944.986) [-944.276] * (-944.320) (-943.745) [-942.028] (-945.012) -- 0:00:28
537000 -- (-940.962) [-941.649] (-941.608) (-941.251) * (-945.579) [-941.909] (-944.795) (-944.776) -- 0:00:28
537500 -- [-942.967] (-941.863) (-943.040) (-942.056) * (-948.427) (-941.854) (-941.908) [-943.616] -- 0:00:28
538000 -- (-945.083) (-944.850) [-942.580] (-941.528) * (-948.087) [-943.879] (-946.543) (-943.014) -- 0:00:28
538500 -- (-946.532) (-944.386) (-945.857) [-942.199] * [-941.796] (-942.030) (-943.066) (-942.757) -- 0:00:28
539000 -- (-944.997) (-946.806) [-943.270] (-943.802) * (-942.552) [-941.763] (-943.600) (-942.767) -- 0:00:28
539500 -- [-941.804] (-948.936) (-942.516) (-942.723) * (-945.095) [-941.294] (-943.965) (-946.420) -- 0:00:28
540000 -- (-942.885) [-944.081] (-945.560) (-945.405) * (-944.879) [-941.430] (-942.925) (-947.185) -- 0:00:28
Average standard deviation of split frequencies: 0.008991
540500 -- (-947.526) (-946.774) [-946.927] (-943.593) * [-944.768] (-941.395) (-944.222) (-944.200) -- 0:00:28
541000 -- (-943.637) [-941.176] (-943.681) (-943.310) * (-949.386) [-943.537] (-943.290) (-943.276) -- 0:00:27
541500 -- (-947.249) (-941.686) [-943.022] (-943.466) * (-946.382) (-944.922) [-942.788] (-944.977) -- 0:00:27
542000 -- (-941.840) (-946.590) [-941.237] (-945.572) * [-944.936] (-944.895) (-943.056) (-942.188) -- 0:00:27
542500 -- (-944.511) [-941.572] (-944.978) (-942.728) * (-944.555) [-944.735] (-943.324) (-941.936) -- 0:00:27
543000 -- (-944.471) (-941.754) [-942.555] (-943.610) * (-945.327) (-943.377) [-942.387] (-942.962) -- 0:00:27
543500 -- [-942.071] (-943.912) (-944.914) (-944.647) * (-941.443) [-944.900] (-945.140) (-943.364) -- 0:00:27
544000 -- [-941.424] (-941.755) (-944.471) (-945.673) * [-943.574] (-942.956) (-941.801) (-943.975) -- 0:00:27
544500 -- (-944.685) (-942.383) [-942.511] (-946.332) * (-943.400) (-942.232) [-944.646] (-943.477) -- 0:00:27
545000 -- [-943.641] (-943.065) (-947.389) (-945.076) * [-944.698] (-943.098) (-946.045) (-944.429) -- 0:00:27
Average standard deviation of split frequencies: 0.009227
545500 -- (-944.729) (-942.578) (-942.152) [-941.862] * [-943.553] (-945.557) (-948.300) (-942.730) -- 0:00:27
546000 -- (-946.552) [-943.856] (-945.010) (-943.736) * (-947.175) [-944.538] (-945.373) (-942.478) -- 0:00:27
546500 -- (-943.245) (-942.329) [-944.056] (-944.034) * (-947.365) (-946.523) [-943.943] (-942.451) -- 0:00:27
547000 -- [-943.649] (-944.386) (-941.974) (-945.691) * (-944.257) [-942.033] (-943.751) (-942.607) -- 0:00:27
547500 -- [-942.944] (-941.706) (-941.980) (-942.973) * [-942.560] (-944.397) (-942.570) (-942.037) -- 0:00:28
548000 -- [-944.865] (-942.734) (-942.244) (-946.018) * (-944.578) [-946.144] (-942.826) (-941.959) -- 0:00:28
548500 -- (-943.381) (-942.020) (-942.626) [-943.619] * (-941.969) [-944.941] (-942.544) (-943.554) -- 0:00:27
549000 -- (-952.224) (-945.389) [-942.688] (-942.265) * (-944.694) (-943.250) [-942.364] (-946.455) -- 0:00:27
549500 -- [-945.141] (-943.597) (-942.747) (-945.802) * (-943.103) [-942.486] (-946.979) (-941.976) -- 0:00:27
550000 -- (-945.701) [-945.649] (-948.914) (-943.615) * (-944.665) [-943.589] (-942.517) (-945.287) -- 0:00:27
Average standard deviation of split frequencies: 0.009684
550500 -- (-941.908) [-944.595] (-947.053) (-944.312) * (-947.774) (-942.834) (-941.616) [-942.985] -- 0:00:27
551000 -- [-943.347] (-944.744) (-949.488) (-945.101) * (-945.594) (-944.532) (-943.972) [-942.982] -- 0:00:27
551500 -- (-942.174) (-944.627) [-947.170] (-943.133) * (-947.735) (-943.867) [-942.297] (-943.377) -- 0:00:27
552000 -- (-942.998) (-944.294) (-944.672) [-944.501] * (-945.962) (-945.027) (-943.084) [-944.722] -- 0:00:27
552500 -- (-945.342) [-943.506] (-946.404) (-945.274) * [-942.860] (-944.420) (-947.572) (-945.873) -- 0:00:27
553000 -- (-942.211) (-943.810) (-943.774) [-945.027] * (-944.186) (-942.675) (-946.335) [-945.816] -- 0:00:27
553500 -- [-943.422] (-949.752) (-944.459) (-944.404) * [-943.357] (-941.930) (-946.118) (-945.942) -- 0:00:27
554000 -- (-944.483) (-947.838) (-942.834) [-942.648] * (-941.757) [-945.361] (-944.868) (-943.537) -- 0:00:27
554500 -- (-944.119) [-946.300] (-944.355) (-941.918) * (-944.706) (-945.050) (-950.179) [-942.150] -- 0:00:27
555000 -- (-941.962) (-941.921) [-944.177] (-941.568) * [-943.579] (-942.048) (-942.922) (-943.896) -- 0:00:27
Average standard deviation of split frequencies: 0.009856
555500 -- (-942.394) [-941.308] (-944.172) (-942.074) * (-943.220) (-942.235) (-942.545) [-941.684] -- 0:00:27
556000 -- (-942.988) (-943.844) [-941.779] (-944.543) * (-943.511) (-941.646) [-942.877] (-942.035) -- 0:00:27
556500 -- [-942.198] (-941.337) (-943.932) (-943.613) * (-943.832) [-944.653] (-946.488) (-945.988) -- 0:00:27
557000 -- (-941.770) [-943.433] (-941.704) (-946.180) * (-944.185) (-944.763) [-943.578] (-943.278) -- 0:00:27
557500 -- (-944.075) (-947.793) (-942.791) [-945.596] * (-946.238) (-944.046) [-941.694] (-943.467) -- 0:00:26
558000 -- (-941.901) [-944.948] (-946.461) (-942.587) * (-946.606) (-950.164) [-942.564] (-943.916) -- 0:00:26
558500 -- (-944.124) [-945.350] (-945.396) (-942.521) * (-941.808) (-942.077) (-942.664) [-943.974] -- 0:00:26
559000 -- (-945.234) (-944.874) (-944.008) [-946.145] * (-942.206) (-942.411) (-943.980) [-943.159] -- 0:00:26
559500 -- [-941.784] (-942.442) (-942.819) (-949.405) * (-944.439) (-943.712) [-941.243] (-942.662) -- 0:00:26
560000 -- (-946.483) (-942.933) [-943.376] (-947.427) * (-941.636) (-942.294) [-942.743] (-942.653) -- 0:00:26
Average standard deviation of split frequencies: 0.009249
560500 -- (-944.559) (-942.096) [-942.158] (-944.548) * (-942.242) (-944.870) (-945.785) [-944.873] -- 0:00:26
561000 -- (-944.121) (-942.734) (-946.990) [-944.784] * (-944.141) [-941.687] (-947.255) (-945.744) -- 0:00:26
561500 -- (-944.187) (-944.234) (-942.148) [-943.945] * (-943.575) (-942.609) [-944.143] (-943.869) -- 0:00:26
562000 -- (-945.717) [-941.965] (-945.424) (-943.500) * [-944.058] (-945.016) (-943.323) (-947.816) -- 0:00:26
562500 -- (-945.344) (-944.039) (-943.263) [-944.179] * [-943.839] (-943.999) (-949.510) (-946.131) -- 0:00:26
563000 -- (-946.451) [-942.876] (-943.390) (-944.922) * (-945.184) (-942.601) [-948.888] (-943.828) -- 0:00:26
563500 -- (-947.352) (-942.231) [-942.391] (-944.237) * (-945.186) (-941.737) (-945.531) [-943.565] -- 0:00:26
564000 -- [-943.030] (-941.397) (-946.781) (-944.880) * (-944.596) (-942.742) (-942.005) [-942.653] -- 0:00:27
564500 -- (-946.257) [-942.275] (-947.434) (-942.448) * (-943.720) (-942.996) (-948.545) [-941.908] -- 0:00:27
565000 -- (-946.086) (-942.566) [-943.230] (-944.892) * (-946.713) (-949.480) [-944.761] (-946.234) -- 0:00:26
Average standard deviation of split frequencies: 0.008693
565500 -- (-950.209) (-944.543) (-943.306) [-943.945] * (-943.783) [-943.702] (-943.190) (-942.488) -- 0:00:26
566000 -- (-945.602) [-944.437] (-942.354) (-941.922) * (-945.609) (-946.670) [-943.182] (-942.874) -- 0:00:26
566500 -- (-941.039) [-945.762] (-944.864) (-941.914) * [-944.379] (-944.298) (-945.909) (-943.995) -- 0:00:26
567000 -- (-943.909) [-943.585] (-942.345) (-942.647) * (-944.906) [-947.132] (-948.545) (-943.726) -- 0:00:26
567500 -- (-946.756) (-944.030) (-943.401) [-943.055] * (-946.283) (-944.152) [-942.732] (-941.395) -- 0:00:26
568000 -- (-944.188) [-943.804] (-943.624) (-943.806) * (-942.407) (-942.412) (-945.655) [-941.988] -- 0:00:26
568500 -- [-947.098] (-942.465) (-943.478) (-945.484) * (-944.359) (-941.854) [-944.653] (-942.866) -- 0:00:26
569000 -- (-941.593) (-941.097) (-944.627) [-947.208] * (-941.718) (-942.658) [-942.200] (-942.570) -- 0:00:26
569500 -- [-942.246] (-942.728) (-944.926) (-943.949) * (-942.188) [-943.567] (-944.688) (-946.389) -- 0:00:26
570000 -- [-942.807] (-943.375) (-948.586) (-944.237) * (-943.439) (-943.165) (-943.754) [-948.053] -- 0:00:26
Average standard deviation of split frequencies: 0.008622
570500 -- [-941.619] (-942.502) (-943.527) (-946.092) * (-947.547) [-943.933] (-944.235) (-942.723) -- 0:00:26
571000 -- (-945.045) (-943.236) [-945.083] (-941.616) * (-945.032) (-947.344) (-943.583) [-942.178] -- 0:00:26
571500 -- (-946.896) [-942.508] (-951.930) (-943.222) * (-942.516) (-943.308) [-942.444] (-943.586) -- 0:00:26
572000 -- (-946.904) (-943.205) (-949.593) [-943.440] * (-945.155) [-941.562] (-943.359) (-945.051) -- 0:00:26
572500 -- (-942.534) (-943.132) [-942.266] (-944.018) * [-943.800] (-943.299) (-945.753) (-942.810) -- 0:00:26
573000 -- (-944.429) (-942.198) (-942.606) [-942.802] * (-942.874) (-942.443) (-941.959) [-942.456] -- 0:00:26
573500 -- [-942.360] (-943.020) (-942.654) (-942.965) * (-942.303) [-942.512] (-945.346) (-943.456) -- 0:00:26
574000 -- (-948.337) [-944.520] (-945.123) (-942.697) * [-941.822] (-946.785) (-942.915) (-944.758) -- 0:00:25
574500 -- [-943.994] (-946.410) (-947.319) (-941.753) * (-941.908) (-946.524) (-943.850) [-943.245] -- 0:00:25
575000 -- (-943.318) (-944.373) [-943.972] (-942.150) * [-941.749] (-942.555) (-942.218) (-944.074) -- 0:00:25
Average standard deviation of split frequencies: 0.008798
575500 -- (-943.988) [-943.523] (-941.883) (-946.674) * (-946.592) (-945.039) [-941.871] (-945.436) -- 0:00:25
576000 -- [-941.735] (-941.725) (-947.889) (-941.759) * (-944.647) [-941.618] (-941.412) (-943.147) -- 0:00:25
576500 -- (-942.991) (-944.237) (-950.909) [-944.225] * (-945.665) (-943.259) (-942.732) [-944.442] -- 0:00:25
577000 -- (-945.354) (-943.483) (-943.308) [-946.332] * (-943.316) (-942.105) [-941.675] (-944.950) -- 0:00:25
577500 -- [-943.986] (-943.717) (-945.182) (-943.956) * (-944.775) [-941.786] (-942.072) (-943.031) -- 0:00:25
578000 -- (-944.467) (-942.405) [-944.571] (-951.590) * (-945.904) (-942.110) (-942.810) [-945.585] -- 0:00:25
578500 -- (-941.801) (-945.439) [-944.199] (-944.666) * (-945.318) (-943.604) [-943.425] (-941.834) -- 0:00:25
579000 -- [-941.788] (-943.465) (-948.717) (-945.543) * [-941.772] (-943.573) (-942.496) (-948.570) -- 0:00:25
579500 -- [-942.502] (-942.466) (-942.354) (-946.026) * [-943.038] (-945.068) (-945.573) (-945.040) -- 0:00:25
580000 -- (-945.085) [-944.444] (-942.276) (-943.265) * (-942.345) (-943.143) [-942.857] (-945.152) -- 0:00:25
Average standard deviation of split frequencies: 0.008676
580500 -- (-945.173) (-942.614) [-943.145] (-943.919) * (-941.620) (-944.075) (-945.005) [-943.071] -- 0:00:26
581000 -- (-945.507) [-942.684] (-941.879) (-942.327) * (-943.175) (-949.882) [-947.192] (-948.022) -- 0:00:25
581500 -- (-946.824) (-944.343) (-942.506) [-941.495] * (-945.915) (-943.134) [-942.922] (-942.451) -- 0:00:25
582000 -- (-942.450) (-942.420) [-943.648] (-945.223) * (-942.644) [-943.605] (-942.958) (-945.560) -- 0:00:25
582500 -- [-943.098] (-942.653) (-942.076) (-942.329) * [-942.921] (-948.076) (-942.802) (-942.094) -- 0:00:25
583000 -- (-942.105) (-942.536) (-942.706) [-944.462] * [-944.096] (-946.596) (-941.868) (-943.133) -- 0:00:25
583500 -- (-943.712) (-946.041) (-943.353) [-943.203] * (-942.786) (-946.210) (-942.877) [-942.626] -- 0:00:25
584000 -- (-943.136) (-946.902) (-944.884) [-943.117] * [-941.642] (-942.375) (-944.654) (-947.433) -- 0:00:25
584500 -- (-944.638) (-941.708) (-944.368) [-943.134] * (-943.867) [-941.552] (-948.531) (-944.771) -- 0:00:25
585000 -- (-943.208) (-941.682) [-943.504] (-944.258) * (-945.936) [-941.384] (-946.202) (-942.413) -- 0:00:25
Average standard deviation of split frequencies: 0.008346
585500 -- [-944.523] (-944.074) (-943.496) (-943.056) * [-944.302] (-942.753) (-943.589) (-942.472) -- 0:00:25
586000 -- [-945.192] (-943.029) (-944.979) (-943.161) * [-942.438] (-943.863) (-941.266) (-945.169) -- 0:00:25
586500 -- (-945.787) (-945.817) (-943.233) [-943.741] * (-942.481) (-943.515) [-942.069] (-942.427) -- 0:00:25
587000 -- [-943.030] (-943.780) (-943.296) (-943.532) * [-941.576] (-942.434) (-942.805) (-941.673) -- 0:00:25
587500 -- (-943.227) (-942.028) (-942.367) [-942.537] * (-944.449) (-942.713) [-943.723] (-943.586) -- 0:00:25
588000 -- (-942.473) (-943.465) (-943.626) [-946.754] * (-945.231) (-946.034) [-946.008] (-942.870) -- 0:00:25
588500 -- [-942.361] (-942.753) (-943.155) (-942.412) * (-947.211) (-944.910) (-945.023) [-943.450] -- 0:00:25
589000 -- [-942.921] (-945.077) (-943.654) (-944.279) * (-943.785) [-946.841] (-941.955) (-943.133) -- 0:00:25
589500 -- (-943.759) [-941.747] (-943.809) (-942.234) * (-952.153) (-942.697) (-947.607) [-943.001] -- 0:00:25
590000 -- (-942.483) [-943.150] (-945.110) (-943.595) * [-949.318] (-943.043) (-945.549) (-941.705) -- 0:00:25
Average standard deviation of split frequencies: 0.007831
590500 -- (-941.890) (-942.602) [-945.769] (-943.888) * [-942.966] (-942.796) (-944.443) (-944.074) -- 0:00:24
591000 -- [-942.568] (-943.295) (-943.516) (-945.249) * (-948.151) (-945.764) [-943.103] (-942.637) -- 0:00:24
591500 -- (-942.770) (-943.040) [-943.054] (-944.060) * (-943.775) [-942.156] (-943.299) (-941.183) -- 0:00:24
592000 -- (-941.509) (-943.143) [-942.291] (-942.585) * [-941.403] (-945.174) (-943.540) (-942.790) -- 0:00:24
592500 -- (-942.606) (-942.679) [-943.408] (-943.050) * [-941.478] (-946.384) (-944.808) (-946.394) -- 0:00:24
593000 -- (-943.726) (-947.206) (-942.631) [-944.566] * (-942.089) [-944.099] (-942.999) (-944.132) -- 0:00:24
593500 -- (-942.603) [-943.427] (-941.717) (-942.796) * [-942.837] (-944.669) (-946.950) (-942.189) -- 0:00:24
594000 -- [-944.098] (-945.591) (-944.054) (-942.976) * (-943.382) (-945.568) [-944.363] (-941.704) -- 0:00:24
594500 -- (-947.663) (-943.082) (-944.186) [-942.729] * (-944.766) [-945.385] (-942.555) (-944.433) -- 0:00:24
595000 -- [-945.274] (-947.748) (-945.158) (-943.991) * [-945.669] (-944.935) (-943.557) (-942.220) -- 0:00:24
Average standard deviation of split frequencies: 0.007465
595500 -- (-943.205) [-942.650] (-944.162) (-943.521) * [-945.813] (-946.095) (-943.569) (-942.356) -- 0:00:24
596000 -- (-943.016) (-945.015) (-943.859) [-941.489] * [-941.589] (-943.415) (-941.608) (-943.195) -- 0:00:24
596500 -- (-944.281) (-943.941) [-943.194] (-947.071) * [-944.039] (-944.780) (-941.898) (-946.547) -- 0:00:24
597000 -- (-942.764) (-945.001) [-941.293] (-946.326) * (-942.880) (-943.284) [-942.756] (-943.844) -- 0:00:24
597500 -- [-945.275] (-946.704) (-947.090) (-950.375) * (-942.821) (-943.290) (-941.199) [-943.187] -- 0:00:24
598000 -- (-941.711) [-943.975] (-945.607) (-945.513) * [-942.265] (-941.813) (-941.577) (-941.682) -- 0:00:24
598500 -- (-945.434) (-943.059) (-947.057) [-944.935] * [-947.711] (-942.036) (-942.211) (-942.704) -- 0:00:24
599000 -- (-946.738) [-943.234] (-944.516) (-946.090) * [-946.188] (-943.194) (-942.437) (-945.089) -- 0:00:24
599500 -- [-947.036] (-943.155) (-942.236) (-944.415) * (-947.972) [-942.672] (-943.692) (-944.592) -- 0:00:24
600000 -- [-946.219] (-942.597) (-945.520) (-942.497) * (-944.461) (-944.869) [-942.110] (-945.204) -- 0:00:24
Average standard deviation of split frequencies: 0.007456
600500 -- [-942.327] (-942.873) (-943.054) (-945.511) * (-942.009) (-945.070) (-943.777) [-943.974] -- 0:00:24
601000 -- (-944.146) (-942.959) (-944.456) [-943.080] * (-944.147) [-942.450] (-941.495) (-947.336) -- 0:00:24
601500 -- [-941.510] (-943.684) (-942.590) (-945.620) * (-945.164) [-948.850] (-945.602) (-945.399) -- 0:00:24
602000 -- (-941.424) [-942.734] (-943.854) (-944.279) * (-946.216) [-946.358] (-945.650) (-943.563) -- 0:00:24
602500 -- [-941.251] (-942.391) (-947.676) (-943.644) * (-944.750) [-942.575] (-941.231) (-943.603) -- 0:00:24
603000 -- [-942.881] (-941.644) (-944.047) (-950.656) * (-942.898) (-941.230) [-941.387] (-945.148) -- 0:00:24
603500 -- [-942.841] (-943.000) (-945.007) (-943.279) * (-942.497) [-945.614] (-941.651) (-946.291) -- 0:00:24
604000 -- (-943.440) (-942.078) (-944.076) [-943.513] * [-943.337] (-943.122) (-941.710) (-941.765) -- 0:00:24
604500 -- (-941.126) (-941.935) [-941.543] (-941.948) * (-941.610) (-942.096) (-943.834) [-942.366] -- 0:00:24
605000 -- (-943.774) [-946.164] (-944.593) (-941.910) * [-946.237] (-941.966) (-943.057) (-947.007) -- 0:00:24
Average standard deviation of split frequencies: 0.007050
605500 -- (-944.976) [-945.163] (-946.363) (-942.025) * (-946.824) (-941.447) [-944.455] (-942.988) -- 0:00:24
606000 -- (-942.529) [-945.735] (-946.510) (-944.183) * [-943.133] (-943.693) (-942.942) (-943.560) -- 0:00:24
606500 -- (-941.702) (-942.387) [-942.519] (-945.428) * (-943.258) [-942.441] (-942.421) (-944.741) -- 0:00:24
607000 -- (-942.267) [-943.850] (-942.503) (-941.339) * (-946.937) (-942.550) (-947.145) [-943.809] -- 0:00:23
607500 -- (-941.809) (-943.163) [-942.912] (-942.130) * (-942.778) (-946.899) (-944.183) [-942.217] -- 0:00:23
608000 -- [-942.153] (-943.718) (-945.739) (-945.595) * (-943.123) (-946.688) (-944.287) [-944.086] -- 0:00:23
608500 -- [-941.478] (-942.602) (-945.316) (-942.689) * (-947.368) (-942.959) [-943.483] (-945.474) -- 0:00:23
609000 -- [-942.587] (-942.185) (-947.090) (-945.041) * [-943.344] (-943.871) (-943.438) (-948.791) -- 0:00:23
609500 -- (-942.803) (-941.800) (-943.079) [-946.428] * (-943.690) (-945.488) (-942.968) [-943.567] -- 0:00:23
610000 -- (-942.740) (-943.228) (-941.882) [-943.684] * [-942.257] (-943.690) (-945.235) (-944.304) -- 0:00:23
Average standard deviation of split frequencies: 0.007720
610500 -- (-942.449) [-943.206] (-945.013) (-943.028) * (-943.008) (-942.275) [-944.280] (-943.585) -- 0:00:23
611000 -- (-945.794) (-944.729) [-943.639] (-947.839) * [-942.868] (-944.426) (-941.332) (-943.110) -- 0:00:23
611500 -- (-945.893) [-943.744] (-946.180) (-943.084) * (-944.962) (-943.520) (-943.748) [-945.777] -- 0:00:23
612000 -- (-948.094) (-943.441) (-943.442) [-946.219] * [-942.199] (-942.984) (-942.245) (-944.562) -- 0:00:23
612500 -- (-944.064) (-946.021) [-944.513] (-947.217) * (-946.714) (-945.539) (-944.934) [-941.875] -- 0:00:23
613000 -- (-946.003) [-941.965] (-945.002) (-945.257) * (-942.969) (-943.978) (-941.855) [-941.658] -- 0:00:23
613500 -- (-941.830) (-942.515) (-943.711) [-942.615] * (-942.673) (-941.821) (-944.127) [-941.702] -- 0:00:23
614000 -- (-944.078) (-941.062) (-944.507) [-942.498] * (-946.566) (-942.874) (-946.146) [-943.972] -- 0:00:23
614500 -- (-943.363) (-944.914) (-941.174) [-941.784] * (-949.800) (-941.314) [-942.587] (-944.200) -- 0:00:23
615000 -- (-942.262) (-944.866) [-945.159] (-941.927) * (-946.463) (-942.935) (-943.344) [-944.437] -- 0:00:23
Average standard deviation of split frequencies: 0.007461
615500 -- (-941.516) (-942.828) (-942.062) [-941.848] * [-944.062] (-945.395) (-945.171) (-942.798) -- 0:00:23
616000 -- [-943.482] (-949.923) (-947.110) (-945.195) * (-943.206) (-944.856) (-944.945) [-943.345] -- 0:00:23
616500 -- (-943.942) (-944.812) [-942.829] (-943.715) * [-943.210] (-948.508) (-944.327) (-942.216) -- 0:00:23
617000 -- [-944.079] (-942.254) (-945.472) (-945.185) * (-943.928) (-942.747) (-942.683) [-942.635] -- 0:00:23
617500 -- (-946.412) [-942.050] (-948.494) (-945.421) * (-942.078) (-942.250) [-945.100] (-946.841) -- 0:00:23
618000 -- (-943.270) [-942.848] (-943.441) (-943.348) * (-942.950) (-943.013) [-942.110] (-943.819) -- 0:00:23
618500 -- (-941.909) (-942.905) (-945.740) [-942.114] * [-942.375] (-942.296) (-942.503) (-945.757) -- 0:00:23
619000 -- (-944.210) [-942.310] (-945.600) (-943.945) * [-942.751] (-942.179) (-943.147) (-945.003) -- 0:00:23
619500 -- (-947.534) (-943.127) [-942.367] (-941.606) * (-944.166) (-943.588) (-945.341) [-943.347] -- 0:00:23
620000 -- (-945.845) [-942.933] (-942.789) (-944.546) * [-944.567] (-945.831) (-942.809) (-942.264) -- 0:00:23
Average standard deviation of split frequencies: 0.007548
620500 -- (-944.562) (-947.374) (-943.598) [-941.516] * (-944.407) [-942.878] (-942.587) (-942.745) -- 0:00:23
621000 -- (-942.146) [-942.585] (-942.991) (-941.862) * (-943.358) (-941.688) (-941.988) [-943.468] -- 0:00:23
621500 -- [-942.477] (-941.495) (-945.418) (-944.018) * (-941.449) [-942.785] (-944.858) (-942.357) -- 0:00:23
622000 -- [-945.459] (-941.203) (-943.536) (-945.495) * [-942.449] (-943.703) (-944.117) (-943.318) -- 0:00:23
622500 -- [-943.004] (-943.533) (-942.042) (-943.579) * (-943.185) (-945.695) (-942.935) [-941.995] -- 0:00:23
623000 -- (-945.092) (-943.837) (-942.619) [-943.389] * (-945.191) [-944.758] (-942.411) (-943.049) -- 0:00:22
623500 -- (-944.081) (-941.487) [-944.317] (-942.484) * (-942.210) [-942.852] (-943.793) (-944.987) -- 0:00:22
624000 -- (-942.812) (-943.292) [-943.515] (-947.012) * (-943.876) (-942.372) (-943.236) [-944.338] -- 0:00:22
624500 -- [-942.387] (-943.691) (-942.518) (-942.038) * (-944.232) [-942.247] (-942.214) (-944.425) -- 0:00:22
625000 -- (-943.685) [-943.359] (-942.092) (-943.355) * (-944.301) (-942.727) (-945.117) [-942.814] -- 0:00:22
Average standard deviation of split frequencies: 0.007766
625500 -- (-944.440) (-943.331) (-941.591) [-945.939] * (-942.633) (-942.925) [-942.538] (-943.075) -- 0:00:22
626000 -- (-942.393) [-942.677] (-943.045) (-945.569) * (-944.940) (-941.295) [-941.956] (-943.597) -- 0:00:22
626500 -- [-943.679] (-943.794) (-945.470) (-947.090) * (-945.000) [-941.203] (-944.942) (-947.692) -- 0:00:22
627000 -- (-943.934) (-945.851) (-947.710) [-946.650] * (-942.122) [-941.935] (-946.167) (-948.507) -- 0:00:22
627500 -- (-951.768) (-941.245) (-941.452) [-941.188] * [-943.167] (-941.966) (-943.937) (-946.021) -- 0:00:22
628000 -- [-943.522] (-943.868) (-942.690) (-943.815) * (-943.230) (-943.202) (-943.904) [-944.736] -- 0:00:22
628500 -- [-945.277] (-942.535) (-943.526) (-943.099) * (-942.136) (-945.330) (-941.208) [-944.008] -- 0:00:22
629000 -- (-941.972) (-944.961) [-942.630] (-943.502) * (-942.225) [-943.804] (-943.678) (-945.726) -- 0:00:22
629500 -- (-941.874) [-945.661] (-943.105) (-945.562) * (-941.708) (-941.721) [-942.329] (-944.943) -- 0:00:22
630000 -- (-943.207) (-945.464) [-942.228] (-941.894) * (-942.591) (-941.721) [-942.389] (-943.549) -- 0:00:22
Average standard deviation of split frequencies: 0.007708
630500 -- (-942.480) [-943.427] (-947.071) (-942.836) * (-944.232) (-946.625) (-947.055) [-944.606] -- 0:00:22
631000 -- (-942.285) [-942.863] (-943.171) (-942.161) * (-942.193) (-944.862) (-946.745) [-943.676] -- 0:00:22
631500 -- (-947.772) [-943.608] (-944.261) (-942.951) * (-944.797) (-942.710) [-945.109] (-947.704) -- 0:00:22
632000 -- (-943.818) (-945.691) [-943.161] (-943.348) * (-948.000) [-941.461] (-942.059) (-946.974) -- 0:00:22
632500 -- [-945.654] (-949.264) (-942.434) (-942.209) * (-943.518) (-943.770) (-945.391) [-948.759] -- 0:00:22
633000 -- (-945.043) (-943.376) (-945.502) [-944.501] * (-942.895) (-943.631) (-944.722) [-943.129] -- 0:00:22
633500 -- (-948.093) (-943.480) (-942.183) [-941.475] * (-943.298) (-942.962) (-946.232) [-945.206] -- 0:00:22
634000 -- (-946.969) (-942.079) [-942.505] (-942.784) * (-942.774) [-941.296] (-945.064) (-944.505) -- 0:00:22
634500 -- (-944.525) (-942.228) [-942.968] (-942.257) * (-942.574) (-947.515) [-944.756] (-943.140) -- 0:00:22
635000 -- (-943.853) [-942.258] (-943.054) (-943.363) * (-945.752) (-943.760) [-941.860] (-944.653) -- 0:00:22
Average standard deviation of split frequencies: 0.007180
635500 -- (-943.895) (-944.415) [-941.768] (-943.157) * [-941.993] (-942.546) (-944.777) (-945.714) -- 0:00:22
636000 -- (-942.988) (-943.306) (-945.244) [-945.034] * (-941.672) (-941.604) (-942.859) [-945.190] -- 0:00:22
636500 -- (-943.248) [-942.388] (-943.984) (-944.052) * (-943.884) (-944.274) [-942.968] (-942.511) -- 0:00:22
637000 -- (-942.744) [-942.680] (-946.184) (-942.010) * [-941.624] (-945.153) (-943.629) (-947.695) -- 0:00:22
637500 -- (-942.085) (-946.064) [-942.648] (-944.715) * (-942.318) (-943.963) (-944.313) [-941.026] -- 0:00:22
638000 -- (-944.451) [-947.293] (-943.610) (-944.805) * (-941.575) (-945.966) [-944.685] (-943.623) -- 0:00:22
638500 -- (-941.980) [-942.319] (-941.862) (-945.981) * (-941.980) (-944.765) [-943.005] (-943.329) -- 0:00:22
639000 -- (-945.515) (-942.350) (-949.347) [-942.707] * [-943.855] (-945.624) (-941.504) (-943.049) -- 0:00:22
639500 -- (-948.245) (-945.637) (-946.110) [-943.491] * (-944.029) (-948.055) (-942.346) [-941.177] -- 0:00:21
640000 -- (-947.597) (-943.316) [-943.514] (-942.389) * (-947.066) (-942.560) (-950.862) [-944.948] -- 0:00:21
Average standard deviation of split frequencies: 0.007542
640500 -- (-954.976) [-943.918] (-943.906) (-945.036) * (-942.186) (-942.534) [-945.463] (-942.182) -- 0:00:21
641000 -- (-947.061) (-943.392) (-942.232) [-947.262] * (-943.126) [-941.202] (-943.434) (-944.062) -- 0:00:21
641500 -- (-942.125) [-945.339] (-944.253) (-946.256) * (-945.901) (-943.049) (-942.914) [-943.130] -- 0:00:21
642000 -- (-941.993) (-943.214) (-944.010) [-947.751] * (-944.376) (-941.842) (-944.620) [-944.604] -- 0:00:21
642500 -- (-945.113) (-943.261) [-941.944] (-944.355) * (-943.883) [-942.734] (-944.557) (-949.822) -- 0:00:21
643000 -- (-945.020) [-942.817] (-941.968) (-945.641) * [-943.521] (-946.862) (-944.317) (-942.390) -- 0:00:21
643500 -- (-946.239) (-945.043) [-947.743] (-943.919) * [-942.325] (-943.841) (-943.964) (-943.055) -- 0:00:21
644000 -- (-942.603) (-948.015) (-946.185) [-943.317] * (-942.632) [-942.488] (-942.594) (-944.870) -- 0:00:21
644500 -- [-943.673] (-947.784) (-944.522) (-943.042) * (-942.564) (-946.483) [-942.083] (-943.352) -- 0:00:21
645000 -- [-941.932] (-941.466) (-944.569) (-944.040) * (-942.426) [-946.115] (-942.756) (-943.240) -- 0:00:21
Average standard deviation of split frequencies: 0.007126
645500 -- (-944.246) (-945.475) [-944.868] (-942.453) * (-943.570) (-943.052) (-945.352) [-942.973] -- 0:00:21
646000 -- [-942.864] (-945.491) (-943.007) (-943.365) * (-947.349) (-944.918) [-945.037] (-942.157) -- 0:00:21
646500 -- (-942.847) (-943.746) (-944.818) [-943.040] * (-942.729) (-943.071) (-945.348) [-941.523] -- 0:00:21
647000 -- [-942.137] (-946.217) (-941.056) (-943.652) * (-943.590) [-943.400] (-945.055) (-944.206) -- 0:00:21
647500 -- [-943.946] (-945.647) (-945.104) (-944.754) * (-943.238) (-943.413) [-945.152] (-944.425) -- 0:00:21
648000 -- (-945.168) (-947.509) (-944.827) [-944.779] * (-942.043) (-942.149) (-943.562) [-942.138] -- 0:00:21
648500 -- (-948.248) (-943.429) (-942.444) [-942.517] * (-943.913) (-942.373) (-949.503) [-944.957] -- 0:00:21
649000 -- (-947.527) (-946.656) [-942.846] (-941.767) * (-944.636) (-941.819) [-944.571] (-946.540) -- 0:00:21
649500 -- (-942.006) (-947.077) [-944.733] (-943.421) * (-943.840) [-942.258] (-945.087) (-945.709) -- 0:00:21
650000 -- (-942.389) (-948.661) (-947.373) [-942.723] * [-942.267] (-942.621) (-942.254) (-941.640) -- 0:00:21
Average standard deviation of split frequencies: 0.007160
650500 -- (-945.383) (-944.979) [-942.788] (-943.094) * [-942.445] (-942.034) (-941.680) (-942.364) -- 0:00:21
651000 -- (-944.938) (-943.041) (-943.528) [-941.608] * (-943.389) (-942.613) [-942.993] (-942.569) -- 0:00:21
651500 -- (-944.244) (-942.017) (-941.365) [-942.629] * [-945.751] (-942.755) (-946.929) (-946.866) -- 0:00:21
652000 -- (-942.193) (-944.384) (-945.487) [-943.747] * (-946.769) [-943.658] (-949.274) (-943.344) -- 0:00:21
652500 -- (-943.752) (-942.034) [-941.609] (-942.116) * (-943.239) (-944.605) [-943.132] (-942.307) -- 0:00:21
653000 -- (-942.974) (-941.167) (-946.903) [-946.922] * [-943.308] (-942.271) (-942.152) (-943.525) -- 0:00:21
653500 -- (-945.904) (-944.457) [-943.684] (-944.502) * (-942.981) (-944.668) [-942.879] (-942.369) -- 0:00:21
654000 -- [-942.863] (-942.830) (-944.470) (-948.431) * (-941.792) [-942.149] (-942.247) (-943.326) -- 0:00:21
654500 -- (-942.451) [-942.838] (-943.059) (-946.229) * [-941.735] (-943.043) (-941.695) (-944.143) -- 0:00:21
655000 -- (-942.669) (-943.808) [-942.615] (-945.140) * [-942.015] (-944.858) (-941.953) (-942.976) -- 0:00:21
Average standard deviation of split frequencies: 0.007651
655500 -- (-942.434) [-944.525] (-944.489) (-942.732) * (-942.324) (-943.578) (-941.757) [-942.131] -- 0:00:21
656000 -- (-941.549) (-944.342) (-944.658) [-948.017] * (-945.621) [-942.793] (-941.801) (-943.849) -- 0:00:20
656500 -- (-945.314) [-942.490] (-944.483) (-948.481) * [-942.847] (-942.604) (-945.649) (-943.530) -- 0:00:20
657000 -- (-945.085) (-947.798) (-945.249) [-943.876] * (-944.869) (-944.223) (-941.614) [-942.815] -- 0:00:20
657500 -- (-943.014) (-942.385) [-943.188] (-941.862) * (-944.095) [-942.902] (-941.284) (-942.235) -- 0:00:20
658000 -- (-941.898) [-942.170] (-945.642) (-943.456) * (-941.917) (-944.450) (-942.000) [-942.854] -- 0:00:20
658500 -- (-941.863) [-944.280] (-951.721) (-942.486) * (-948.406) (-945.398) (-946.083) [-943.013] -- 0:00:20
659000 -- (-944.125) (-943.654) [-943.553] (-945.147) * (-946.066) (-943.410) [-942.745] (-943.357) -- 0:00:20
659500 -- (-945.954) (-943.200) [-941.874] (-944.346) * (-944.166) (-942.269) [-941.683] (-944.705) -- 0:00:20
660000 -- [-942.233] (-947.457) (-941.982) (-944.056) * (-943.084) (-944.070) [-942.050] (-943.399) -- 0:00:20
Average standard deviation of split frequencies: 0.007135
660500 -- (-941.112) [-942.616] (-941.961) (-943.972) * [-943.000] (-944.828) (-944.677) (-943.744) -- 0:00:20
661000 -- (-945.604) (-943.947) (-944.599) [-942.576] * (-943.359) [-941.596] (-941.692) (-944.350) -- 0:00:20
661500 -- (-942.984) (-943.730) [-946.244] (-943.742) * (-946.851) [-942.200] (-945.381) (-943.315) -- 0:00:20
662000 -- [-941.893] (-944.165) (-941.267) (-943.501) * [-946.718] (-947.856) (-943.262) (-942.795) -- 0:00:20
662500 -- (-943.425) (-944.133) [-941.160] (-942.266) * (-944.180) (-943.739) (-943.979) [-944.915] -- 0:00:20
663000 -- (-943.854) (-942.550) [-941.119] (-942.120) * (-942.255) (-943.872) (-943.214) [-943.937] -- 0:00:20
663500 -- (-948.036) [-942.835] (-944.791) (-945.260) * (-943.240) (-945.544) (-944.771) [-941.612] -- 0:00:20
664000 -- (-944.260) (-943.369) [-944.132] (-944.767) * (-941.810) (-946.077) [-944.365] (-941.558) -- 0:00:20
664500 -- (-942.860) (-943.332) (-941.863) [-942.990] * (-943.862) (-943.252) (-942.367) [-941.989] -- 0:00:20
665000 -- [-942.007] (-944.964) (-942.925) (-944.407) * (-945.625) (-945.287) (-943.600) [-944.674] -- 0:00:20
Average standard deviation of split frequencies: 0.007120
665500 -- (-942.818) (-941.959) (-942.796) [-941.891] * [-943.760] (-942.677) (-944.737) (-944.724) -- 0:00:20
666000 -- (-944.248) [-941.626] (-943.807) (-941.856) * (-943.414) (-942.707) (-950.286) [-943.575] -- 0:00:20
666500 -- [-942.617] (-943.902) (-942.269) (-941.505) * [-942.270] (-941.374) (-948.488) (-942.669) -- 0:00:20
667000 -- (-941.243) [-942.698] (-946.637) (-944.137) * [-942.214] (-942.396) (-947.244) (-943.845) -- 0:00:20
667500 -- [-942.082] (-941.777) (-942.719) (-943.295) * (-941.781) (-944.787) [-942.711] (-947.811) -- 0:00:20
668000 -- (-944.387) (-942.244) [-942.596] (-946.525) * (-942.379) (-945.313) [-942.476] (-943.729) -- 0:00:20
668500 -- (-944.536) (-946.179) [-945.628] (-942.355) * (-952.860) (-949.869) [-942.660] (-942.967) -- 0:00:20
669000 -- (-946.624) [-943.503] (-946.555) (-941.807) * (-945.376) (-943.497) (-944.672) [-944.110] -- 0:00:20
669500 -- (-946.831) (-943.071) (-944.886) [-944.498] * [-942.990] (-943.272) (-942.767) (-944.309) -- 0:00:20
670000 -- [-942.915] (-942.872) (-945.988) (-944.837) * (-945.384) (-943.205) (-942.959) [-943.269] -- 0:00:20
Average standard deviation of split frequencies: 0.006897
670500 -- (-944.274) (-944.941) [-946.851] (-945.510) * (-942.239) (-942.633) (-942.931) [-944.747] -- 0:00:20
671000 -- [-944.089] (-944.974) (-946.575) (-943.600) * (-942.435) [-944.981] (-944.014) (-945.770) -- 0:00:20
671500 -- (-943.948) [-944.578] (-942.122) (-944.477) * (-943.018) (-942.956) (-942.303) [-946.258] -- 0:00:20
672000 -- [-942.435] (-944.034) (-943.577) (-946.305) * (-944.464) [-943.183] (-941.690) (-942.694) -- 0:00:20
672500 -- (-945.851) [-943.347] (-941.865) (-946.357) * [-942.390] (-941.616) (-945.167) (-941.740) -- 0:00:19
673000 -- (-944.334) [-942.856] (-943.548) (-944.320) * (-942.734) (-941.330) (-943.876) [-942.365] -- 0:00:19
673500 -- (-943.120) (-942.553) (-945.604) [-943.350] * (-941.977) [-941.065] (-943.677) (-943.766) -- 0:00:19
674000 -- [-943.690] (-947.278) (-941.163) (-942.883) * (-946.567) [-942.193] (-942.396) (-943.769) -- 0:00:19
674500 -- (-944.633) (-946.248) [-941.683] (-944.746) * (-942.194) (-942.578) (-944.014) [-943.958] -- 0:00:19
675000 -- (-941.293) (-951.061) [-942.125] (-945.186) * [-943.726] (-942.003) (-950.091) (-943.769) -- 0:00:19
Average standard deviation of split frequencies: 0.006320
675500 -- [-941.357] (-946.187) (-941.895) (-943.233) * (-942.371) [-943.404] (-947.310) (-950.581) -- 0:00:19
676000 -- (-943.638) (-942.202) (-941.446) [-942.996] * (-945.871) (-943.144) (-944.940) [-943.464] -- 0:00:19
676500 -- (-945.816) (-946.740) [-943.375] (-943.602) * (-945.136) (-944.311) [-944.331] (-945.147) -- 0:00:19
677000 -- (-944.135) (-943.852) [-941.575] (-942.160) * (-941.598) (-948.998) (-944.540) [-944.398] -- 0:00:19
677500 -- (-942.479) (-942.973) [-941.706] (-943.924) * (-942.960) (-944.190) [-947.557] (-943.375) -- 0:00:19
678000 -- [-944.459] (-943.649) (-944.487) (-943.156) * (-945.725) [-942.549] (-941.909) (-942.152) -- 0:00:19
678500 -- (-942.324) [-944.105] (-942.362) (-944.885) * [-943.993] (-942.435) (-946.776) (-943.157) -- 0:00:19
679000 -- [-943.743] (-941.482) (-944.595) (-941.780) * (-942.493) (-944.090) [-941.391] (-943.659) -- 0:00:19
679500 -- (-941.810) [-941.612] (-942.876) (-942.437) * (-945.737) [-942.979] (-941.284) (-942.109) -- 0:00:19
680000 -- (-942.458) (-943.495) [-944.417] (-942.926) * (-944.475) (-943.449) [-942.657] (-945.783) -- 0:00:19
Average standard deviation of split frequencies: 0.006449
680500 -- (-951.608) (-944.848) [-942.843] (-945.454) * (-944.251) (-942.419) [-943.785] (-942.533) -- 0:00:19
681000 -- (-944.721) [-943.753] (-942.417) (-942.421) * (-941.815) (-942.139) [-945.252] (-944.120) -- 0:00:19
681500 -- (-944.565) (-945.673) [-948.873] (-944.888) * (-942.000) (-941.788) (-945.337) [-944.048] -- 0:00:19
682000 -- (-945.854) (-943.352) (-944.144) [-944.508] * [-942.744] (-941.588) (-946.427) (-944.966) -- 0:00:19
682500 -- (-942.155) [-943.422] (-943.212) (-944.461) * [-943.701] (-942.621) (-941.731) (-944.775) -- 0:00:19
683000 -- (-943.627) (-943.035) (-944.804) [-942.404] * (-945.470) (-945.187) [-941.260] (-942.954) -- 0:00:19
683500 -- (-945.332) [-944.453] (-945.233) (-942.317) * (-943.989) (-945.798) [-941.328] (-942.970) -- 0:00:19
684000 -- (-941.945) [-942.544] (-945.041) (-943.119) * (-945.692) (-944.074) (-942.379) [-943.277] -- 0:00:19
684500 -- (-941.897) (-942.132) [-942.011] (-946.639) * (-944.701) (-943.762) [-942.140] (-943.040) -- 0:00:19
685000 -- (-941.459) [-944.003] (-941.879) (-943.263) * (-944.605) (-943.157) [-943.097] (-943.797) -- 0:00:19
Average standard deviation of split frequencies: 0.006571
685500 -- (-943.063) (-943.986) (-946.897) [-941.749] * [-942.879] (-944.204) (-944.630) (-944.091) -- 0:00:19
686000 -- (-943.676) (-943.144) (-945.965) [-943.367] * [-940.945] (-942.713) (-942.765) (-942.417) -- 0:00:19
686500 -- [-941.195] (-946.387) (-946.573) (-942.486) * (-942.020) [-942.821] (-941.986) (-946.572) -- 0:00:19
687000 -- [-942.675] (-943.435) (-944.999) (-941.881) * [-942.364] (-943.349) (-946.343) (-945.794) -- 0:00:19
687500 -- (-945.248) (-944.727) [-941.593] (-942.534) * (-941.409) (-946.569) (-943.420) [-944.586] -- 0:00:19
688000 -- (-943.216) (-941.955) [-943.190] (-947.233) * (-943.957) [-943.302] (-944.344) (-944.315) -- 0:00:19
688500 -- [-943.231] (-944.267) (-943.276) (-944.913) * [-941.985] (-943.687) (-942.475) (-942.964) -- 0:00:19
689000 -- [-943.197] (-944.660) (-942.853) (-942.782) * (-950.097) [-944.005] (-946.140) (-941.842) -- 0:00:18
689500 -- (-942.698) (-942.496) (-943.097) [-945.043] * (-951.160) [-943.371] (-945.289) (-941.633) -- 0:00:18
690000 -- [-942.764] (-943.046) (-942.777) (-944.404) * (-942.056) (-947.279) [-946.007] (-942.632) -- 0:00:18
Average standard deviation of split frequencies: 0.006527
690500 -- (-943.841) (-942.546) (-942.390) [-942.557] * [-942.970] (-947.134) (-946.431) (-941.618) -- 0:00:18
691000 -- (-944.729) (-952.075) (-944.234) [-944.815] * [-943.156] (-946.266) (-943.624) (-945.057) -- 0:00:18
691500 -- (-946.658) (-943.310) [-942.297] (-946.411) * [-944.383] (-944.873) (-941.701) (-942.112) -- 0:00:18
692000 -- (-943.012) (-943.097) (-943.113) [-942.525] * (-943.808) (-945.514) [-942.458] (-942.957) -- 0:00:18
692500 -- [-944.330] (-945.601) (-946.226) (-942.268) * (-943.200) (-945.935) (-942.276) [-943.180] -- 0:00:18
693000 -- (-942.062) [-943.034] (-943.187) (-947.486) * (-948.096) (-945.428) (-943.941) [-942.886] -- 0:00:18
693500 -- [-945.412] (-946.837) (-943.635) (-944.596) * [-944.871] (-942.819) (-943.577) (-942.730) -- 0:00:18
694000 -- (-943.738) (-942.516) [-944.154] (-944.802) * [-944.191] (-942.267) (-942.449) (-943.453) -- 0:00:18
694500 -- (-943.623) [-943.763] (-942.243) (-945.576) * (-942.251) (-944.077) (-943.573) [-943.478] -- 0:00:18
695000 -- (-943.662) (-943.304) (-942.615) [-941.386] * (-942.633) (-943.057) [-941.733] (-943.131) -- 0:00:18
Average standard deviation of split frequencies: 0.006900
695500 -- (-943.484) (-942.510) (-946.033) [-942.560] * (-943.014) (-943.478) [-941.842] (-944.385) -- 0:00:18
696000 -- (-942.211) [-942.115] (-942.799) (-942.107) * (-944.649) (-941.562) (-943.631) [-942.055] -- 0:00:18
696500 -- (-944.709) (-942.521) [-943.840] (-945.042) * (-942.540) [-942.112] (-942.461) (-944.932) -- 0:00:18
697000 -- (-943.818) (-942.722) (-943.014) [-946.625] * (-943.281) [-945.801] (-942.779) (-941.727) -- 0:00:18
697500 -- (-946.353) (-948.470) [-941.388] (-944.021) * [-942.652] (-944.240) (-942.105) (-942.081) -- 0:00:18
698000 -- (-948.614) (-944.089) [-941.316] (-941.575) * (-943.164) [-943.555] (-944.338) (-942.915) -- 0:00:18
698500 -- (-946.037) (-942.854) (-941.325) [-942.664] * (-944.414) (-942.240) (-944.731) [-942.379] -- 0:00:18
699000 -- (-943.676) (-943.209) (-941.123) [-946.232] * (-946.494) (-943.104) [-941.639] (-944.251) -- 0:00:18
699500 -- (-944.385) (-946.121) (-943.800) [-944.570] * [-943.023] (-943.504) (-945.574) (-942.591) -- 0:00:18
700000 -- (-942.266) [-944.316] (-943.305) (-944.737) * (-943.022) (-942.079) (-943.465) [-943.271] -- 0:00:18
Average standard deviation of split frequencies: 0.006896
700500 -- (-944.077) [-944.522] (-944.839) (-943.597) * (-948.689) (-942.985) (-950.766) [-941.901] -- 0:00:18
701000 -- (-947.008) (-942.980) (-945.199) [-943.684] * [-945.982] (-943.928) (-943.599) (-943.946) -- 0:00:18
701500 -- (-943.288) (-948.374) (-943.305) [-941.392] * [-945.247] (-944.974) (-944.020) (-944.437) -- 0:00:18
702000 -- [-941.871] (-947.441) (-942.816) (-941.572) * [-942.699] (-941.854) (-942.821) (-942.632) -- 0:00:18
702500 -- (-945.903) (-942.003) (-942.720) [-941.578] * [-946.375] (-942.757) (-944.166) (-944.453) -- 0:00:18
703000 -- (-942.835) (-944.740) (-942.916) [-942.487] * (-944.691) [-942.012] (-944.829) (-949.269) -- 0:00:18
703500 -- (-948.503) (-941.991) [-945.867] (-944.296) * (-942.229) (-941.975) [-946.568] (-945.734) -- 0:00:18
704000 -- (-945.716) [-944.192] (-943.935) (-944.148) * (-943.922) (-942.373) (-942.628) [-943.212] -- 0:00:18
704500 -- (-948.126) (-947.336) [-943.837] (-941.397) * (-943.848) (-947.005) (-942.994) [-943.336] -- 0:00:18
705000 -- (-945.769) (-942.339) (-947.776) [-943.662] * (-942.115) [-941.837] (-943.513) (-942.468) -- 0:00:17
Average standard deviation of split frequencies: 0.006677
705500 -- (-943.433) [-942.444] (-941.996) (-947.071) * (-943.902) (-942.399) [-942.327] (-941.706) -- 0:00:17
706000 -- [-943.811] (-941.809) (-942.422) (-944.038) * (-944.548) (-945.240) (-943.751) [-942.021] -- 0:00:17
706500 -- (-943.369) (-942.673) (-946.634) [-943.881] * (-943.565) [-942.511] (-941.810) (-942.404) -- 0:00:17
707000 -- (-944.233) [-942.018] (-944.594) (-945.462) * (-943.695) [-943.431] (-944.027) (-943.702) -- 0:00:17
707500 -- [-942.528] (-943.668) (-943.133) (-942.784) * [-942.820] (-941.978) (-945.033) (-942.804) -- 0:00:17
708000 -- (-941.539) [-941.521] (-944.461) (-942.661) * (-943.197) (-942.618) (-943.724) [-941.812] -- 0:00:17
708500 -- (-943.566) (-944.607) (-942.216) [-942.254] * [-942.048] (-942.900) (-945.978) (-943.590) -- 0:00:17
709000 -- (-944.370) [-943.485] (-942.025) (-947.656) * (-944.075) (-943.189) [-944.700] (-942.822) -- 0:00:17
709500 -- [-944.433] (-944.096) (-943.625) (-944.251) * (-944.654) (-942.890) (-944.598) [-942.573] -- 0:00:17
710000 -- (-941.666) (-942.350) (-942.288) [-945.173] * (-943.620) [-945.169] (-943.377) (-944.149) -- 0:00:17
Average standard deviation of split frequencies: 0.006467
710500 -- (-942.161) (-941.894) (-941.241) [-947.626] * (-942.634) (-943.709) [-942.549] (-943.333) -- 0:00:17
711000 -- [-942.957] (-942.473) (-944.830) (-947.371) * (-943.062) [-942.216] (-941.500) (-943.191) -- 0:00:17
711500 -- (-944.594) (-944.056) [-943.604] (-944.847) * (-942.616) (-942.090) (-942.500) [-943.111] -- 0:00:17
712000 -- (-945.123) (-941.435) [-943.468] (-943.901) * (-944.724) (-945.357) [-941.226] (-942.274) -- 0:00:17
712500 -- (-943.454) (-942.906) [-944.043] (-942.842) * (-945.176) [-944.089] (-941.659) (-943.096) -- 0:00:17
713000 -- (-942.766) (-946.848) (-943.960) [-944.438] * (-948.602) (-946.995) (-945.913) [-944.509] -- 0:00:17
713500 -- [-942.322] (-942.633) (-943.276) (-950.052) * (-947.831) (-943.309) (-944.134) [-942.492] -- 0:00:17
714000 -- (-943.761) (-944.390) [-942.057] (-944.667) * (-948.304) [-943.479] (-942.941) (-944.241) -- 0:00:17
714500 -- [-943.714] (-943.282) (-941.698) (-941.961) * (-943.938) (-943.988) (-943.087) [-944.231] -- 0:00:17
715000 -- [-945.650] (-944.563) (-943.162) (-942.594) * (-943.452) (-945.209) (-943.696) [-943.067] -- 0:00:17
Average standard deviation of split frequencies: 0.006625
715500 -- (-943.235) [-943.162] (-945.341) (-942.152) * [-944.522] (-944.678) (-943.400) (-942.801) -- 0:00:17
716000 -- [-946.791] (-942.187) (-942.525) (-942.786) * (-943.651) (-943.681) [-941.716] (-943.423) -- 0:00:17
716500 -- (-943.412) [-944.154] (-944.148) (-943.668) * (-942.087) [-943.675] (-943.254) (-942.703) -- 0:00:17
717000 -- (-943.015) (-942.207) [-942.889] (-941.803) * (-942.958) [-944.643] (-942.681) (-941.771) -- 0:00:17
717500 -- (-943.948) (-942.486) [-941.747] (-942.251) * (-943.302) (-942.110) (-943.768) [-941.485] -- 0:00:17
718000 -- (-945.379) [-942.095] (-942.338) (-942.848) * (-941.952) [-943.980] (-943.136) (-946.680) -- 0:00:17
718500 -- (-945.531) (-943.546) [-941.581] (-945.248) * (-944.367) (-942.716) (-944.776) [-944.561] -- 0:00:17
719000 -- (-947.283) (-942.795) (-941.599) [-941.962] * (-942.805) (-944.690) [-944.075] (-943.389) -- 0:00:17
719500 -- (-944.692) [-942.933] (-943.715) (-942.446) * [-944.868] (-946.540) (-943.121) (-943.690) -- 0:00:17
720000 -- (-942.555) [-943.153] (-947.301) (-942.619) * (-944.694) [-941.332] (-942.283) (-942.760) -- 0:00:17
Average standard deviation of split frequencies: 0.006337
720500 -- (-942.927) (-944.857) [-941.968] (-941.635) * (-943.599) [-941.089] (-951.243) (-945.984) -- 0:00:17
721000 -- [-942.574] (-943.836) (-941.405) (-942.876) * (-945.882) [-943.762] (-949.263) (-941.383) -- 0:00:17
721500 -- (-949.059) (-946.137) (-942.014) [-943.236] * (-943.195) (-943.738) (-948.867) [-942.503] -- 0:00:16
722000 -- (-942.060) (-943.137) [-941.472] (-943.044) * [-943.675] (-945.213) (-943.310) (-942.964) -- 0:00:16
722500 -- (-943.799) (-941.797) [-941.345] (-942.653) * [-942.797] (-943.235) (-944.369) (-945.238) -- 0:00:16
723000 -- [-942.266] (-943.055) (-942.681) (-947.350) * [-942.211] (-944.221) (-944.391) (-943.261) -- 0:00:16
723500 -- [-946.410] (-943.052) (-942.564) (-945.246) * (-944.924) [-945.482] (-943.292) (-944.243) -- 0:00:16
724000 -- (-943.979) (-943.430) [-942.733] (-948.665) * (-943.088) (-946.072) (-942.920) [-945.961] -- 0:00:16
724500 -- (-945.062) [-946.896] (-942.786) (-945.122) * (-944.143) [-942.788] (-941.352) (-945.334) -- 0:00:16
725000 -- (-943.937) [-943.959] (-941.810) (-944.116) * (-942.709) [-942.729] (-943.460) (-942.906) -- 0:00:16
Average standard deviation of split frequencies: 0.006188
725500 -- (-944.044) (-945.867) (-942.320) [-941.819] * [-942.977] (-943.513) (-944.513) (-943.900) -- 0:00:16
726000 -- (-944.766) [-942.566] (-942.407) (-942.237) * [-942.912] (-942.811) (-943.891) (-942.822) -- 0:00:16
726500 -- (-942.816) (-948.122) [-943.498] (-944.518) * [-943.211] (-943.798) (-943.417) (-941.728) -- 0:00:16
727000 -- (-942.949) (-944.275) (-945.431) [-943.495] * [-943.954] (-946.371) (-943.778) (-941.818) -- 0:00:16
727500 -- (-942.015) (-947.396) [-943.863] (-941.211) * [-942.455] (-945.865) (-943.803) (-942.118) -- 0:00:16
728000 -- (-942.493) (-946.576) (-941.993) [-942.224] * (-947.593) (-943.617) [-944.137] (-941.420) -- 0:00:16
728500 -- [-945.888] (-945.166) (-942.598) (-945.474) * (-944.422) [-942.731] (-945.318) (-942.822) -- 0:00:16
729000 -- (-943.568) (-946.006) (-942.038) [-946.108] * (-942.753) (-942.648) [-942.612] (-942.896) -- 0:00:16
729500 -- (-942.837) [-942.246] (-941.316) (-947.382) * (-943.580) (-943.974) (-946.431) [-941.839] -- 0:00:16
730000 -- [-942.424] (-940.995) (-943.724) (-943.370) * (-941.975) [-943.407] (-941.143) (-943.037) -- 0:00:16
Average standard deviation of split frequencies: 0.006186
730500 -- [-942.853] (-940.985) (-942.363) (-945.505) * (-947.921) (-941.993) (-941.654) [-943.048] -- 0:00:16
731000 -- [-943.409] (-940.985) (-942.928) (-942.127) * [-947.434] (-948.051) (-942.080) (-942.729) -- 0:00:16
731500 -- [-944.547] (-946.540) (-942.624) (-942.600) * (-949.167) (-943.903) (-946.790) [-942.794] -- 0:00:16
732000 -- (-942.750) [-943.634] (-942.699) (-945.920) * (-945.920) (-941.481) (-944.337) [-945.238] -- 0:00:16
732500 -- (-941.700) (-942.234) (-942.132) [-943.238] * (-950.558) [-942.574] (-947.417) (-944.727) -- 0:00:16
733000 -- (-944.099) [-941.959] (-945.005) (-941.595) * [-941.991] (-944.224) (-943.105) (-941.616) -- 0:00:16
733500 -- [-943.014] (-943.968) (-943.758) (-941.757) * (-942.221) (-945.418) (-942.815) [-941.500] -- 0:00:16
734000 -- (-943.447) [-943.825] (-942.570) (-946.662) * (-942.492) (-942.597) (-944.332) [-941.170] -- 0:00:16
734500 -- (-946.649) [-945.789] (-943.979) (-943.415) * [-942.869] (-945.217) (-943.876) (-942.459) -- 0:00:16
735000 -- [-943.866] (-943.874) (-944.987) (-944.911) * (-943.071) (-943.442) [-943.715] (-942.507) -- 0:00:16
Average standard deviation of split frequencies: 0.005953
735500 -- (-944.700) (-946.713) (-944.698) [-945.769] * (-946.588) [-942.740] (-945.333) (-942.369) -- 0:00:16
736000 -- (-942.220) [-945.951] (-942.396) (-943.201) * (-947.140) [-942.860] (-942.857) (-945.339) -- 0:00:16
736500 -- (-942.505) (-947.256) (-944.404) [-943.487] * (-941.748) [-943.748] (-944.453) (-944.059) -- 0:00:16
737000 -- (-942.520) (-944.067) (-943.591) [-943.905] * (-941.768) (-944.493) [-943.156] (-944.060) -- 0:00:16
737500 -- (-942.523) (-942.411) [-945.130] (-947.260) * [-943.779] (-944.901) (-941.903) (-945.560) -- 0:00:16
738000 -- [-945.415] (-944.025) (-942.867) (-941.656) * [-943.734] (-947.493) (-943.254) (-942.080) -- 0:00:15
738500 -- (-943.417) [-945.138] (-943.886) (-941.534) * (-944.557) (-943.610) (-941.704) [-947.068] -- 0:00:15
739000 -- (-944.101) [-945.748] (-943.983) (-945.833) * (-944.455) (-942.088) (-944.488) [-945.050] -- 0:00:15
739500 -- (-942.523) (-952.123) (-942.758) [-945.645] * (-941.286) (-943.223) [-944.677] (-942.884) -- 0:00:15
740000 -- [-947.081] (-945.410) (-943.789) (-941.565) * [-942.050] (-942.645) (-942.353) (-946.441) -- 0:00:15
Average standard deviation of split frequencies: 0.006524
740500 -- (-944.376) (-943.356) (-946.799) [-941.730] * (-941.787) (-942.465) (-943.604) [-945.497] -- 0:00:15
741000 -- (-944.749) (-943.411) [-943.759] (-948.766) * (-944.607) [-942.045] (-942.869) (-943.315) -- 0:00:15
741500 -- (-944.777) (-945.119) [-944.666] (-943.464) * (-941.635) [-942.647] (-944.336) (-942.041) -- 0:00:15
742000 -- (-945.683) (-945.304) [-943.701] (-942.717) * (-945.656) (-941.208) [-945.421] (-942.440) -- 0:00:15
742500 -- [-944.216] (-944.153) (-943.728) (-947.996) * (-945.394) (-946.902) [-941.837] (-941.842) -- 0:00:15
743000 -- (-942.530) (-945.717) (-947.991) [-945.017] * (-944.674) (-946.990) [-941.683] (-942.845) -- 0:00:15
743500 -- (-943.542) [-943.203] (-944.336) (-944.894) * (-943.410) (-943.952) (-941.679) [-942.360] -- 0:00:15
744000 -- (-946.928) (-945.912) (-942.301) [-943.770] * (-943.160) [-942.272] (-946.334) (-942.614) -- 0:00:15
744500 -- (-945.164) [-942.057] (-943.959) (-945.610) * (-944.548) (-944.385) [-944.803] (-943.065) -- 0:00:15
745000 -- [-943.247] (-942.710) (-943.009) (-948.394) * [-942.704] (-948.300) (-944.182) (-943.370) -- 0:00:15
Average standard deviation of split frequencies: 0.006282
745500 -- [-941.927] (-944.191) (-942.900) (-943.104) * [-944.292] (-944.235) (-941.771) (-942.607) -- 0:00:15
746000 -- [-944.269] (-943.619) (-944.035) (-943.164) * [-942.916] (-944.171) (-941.470) (-945.979) -- 0:00:15
746500 -- [-945.142] (-942.709) (-944.382) (-942.942) * (-942.897) (-943.249) (-943.330) [-941.590] -- 0:00:15
747000 -- (-943.497) (-943.500) [-943.006] (-941.900) * (-943.170) (-943.883) [-945.078] (-941.751) -- 0:00:15
747500 -- (-943.603) (-942.865) [-943.038] (-942.057) * (-941.895) (-945.542) (-945.141) [-942.836] -- 0:00:15
748000 -- (-942.690) (-943.251) (-944.410) [-946.282] * (-945.964) [-942.679] (-942.343) (-941.548) -- 0:00:15
748500 -- [-942.766] (-949.286) (-942.708) (-944.588) * (-945.946) (-942.236) (-945.558) [-944.770] -- 0:00:15
749000 -- (-943.310) (-942.321) (-942.785) [-941.561] * (-945.967) [-942.235] (-942.091) (-942.950) -- 0:00:15
749500 -- (-942.889) (-941.950) (-943.714) [-942.179] * (-944.398) (-941.937) [-943.356] (-943.928) -- 0:00:15
750000 -- (-943.762) [-943.321] (-945.619) (-943.649) * (-945.857) (-945.067) (-943.407) [-942.304] -- 0:00:15
Average standard deviation of split frequencies: 0.006095
750500 -- (-941.823) (-941.653) (-942.918) [-942.034] * (-943.473) (-942.201) (-943.160) [-946.568] -- 0:00:15
751000 -- [-941.231] (-942.041) (-942.284) (-944.484) * (-942.889) (-942.202) [-942.673] (-941.830) -- 0:00:15
751500 -- [-944.355] (-943.011) (-941.531) (-942.812) * (-943.884) [-941.263] (-945.170) (-941.866) -- 0:00:15
752000 -- (-943.040) (-942.257) [-943.140] (-945.013) * (-943.110) (-943.162) [-942.566] (-945.634) -- 0:00:15
752500 -- [-944.926] (-943.083) (-942.335) (-943.698) * (-946.190) (-942.712) (-948.693) [-944.477] -- 0:00:15
753000 -- [-943.177] (-942.730) (-945.205) (-943.968) * (-941.401) (-942.723) [-943.916] (-944.967) -- 0:00:15
753500 -- (-943.537) [-941.834] (-945.429) (-943.766) * [-942.191] (-944.574) (-943.028) (-946.454) -- 0:00:15
754000 -- (-944.193) [-943.513] (-950.230) (-942.618) * [-943.184] (-942.256) (-945.154) (-945.832) -- 0:00:15
754500 -- (-942.792) (-948.016) [-947.779] (-945.795) * (-947.649) (-941.876) (-943.374) [-944.235] -- 0:00:14
755000 -- (-945.056) (-946.931) [-943.525] (-943.095) * (-945.145) (-943.259) (-945.219) [-944.388] -- 0:00:14
Average standard deviation of split frequencies: 0.005905
755500 -- (-945.096) [-942.672] (-944.580) (-943.464) * (-944.145) [-947.083] (-944.334) (-944.618) -- 0:00:14
756000 -- (-944.163) [-948.722] (-947.382) (-943.764) * (-943.596) (-941.756) (-942.478) [-941.665] -- 0:00:14
756500 -- (-941.980) [-941.994] (-946.302) (-942.014) * (-945.406) (-945.107) (-945.543) [-942.104] -- 0:00:14
757000 -- (-942.212) [-941.956] (-948.787) (-941.430) * (-945.340) [-947.105] (-943.990) (-944.960) -- 0:00:14
757500 -- (-942.736) (-942.749) (-952.060) [-941.096] * (-943.714) (-946.688) [-943.391] (-943.042) -- 0:00:14
758000 -- (-942.969) [-941.794] (-944.979) (-944.207) * (-943.906) (-946.384) (-943.764) [-942.351] -- 0:00:14
758500 -- [-945.278] (-944.226) (-951.097) (-943.907) * [-942.690] (-942.801) (-943.833) (-942.999) -- 0:00:14
759000 -- (-944.145) [-946.621] (-945.489) (-944.297) * (-942.898) (-943.419) [-942.699] (-946.951) -- 0:00:14
759500 -- (-944.896) (-942.131) [-947.377] (-946.527) * [-941.917] (-943.548) (-942.567) (-946.447) -- 0:00:14
760000 -- (-944.279) (-943.072) [-944.337] (-943.043) * (-942.913) (-941.294) [-943.326] (-943.314) -- 0:00:14
Average standard deviation of split frequencies: 0.005412
760500 -- (-944.553) [-943.125] (-943.851) (-943.547) * (-945.383) (-943.782) (-943.111) [-943.192] -- 0:00:14
761000 -- (-943.196) (-945.993) (-944.433) [-943.269] * (-944.225) (-942.790) [-943.866] (-943.382) -- 0:00:14
761500 -- (-944.908) (-948.859) [-946.471] (-947.919) * (-941.559) (-942.884) (-950.007) [-944.460] -- 0:00:14
762000 -- [-947.168] (-944.740) (-947.282) (-942.354) * (-942.223) (-944.026) (-941.504) [-941.951] -- 0:00:14
762500 -- (-944.408) (-944.770) [-942.650] (-942.646) * (-941.923) (-945.979) [-945.300] (-941.763) -- 0:00:14
763000 -- [-942.228] (-942.010) (-943.962) (-942.369) * (-942.512) (-944.335) (-943.726) [-943.329] -- 0:00:14
763500 -- [-943.583] (-942.908) (-949.693) (-943.523) * (-945.058) [-942.734] (-941.776) (-942.417) -- 0:00:14
764000 -- (-942.830) (-944.895) [-945.816] (-942.899) * (-943.665) (-943.977) [-944.011] (-943.285) -- 0:00:14
764500 -- (-941.644) [-945.703] (-942.938) (-942.307) * [-943.084] (-943.749) (-944.818) (-946.996) -- 0:00:14
765000 -- (-941.695) (-946.552) [-943.032] (-942.478) * (-947.195) [-941.492] (-944.345) (-943.138) -- 0:00:14
Average standard deviation of split frequencies: 0.005293
765500 -- (-943.507) (-946.473) [-943.424] (-943.494) * (-944.452) (-943.177) (-945.627) [-943.128] -- 0:00:14
766000 -- (-942.456) (-943.204) (-942.301) [-944.863] * (-943.723) (-942.694) (-947.476) [-942.755] -- 0:00:14
766500 -- (-945.874) (-942.527) (-941.768) [-945.511] * (-944.028) [-942.843] (-943.920) (-942.381) -- 0:00:14
767000 -- (-944.276) (-949.253) (-942.675) [-944.404] * (-945.884) [-942.241] (-947.102) (-942.483) -- 0:00:14
767500 -- [-943.610] (-943.340) (-943.540) (-942.970) * (-946.696) (-941.290) (-943.679) [-942.339] -- 0:00:14
768000 -- (-942.518) (-943.862) [-941.906] (-942.692) * (-947.155) (-946.578) [-942.754] (-944.358) -- 0:00:14
768500 -- [-942.772] (-947.185) (-942.018) (-943.045) * (-943.370) (-944.068) [-946.902] (-943.713) -- 0:00:14
769000 -- [-942.303] (-945.267) (-944.434) (-943.674) * (-943.956) (-943.328) [-944.362] (-944.105) -- 0:00:14
769500 -- (-944.127) [-942.143] (-942.091) (-947.576) * [-945.449] (-942.562) (-942.742) (-943.197) -- 0:00:14
770000 -- (-941.891) [-942.930] (-943.236) (-943.920) * (-944.423) (-942.793) (-944.506) [-943.436] -- 0:00:14
Average standard deviation of split frequencies: 0.005199
770500 -- (-941.891) [-944.164] (-946.626) (-943.575) * [-941.794] (-943.846) (-941.882) (-943.777) -- 0:00:13
771000 -- (-942.985) (-944.339) [-945.535] (-942.132) * [-944.711] (-943.719) (-943.069) (-943.125) -- 0:00:13
771500 -- (-943.972) [-943.083] (-944.878) (-943.398) * (-942.910) (-942.243) (-946.697) [-944.348] -- 0:00:13
772000 -- (-942.338) [-941.970] (-943.729) (-942.662) * [-947.207] (-944.195) (-945.778) (-945.331) -- 0:00:13
772500 -- (-941.016) (-948.196) (-944.486) [-941.761] * (-941.330) (-947.880) [-943.342] (-942.374) -- 0:00:13
773000 -- [-942.855] (-941.920) (-942.150) (-942.798) * [-943.986] (-948.042) (-947.224) (-941.862) -- 0:00:13
773500 -- (-943.045) (-946.785) [-943.115] (-943.842) * (-942.857) (-943.578) (-943.467) [-942.682] -- 0:00:13
774000 -- (-944.841) (-946.836) [-943.187] (-942.392) * (-942.699) (-942.514) [-944.017] (-942.125) -- 0:00:13
774500 -- [-947.330] (-944.561) (-944.525) (-943.056) * (-943.086) (-944.364) [-947.634] (-944.159) -- 0:00:13
775000 -- [-946.918] (-945.047) (-943.789) (-944.824) * (-943.999) [-943.951] (-943.898) (-943.263) -- 0:00:13
Average standard deviation of split frequencies: 0.005022
775500 -- (-943.529) [-942.480] (-944.399) (-946.396) * (-943.682) (-944.594) [-941.730] (-944.397) -- 0:00:13
776000 -- [-942.039] (-944.056) (-947.425) (-944.067) * (-942.590) (-942.428) [-941.649] (-944.960) -- 0:00:13
776500 -- [-941.523] (-944.777) (-948.204) (-949.469) * (-943.646) (-946.227) [-941.657] (-945.001) -- 0:00:13
777000 -- (-945.613) [-942.502] (-942.469) (-949.145) * (-942.719) [-946.958] (-945.598) (-944.449) -- 0:00:13
777500 -- (-945.323) (-942.988) (-946.966) [-945.993] * (-947.716) (-943.718) (-941.333) [-942.918] -- 0:00:13
778000 -- (-942.817) (-942.845) (-942.815) [-943.774] * (-944.418) (-943.331) (-941.590) [-941.713] -- 0:00:13
778500 -- [-942.521] (-944.560) (-942.141) (-944.742) * (-944.841) (-949.290) (-943.456) [-944.752] -- 0:00:13
779000 -- (-942.222) (-944.242) [-942.403] (-947.893) * (-945.115) [-943.607] (-941.526) (-945.255) -- 0:00:13
779500 -- [-943.388] (-944.691) (-946.289) (-945.094) * (-946.274) (-944.880) (-943.970) [-945.539] -- 0:00:13
780000 -- (-942.430) [-944.282] (-947.155) (-943.163) * (-942.460) [-942.894] (-946.785) (-942.993) -- 0:00:13
Average standard deviation of split frequencies: 0.004992
780500 -- (-941.816) [-942.847] (-944.023) (-943.180) * [-943.032] (-942.939) (-942.390) (-942.835) -- 0:00:13
781000 -- (-941.792) (-942.222) [-942.186] (-942.990) * (-945.073) (-941.621) [-942.346] (-943.775) -- 0:00:13
781500 -- (-944.402) (-942.297) [-943.697] (-946.935) * (-943.283) [-941.511] (-944.784) (-942.276) -- 0:00:13
782000 -- (-942.248) (-942.062) [-941.973] (-947.895) * (-942.045) (-942.254) [-943.534] (-942.714) -- 0:00:13
782500 -- (-943.576) (-944.555) (-943.750) [-944.249] * (-942.073) (-943.424) [-941.399] (-946.793) -- 0:00:13
783000 -- [-943.433] (-944.765) (-951.096) (-942.391) * (-942.558) (-943.063) (-943.025) [-941.885] -- 0:00:13
783500 -- (-944.672) (-944.740) [-948.183] (-945.195) * (-943.415) (-942.807) (-942.407) [-942.633] -- 0:00:13
784000 -- (-944.134) (-944.126) (-943.701) [-945.941] * (-945.206) (-945.716) (-941.908) [-941.785] -- 0:00:13
784500 -- (-945.558) [-942.931] (-942.155) (-941.564) * (-945.935) [-942.464] (-942.654) (-941.857) -- 0:00:13
785000 -- (-943.500) (-941.326) [-947.028] (-941.527) * (-944.622) (-949.341) (-946.807) [-941.447] -- 0:00:13
Average standard deviation of split frequencies: 0.004518
785500 -- (-946.398) (-949.369) (-942.455) [-942.191] * [-945.390] (-944.039) (-943.191) (-947.133) -- 0:00:13
786000 -- [-945.761] (-943.941) (-945.154) (-945.362) * (-942.423) [-944.177] (-944.905) (-944.446) -- 0:00:13
786500 -- (-943.182) (-948.784) (-947.949) [-943.195] * [-942.233] (-944.098) (-944.390) (-945.134) -- 0:00:13
787000 -- (-943.546) (-946.095) (-942.213) [-944.915] * (-942.533) [-945.662] (-943.654) (-943.241) -- 0:00:12
787500 -- (-942.002) (-942.931) (-942.020) [-943.018] * (-945.425) [-944.447] (-942.345) (-943.176) -- 0:00:12
788000 -- (-942.431) [-942.993] (-947.291) (-942.380) * (-943.949) [-942.961] (-941.881) (-943.182) -- 0:00:12
788500 -- (-945.878) (-943.985) (-946.466) [-944.191] * (-944.575) (-946.931) (-942.151) [-946.970] -- 0:00:12
789000 -- (-944.177) [-941.857] (-943.713) (-945.500) * (-943.625) (-943.674) [-944.798] (-942.909) -- 0:00:12
789500 -- (-943.908) [-942.393] (-943.626) (-946.909) * [-943.413] (-946.524) (-945.194) (-942.730) -- 0:00:12
790000 -- (-943.061) (-941.965) [-942.967] (-941.789) * (-942.257) [-942.474] (-946.612) (-942.613) -- 0:00:12
Average standard deviation of split frequencies: 0.004650
790500 -- (-943.483) [-942.776] (-944.751) (-944.189) * (-942.069) (-942.549) (-943.390) [-942.546] -- 0:00:12
791000 -- (-941.834) [-942.279] (-942.998) (-946.492) * [-943.136] (-944.135) (-944.697) (-944.043) -- 0:00:12
791500 -- (-943.804) [-945.409] (-942.093) (-942.425) * (-942.717) (-945.230) [-943.883] (-942.255) -- 0:00:12
792000 -- [-945.454] (-942.217) (-945.010) (-944.390) * (-946.010) (-944.605) [-943.015] (-942.011) -- 0:00:12
792500 -- [-943.162] (-945.295) (-943.604) (-942.462) * (-943.342) (-941.353) [-943.249] (-944.107) -- 0:00:12
793000 -- (-943.485) (-949.537) [-945.257] (-946.424) * (-942.035) (-946.359) [-942.871] (-944.203) -- 0:00:12
793500 -- (-944.198) [-946.041] (-943.679) (-944.620) * (-943.225) (-942.813) (-948.361) [-942.203] -- 0:00:12
794000 -- (-942.428) [-943.633] (-944.752) (-944.379) * (-943.961) [-942.435] (-942.159) (-942.203) -- 0:00:12
794500 -- (-941.736) (-945.933) [-942.824] (-944.757) * (-942.766) (-946.105) [-942.622] (-943.694) -- 0:00:12
795000 -- (-942.151) [-942.729] (-942.458) (-943.271) * [-944.037] (-942.150) (-943.442) (-944.492) -- 0:00:12
Average standard deviation of split frequencies: 0.004896
795500 -- [-945.502] (-943.656) (-945.458) (-943.202) * (-943.242) [-944.575] (-942.309) (-941.621) -- 0:00:12
796000 -- (-944.003) [-941.397] (-943.681) (-944.869) * (-943.583) (-944.468) [-942.562] (-941.183) -- 0:00:12
796500 -- [-943.638] (-942.345) (-947.834) (-944.756) * (-943.011) [-944.584] (-941.705) (-941.115) -- 0:00:12
797000 -- [-942.623] (-943.531) (-951.312) (-946.359) * (-942.470) (-945.541) [-941.873] (-941.859) -- 0:00:12
797500 -- [-943.087] (-942.293) (-944.535) (-948.662) * (-943.232) (-944.141) (-942.922) [-942.666] -- 0:00:12
798000 -- (-946.276) [-941.958] (-944.780) (-946.511) * (-941.259) (-941.319) (-941.509) [-944.068] -- 0:00:12
798500 -- [-942.035] (-941.848) (-942.417) (-946.121) * (-943.727) [-941.753] (-943.198) (-942.593) -- 0:00:12
799000 -- (-942.672) (-944.154) [-941.905] (-944.993) * [-941.774] (-941.392) (-943.203) (-944.656) -- 0:00:12
799500 -- (-943.251) [-946.197] (-942.213) (-941.272) * (-942.541) (-944.038) [-942.524] (-941.967) -- 0:00:12
800000 -- (-943.347) (-941.421) (-942.375) [-942.142] * [-943.845] (-946.828) (-943.632) (-942.430) -- 0:00:12
Average standard deviation of split frequencies: 0.004592
800500 -- [-942.666] (-941.934) (-942.883) (-942.538) * (-943.747) (-946.963) (-945.750) [-941.880] -- 0:00:12
801000 -- (-943.116) [-942.968] (-942.262) (-942.889) * [-943.070] (-947.476) (-945.964) (-942.485) -- 0:00:12
801500 -- (-941.887) [-944.684] (-941.287) (-943.394) * [-942.529] (-944.669) (-944.115) (-942.010) -- 0:00:12
802000 -- (-944.277) (-944.050) [-944.851] (-942.809) * (-943.557) (-941.575) (-946.097) [-942.421] -- 0:00:12
802500 -- (-944.637) (-943.983) [-941.900] (-942.132) * (-945.286) [-948.983] (-944.738) (-942.673) -- 0:00:12
803000 -- [-943.177] (-943.288) (-941.900) (-942.912) * (-944.075) (-944.624) [-943.771] (-942.763) -- 0:00:12
803500 -- [-944.460] (-943.444) (-942.659) (-942.715) * [-942.942] (-943.232) (-947.795) (-943.196) -- 0:00:11
804000 -- (-944.170) (-944.743) (-942.871) [-942.940] * (-943.206) (-945.796) [-943.144] (-944.017) -- 0:00:11
804500 -- (-941.062) [-945.598] (-943.117) (-944.391) * (-948.758) (-943.017) [-943.975] (-942.296) -- 0:00:11
805000 -- [-941.630] (-945.059) (-941.780) (-944.747) * (-945.110) [-943.288] (-941.514) (-944.559) -- 0:00:11
Average standard deviation of split frequencies: 0.004562
805500 -- (-941.852) (-945.902) (-941.527) [-943.208] * [-945.329] (-943.748) (-942.060) (-943.008) -- 0:00:11
806000 -- (-943.452) (-944.548) [-944.745] (-943.714) * (-944.459) (-944.734) [-942.939] (-943.050) -- 0:00:11
806500 -- (-946.626) (-941.834) (-943.409) [-942.459] * (-942.037) (-946.287) [-954.102] (-942.346) -- 0:00:11
807000 -- (-945.247) [-944.170] (-944.130) (-942.946) * [-942.171] (-942.140) (-944.877) (-942.281) -- 0:00:11
807500 -- (-944.193) (-944.590) (-943.237) [-943.419] * [-941.395] (-941.770) (-944.074) (-941.969) -- 0:00:11
808000 -- (-945.567) (-945.751) (-943.198) [-943.323] * (-942.513) [-941.124] (-943.790) (-943.740) -- 0:00:11
808500 -- (-942.920) (-943.747) (-943.642) [-950.559] * [-942.201] (-942.607) (-943.389) (-944.897) -- 0:00:11
809000 -- (-942.275) [-950.099] (-944.899) (-947.978) * (-943.304) [-941.895] (-943.577) (-942.688) -- 0:00:11
809500 -- (-947.867) [-945.962] (-949.912) (-947.222) * (-943.106) (-942.103) [-941.286] (-946.304) -- 0:00:11
810000 -- (-944.475) (-943.601) [-943.942] (-946.237) * [-944.463] (-943.897) (-943.021) (-947.712) -- 0:00:11
Average standard deviation of split frequencies: 0.004497
810500 -- (-945.234) (-948.407) [-944.353] (-944.966) * [-942.840] (-944.807) (-945.855) (-943.853) -- 0:00:11
811000 -- (-947.337) (-947.266) [-941.771] (-946.411) * (-942.773) (-944.185) (-944.643) [-942.256] -- 0:00:11
811500 -- (-942.564) (-947.049) [-943.858] (-944.825) * (-942.277) (-944.263) [-946.078] (-949.377) -- 0:00:11
812000 -- (-941.613) (-948.071) (-945.210) [-941.900] * [-946.674] (-944.735) (-942.816) (-942.570) -- 0:00:11
812500 -- [-943.849] (-943.666) (-948.105) (-943.773) * (-941.796) [-945.020] (-942.710) (-944.042) -- 0:00:11
813000 -- (-943.803) [-944.327] (-943.077) (-945.351) * [-943.389] (-942.466) (-944.356) (-943.734) -- 0:00:11
813500 -- [-943.521] (-944.040) (-942.877) (-948.961) * (-942.649) (-944.794) [-944.304] (-943.411) -- 0:00:11
814000 -- (-947.204) (-943.267) [-942.995] (-944.267) * [-942.745] (-942.271) (-941.648) (-944.672) -- 0:00:11
814500 -- (-947.916) (-942.762) (-950.584) [-942.850] * (-943.650) [-945.224] (-941.154) (-944.565) -- 0:00:11
815000 -- (-943.367) (-942.762) (-944.111) [-942.914] * [-941.402] (-942.025) (-946.217) (-941.223) -- 0:00:11
Average standard deviation of split frequencies: 0.004159
815500 -- [-944.555] (-942.234) (-943.011) (-947.318) * (-941.438) (-941.999) (-942.317) [-941.611] -- 0:00:11
816000 -- (-945.676) [-941.924] (-942.803) (-942.974) * (-944.197) (-943.511) [-944.987] (-942.799) -- 0:00:11
816500 -- (-945.458) (-943.837) (-942.951) [-945.030] * (-946.461) (-944.646) (-943.648) [-941.357] -- 0:00:11
817000 -- (-943.527) (-944.778) (-944.969) [-948.584] * (-946.033) (-944.443) (-945.279) [-942.981] -- 0:00:11
817500 -- [-945.404] (-943.390) (-944.340) (-944.359) * (-946.397) [-942.749] (-944.369) (-943.086) -- 0:00:11
818000 -- (-941.858) (-942.419) (-944.580) [-943.515] * (-945.873) (-946.684) [-944.708] (-942.745) -- 0:00:11
818500 -- [-944.481] (-943.309) (-944.923) (-944.840) * (-945.444) (-944.640) [-943.112] (-943.033) -- 0:00:11
819000 -- (-942.434) (-941.447) [-943.665] (-945.954) * (-943.817) (-943.117) [-943.471] (-941.805) -- 0:00:11
819500 -- (-942.331) [-944.091] (-942.771) (-944.850) * (-945.265) (-941.472) (-941.906) [-942.747] -- 0:00:11
820000 -- (-944.606) (-944.301) (-944.968) [-942.073] * (-944.667) (-943.081) [-942.470] (-944.825) -- 0:00:10
Average standard deviation of split frequencies: 0.004236
820500 -- (-942.647) (-942.603) [-942.295] (-942.845) * (-946.162) (-942.986) [-945.449] (-943.504) -- 0:00:10
821000 -- (-944.380) (-942.547) (-946.817) [-942.505] * (-946.368) (-943.252) (-946.398) [-941.599] -- 0:00:10
821500 -- [-943.267] (-945.376) (-945.010) (-942.531) * [-941.806] (-941.242) (-943.458) (-941.589) -- 0:00:10
822000 -- (-943.710) (-943.528) [-941.707] (-941.902) * (-945.881) (-943.102) (-942.785) [-941.026] -- 0:00:10
822500 -- (-943.375) [-942.075] (-942.874) (-942.698) * (-942.794) (-944.088) [-950.332] (-942.898) -- 0:00:10
823000 -- (-941.966) (-941.201) [-941.488] (-945.289) * [-944.205] (-944.255) (-944.440) (-942.119) -- 0:00:10
823500 -- (-941.430) [-943.541] (-943.539) (-945.908) * (-943.954) (-943.696) [-942.446] (-943.090) -- 0:00:10
824000 -- (-941.983) (-945.911) [-943.440] (-942.688) * [-944.438] (-941.540) (-945.106) (-944.270) -- 0:00:10
824500 -- (-945.598) (-944.215) [-942.610] (-944.052) * (-949.743) [-944.235] (-943.959) (-944.481) -- 0:00:10
825000 -- [-941.150] (-942.588) (-942.277) (-943.959) * (-942.447) (-945.591) (-944.534) [-941.998] -- 0:00:10
Average standard deviation of split frequencies: 0.004102
825500 -- (-943.175) (-946.955) (-944.058) [-943.300] * (-946.374) [-942.759] (-946.646) (-942.566) -- 0:00:10
826000 -- (-944.430) [-941.755] (-943.287) (-943.957) * [-942.370] (-941.799) (-943.633) (-946.829) -- 0:00:10
826500 -- [-944.568] (-946.100) (-941.675) (-945.062) * (-941.783) (-946.316) (-945.993) [-945.979] -- 0:00:10
827000 -- (-948.313) (-943.590) (-941.869) [-943.722] * (-942.541) (-945.542) [-942.337] (-945.220) -- 0:00:10
827500 -- (-944.676) (-942.353) [-942.415] (-945.106) * [-943.108] (-945.172) (-942.772) (-942.881) -- 0:00:10
828000 -- (-944.231) (-943.444) (-942.502) [-945.728] * (-943.470) (-941.787) (-946.256) [-941.920] -- 0:00:10
828500 -- (-943.753) (-942.724) (-943.091) [-943.796] * (-945.332) [-942.621] (-945.137) (-943.273) -- 0:00:10
829000 -- (-942.900) [-943.529] (-943.203) (-943.594) * (-944.911) (-942.911) (-942.202) [-944.841] -- 0:00:10
829500 -- (-942.005) [-942.711] (-944.772) (-943.218) * (-942.876) (-944.254) [-945.370] (-941.849) -- 0:00:10
830000 -- (-942.764) (-942.973) [-941.537] (-941.577) * (-941.919) (-942.266) (-947.410) [-943.206] -- 0:00:10
Average standard deviation of split frequencies: 0.003102
830500 -- (-942.911) [-943.123] (-945.010) (-943.288) * (-942.291) (-941.419) [-944.994] (-943.243) -- 0:00:10
831000 -- (-943.116) [-943.337] (-943.677) (-948.573) * (-942.671) (-943.723) (-942.841) [-943.198] -- 0:00:10
831500 -- (-945.593) (-942.720) (-943.879) [-943.675] * (-942.947) (-945.211) [-942.449] (-944.697) -- 0:00:10
832000 -- (-944.987) (-943.299) [-942.285] (-946.130) * [-942.260] (-942.677) (-945.584) (-948.420) -- 0:00:10
832500 -- (-948.641) (-946.235) (-941.961) [-943.117] * (-941.294) [-943.067] (-946.943) (-944.816) -- 0:00:10
833000 -- (-941.867) [-942.603] (-942.539) (-943.346) * (-944.026) (-943.299) [-943.820] (-943.475) -- 0:00:10
833500 -- (-945.989) (-944.645) (-943.700) [-941.347] * (-943.956) (-941.596) [-942.739] (-942.145) -- 0:00:10
834000 -- (-947.184) (-944.674) (-944.097) [-941.276] * (-944.152) (-943.693) [-946.600] (-942.572) -- 0:00:10
834500 -- (-946.175) (-943.294) (-946.059) [-942.235] * [-946.447] (-943.430) (-945.590) (-943.176) -- 0:00:10
835000 -- (-941.606) [-943.737] (-947.609) (-942.913) * [-942.384] (-942.894) (-943.423) (-943.279) -- 0:00:10
Average standard deviation of split frequencies: 0.003609
835500 -- (-943.961) (-941.569) (-946.502) [-945.894] * (-943.774) (-943.389) [-941.893] (-943.159) -- 0:00:10
836000 -- (-941.635) (-943.701) [-942.855] (-948.183) * (-941.317) [-945.090] (-943.276) (-942.610) -- 0:00:10
836500 -- (-943.767) (-942.477) (-944.554) [-942.498] * (-941.080) (-945.447) [-943.310] (-942.145) -- 0:00:09
837000 -- (-945.746) (-946.004) [-944.827] (-943.229) * (-942.163) (-942.707) (-944.051) [-942.056] -- 0:00:09
837500 -- (-947.520) (-943.517) [-942.797] (-944.987) * (-943.800) (-943.827) (-943.249) [-942.217] -- 0:00:09
838000 -- [-944.866] (-941.403) (-942.364) (-947.668) * (-943.745) [-946.230] (-943.660) (-943.552) -- 0:00:09
838500 -- [-949.562] (-942.197) (-942.011) (-946.382) * (-943.680) [-942.619] (-943.185) (-943.579) -- 0:00:09
839000 -- (-942.782) (-942.455) [-942.244] (-945.674) * (-944.819) (-944.358) (-942.754) [-942.679] -- 0:00:09
839500 -- [-944.103] (-944.501) (-942.710) (-944.890) * (-942.064) (-942.508) [-942.274] (-941.341) -- 0:00:09
840000 -- [-942.326] (-943.914) (-943.870) (-945.436) * (-942.182) (-946.332) (-943.510) [-941.747] -- 0:00:09
Average standard deviation of split frequencies: 0.003785
840500 -- (-943.052) (-945.289) (-943.555) [-942.306] * (-942.932) [-944.797] (-941.174) (-941.794) -- 0:00:09
841000 -- (-944.936) [-941.681] (-942.580) (-942.754) * [-942.063] (-942.229) (-941.173) (-946.321) -- 0:00:09
841500 -- (-942.802) [-946.497] (-943.182) (-942.395) * (-941.322) [-942.976] (-945.928) (-944.142) -- 0:00:09
842000 -- (-942.549) [-943.186] (-945.378) (-944.416) * (-942.440) [-943.162] (-946.768) (-945.250) -- 0:00:09
842500 -- (-942.596) (-942.738) (-941.464) [-944.218] * (-942.277) (-941.714) (-943.494) [-944.192] -- 0:00:09
843000 -- (-944.400) (-943.327) [-941.872] (-941.439) * (-941.935) (-944.086) (-944.148) [-945.314] -- 0:00:09
843500 -- [-942.360] (-943.707) (-942.325) (-941.583) * [-942.155] (-945.455) (-943.561) (-943.584) -- 0:00:09
844000 -- (-944.437) [-943.070] (-944.489) (-941.890) * [-941.695] (-944.452) (-942.573) (-948.335) -- 0:00:09
844500 -- (-942.986) [-941.796] (-945.141) (-941.792) * (-942.415) (-945.276) [-941.563] (-942.004) -- 0:00:09
845000 -- (-942.949) [-941.599] (-943.452) (-943.624) * (-943.286) [-947.362] (-942.428) (-943.222) -- 0:00:09
Average standard deviation of split frequencies: 0.003657
845500 -- [-944.856] (-941.522) (-943.305) (-941.984) * (-941.289) (-944.195) [-941.543] (-942.843) -- 0:00:09
846000 -- (-943.805) (-944.660) [-947.669] (-945.561) * [-941.638] (-942.033) (-943.497) (-944.764) -- 0:00:09
846500 -- (-944.318) (-942.533) (-944.262) [-942.547] * (-943.518) [-942.213] (-943.602) (-943.712) -- 0:00:09
847000 -- (-942.427) (-948.592) (-941.816) [-941.626] * (-943.862) [-942.143] (-944.049) (-942.498) -- 0:00:09
847500 -- (-945.990) (-941.323) (-945.247) [-942.260] * [-942.358] (-942.371) (-944.439) (-944.494) -- 0:00:09
848000 -- (-942.711) [-944.733] (-943.010) (-942.365) * (-944.380) (-943.600) [-943.173] (-942.207) -- 0:00:09
848500 -- (-944.669) (-944.080) (-941.493) [-942.914] * (-948.946) (-944.995) (-944.422) [-942.071] -- 0:00:09
849000 -- (-944.155) (-942.798) (-941.850) [-943.967] * (-943.790) (-947.269) (-941.669) [-944.360] -- 0:00:09
849500 -- (-949.217) (-942.987) [-943.085] (-942.979) * (-946.105) [-943.590] (-942.447) (-947.078) -- 0:00:09
850000 -- (-943.952) [-943.803] (-943.862) (-943.706) * (-946.613) (-944.973) (-941.643) [-947.917] -- 0:00:09
Average standard deviation of split frequencies: 0.004122
850500 -- (-945.886) [-944.984] (-944.417) (-942.671) * (-942.543) [-942.242] (-944.731) (-947.874) -- 0:00:09
851000 -- (-942.794) [-945.703] (-943.925) (-942.001) * [-945.384] (-943.430) (-945.702) (-946.097) -- 0:00:09
851500 -- (-942.968) [-941.786] (-945.230) (-942.714) * (-943.619) (-941.170) [-942.662] (-942.167) -- 0:00:09
852000 -- (-942.826) (-941.537) [-941.817] (-941.117) * [-944.381] (-942.809) (-943.221) (-942.700) -- 0:00:09
852500 -- [-945.732] (-942.753) (-942.193) (-942.471) * (-945.393) [-944.938] (-943.714) (-945.215) -- 0:00:08
853000 -- [-942.836] (-942.710) (-943.069) (-945.276) * [-943.214] (-943.375) (-944.751) (-944.867) -- 0:00:08
853500 -- [-943.286] (-942.402) (-942.368) (-943.496) * (-942.781) (-945.905) [-942.118] (-945.155) -- 0:00:08
854000 -- (-946.411) (-943.901) [-949.095] (-943.484) * [-943.387] (-943.265) (-943.530) (-945.731) -- 0:00:08
854500 -- (-944.670) [-941.345] (-944.561) (-943.804) * (-942.325) (-944.792) [-943.305] (-943.581) -- 0:00:08
855000 -- (-942.470) [-942.383] (-944.522) (-942.242) * (-944.875) (-944.178) [-941.411] (-947.063) -- 0:00:08
Average standard deviation of split frequencies: 0.003993
855500 -- [-942.580] (-941.928) (-942.860) (-941.387) * (-942.237) (-943.737) (-944.966) [-945.444] -- 0:00:08
856000 -- (-942.122) (-945.077) [-942.523] (-945.736) * [-942.506] (-942.991) (-942.669) (-945.085) -- 0:00:08
856500 -- (-941.183) [-941.278] (-942.569) (-941.498) * [-944.754] (-944.650) (-943.801) (-944.365) -- 0:00:08
857000 -- [-941.803] (-942.212) (-941.762) (-943.763) * (-941.964) [-945.504] (-941.975) (-942.031) -- 0:00:08
857500 -- (-946.002) (-941.904) (-942.973) [-941.592] * [-944.329] (-942.805) (-941.189) (-944.312) -- 0:00:08
858000 -- [-941.863] (-943.926) (-943.535) (-944.231) * (-943.628) (-941.704) (-942.793) [-943.064] -- 0:00:08
858500 -- (-949.282) (-942.191) (-941.707) [-941.862] * [-945.233] (-942.842) (-941.837) (-943.262) -- 0:00:08
859000 -- (-946.056) (-942.182) [-943.495] (-951.751) * [-942.029] (-944.437) (-946.251) (-945.141) -- 0:00:08
859500 -- (-946.876) (-942.076) [-941.366] (-942.850) * [-944.326] (-942.908) (-946.074) (-946.358) -- 0:00:08
860000 -- [-944.583] (-942.960) (-943.023) (-944.022) * (-946.487) [-943.689] (-943.275) (-942.775) -- 0:00:08
Average standard deviation of split frequencies: 0.003834
860500 -- (-945.971) (-945.099) (-944.709) [-942.577] * (-944.721) (-945.362) [-941.480] (-941.271) -- 0:00:08
861000 -- (-946.464) (-943.157) (-945.064) [-943.446] * (-944.733) (-947.277) (-945.040) [-945.360] -- 0:00:08
861500 -- (-944.383) (-942.810) [-943.884] (-943.410) * (-941.845) (-943.721) (-945.769) [-941.701] -- 0:00:08
862000 -- (-945.960) (-943.334) (-944.395) [-942.673] * (-941.959) (-942.241) (-944.736) [-946.376] -- 0:00:08
862500 -- (-942.309) (-941.664) (-945.226) [-944.030] * (-943.549) [-942.069] (-945.523) (-944.465) -- 0:00:08
863000 -- [-945.345] (-942.932) (-943.787) (-944.251) * (-943.560) (-945.331) (-941.775) [-942.171] -- 0:00:08
863500 -- (-947.274) (-950.200) (-943.639) [-942.445] * (-946.019) (-944.479) (-943.056) [-942.294] -- 0:00:08
864000 -- (-941.634) (-943.232) [-946.080] (-943.940) * (-947.660) (-944.292) [-941.055] (-943.885) -- 0:00:08
864500 -- [-943.069] (-944.715) (-945.915) (-944.027) * (-942.163) (-942.752) [-944.545] (-948.388) -- 0:00:08
865000 -- [-942.884] (-942.125) (-941.806) (-944.355) * [-943.281] (-943.501) (-946.668) (-945.841) -- 0:00:08
Average standard deviation of split frequencies: 0.004483
865500 -- (-943.571) (-941.689) [-942.482] (-942.168) * [-942.323] (-944.072) (-943.380) (-946.591) -- 0:00:08
866000 -- [-941.904] (-942.598) (-942.622) (-943.755) * (-944.571) (-942.819) (-941.881) [-944.215] -- 0:00:08
866500 -- [-941.917] (-945.435) (-942.820) (-943.400) * [-944.209] (-943.070) (-941.569) (-941.591) -- 0:00:08
867000 -- (-943.079) (-943.259) [-943.587] (-941.552) * [-946.607] (-943.773) (-941.456) (-944.625) -- 0:00:08
867500 -- (-943.615) (-943.626) [-943.931] (-941.175) * (-946.217) (-944.171) (-942.851) [-949.134] -- 0:00:08
868000 -- (-950.625) (-942.410) (-945.800) [-941.501] * [-944.647] (-943.448) (-942.660) (-943.904) -- 0:00:08
868500 -- [-943.683] (-947.938) (-942.535) (-943.920) * (-942.022) (-942.529) (-942.294) [-943.857] -- 0:00:08
869000 -- [-941.681] (-943.222) (-943.285) (-943.511) * (-942.443) (-941.830) [-942.620] (-941.718) -- 0:00:07
869500 -- [-943.554] (-945.308) (-945.305) (-943.706) * [-941.558] (-942.332) (-941.922) (-943.087) -- 0:00:07
870000 -- [-941.687] (-945.080) (-947.585) (-943.957) * (-944.245) (-942.526) (-944.480) [-941.546] -- 0:00:07
Average standard deviation of split frequencies: 0.004501
870500 -- (-941.655) (-941.437) [-944.699] (-943.961) * (-948.042) (-945.795) [-945.649] (-942.652) -- 0:00:07
871000 -- (-944.556) (-942.575) [-944.462] (-941.377) * (-944.702) (-942.677) [-943.773] (-944.942) -- 0:00:07
871500 -- [-941.706] (-943.515) (-943.589) (-941.348) * (-943.721) (-941.886) [-944.759] (-945.265) -- 0:00:07
872000 -- [-941.245] (-942.606) (-942.341) (-943.307) * (-946.109) [-942.308] (-943.975) (-943.090) -- 0:00:07
872500 -- (-943.213) [-943.176] (-943.265) (-945.256) * (-944.703) (-946.928) [-943.849] (-943.310) -- 0:00:07
873000 -- (-944.181) (-942.281) [-943.148] (-941.557) * (-944.017) (-941.815) (-942.620) [-941.712] -- 0:00:07
873500 -- [-945.136] (-941.485) (-944.971) (-943.782) * (-943.750) (-943.886) (-945.650) [-943.772] -- 0:00:07
874000 -- (-943.421) (-941.650) [-945.291] (-944.647) * (-942.176) (-943.939) [-942.933] (-943.496) -- 0:00:07
874500 -- (-941.608) [-943.626] (-942.117) (-945.819) * (-942.617) (-942.547) [-942.432] (-945.965) -- 0:00:07
875000 -- (-942.813) [-944.202] (-941.490) (-942.809) * [-942.163] (-945.115) (-946.011) (-943.131) -- 0:00:07
Average standard deviation of split frequencies: 0.004675
875500 -- [-942.451] (-947.087) (-942.901) (-941.956) * (-946.833) [-941.911] (-943.555) (-942.815) -- 0:00:07
876000 -- (-941.574) (-943.910) [-944.984] (-944.137) * (-942.325) [-944.541] (-943.449) (-942.118) -- 0:00:07
876500 -- (-944.288) (-942.533) (-941.786) [-943.724] * [-942.830] (-944.786) (-943.822) (-941.770) -- 0:00:07
877000 -- (-942.664) (-946.242) (-943.015) [-945.756] * (-943.568) [-942.827] (-942.393) (-941.554) -- 0:00:07
877500 -- (-945.453) (-943.886) (-942.546) [-942.818] * (-943.148) (-943.197) [-942.487] (-941.725) -- 0:00:07
878000 -- (-944.026) [-946.273] (-942.673) (-943.693) * (-945.362) [-943.097] (-948.588) (-945.564) -- 0:00:07
878500 -- (-942.439) [-942.427] (-943.638) (-945.385) * [-942.787] (-943.160) (-941.922) (-942.023) -- 0:00:07
879000 -- (-943.359) (-943.649) [-943.228] (-943.803) * (-947.169) (-944.925) [-942.025] (-945.193) -- 0:00:07
879500 -- (-943.540) (-945.532) [-943.689] (-942.120) * [-943.593] (-945.831) (-943.510) (-942.880) -- 0:00:07
880000 -- (-945.201) [-943.861] (-945.399) (-942.704) * (-944.649) (-942.950) [-944.639] (-942.367) -- 0:00:07
Average standard deviation of split frequencies: 0.004684
880500 -- (-941.950) (-942.091) [-946.366] (-943.114) * [-944.107] (-942.773) (-944.058) (-941.974) -- 0:00:07
881000 -- (-941.960) [-943.139] (-943.394) (-949.553) * (-945.491) [-942.411] (-942.658) (-941.692) -- 0:00:07
881500 -- (-943.699) (-946.485) [-942.928] (-946.184) * (-943.674) (-942.963) [-943.615] (-942.235) -- 0:00:07
882000 -- (-942.776) (-943.693) (-941.315) [-943.693] * [-941.859] (-944.300) (-941.741) (-941.974) -- 0:00:07
882500 -- (-944.112) (-943.367) (-944.065) [-945.016] * (-942.176) (-943.566) [-942.575] (-942.427) -- 0:00:07
883000 -- (-947.696) (-944.256) [-946.730] (-945.749) * (-946.754) (-944.452) [-941.538] (-942.923) -- 0:00:07
883500 -- [-945.468] (-944.071) (-948.729) (-944.490) * [-945.444] (-943.275) (-941.429) (-943.664) -- 0:00:07
884000 -- (-948.603) [-942.444] (-945.771) (-944.805) * [-944.983] (-943.787) (-949.127) (-944.679) -- 0:00:07
884500 -- (-945.086) (-942.775) (-943.111) [-944.723] * (-942.528) (-942.436) [-943.979] (-944.167) -- 0:00:07
885000 -- (-943.249) (-945.527) [-943.039] (-944.556) * (-942.491) [-943.632] (-942.980) (-944.847) -- 0:00:07
Average standard deviation of split frequencies: 0.004489
885500 -- (-942.953) [-944.202] (-943.217) (-944.644) * [-944.845] (-943.908) (-943.289) (-944.793) -- 0:00:06
886000 -- [-942.307] (-941.573) (-941.989) (-941.329) * (-943.519) (-942.814) (-947.988) [-942.255] -- 0:00:06
886500 -- (-945.171) (-941.710) (-942.377) [-942.967] * (-946.265) [-944.205] (-941.526) (-943.495) -- 0:00:06
887000 -- [-942.188] (-941.274) (-942.267) (-945.248) * [-947.120] (-941.508) (-941.967) (-942.667) -- 0:00:06
887500 -- (-942.766) (-942.690) (-944.093) [-942.536] * [-945.327] (-944.732) (-941.411) (-943.177) -- 0:00:06
888000 -- (-941.798) [-943.972] (-944.880) (-943.881) * [-944.363] (-944.629) (-946.885) (-943.322) -- 0:00:06
888500 -- (-942.100) (-943.078) [-943.647] (-941.610) * (-944.363) (-941.819) [-944.232] (-942.401) -- 0:00:06
889000 -- (-942.601) (-943.434) [-943.197] (-942.224) * (-943.497) (-945.689) (-945.699) [-942.670] -- 0:00:06
889500 -- (-942.129) (-944.417) (-945.445) [-942.673] * (-942.166) (-943.730) (-945.700) [-946.802] -- 0:00:06
890000 -- (-944.481) [-945.243] (-944.714) (-942.014) * (-941.080) (-945.758) [-942.760] (-944.530) -- 0:00:06
Average standard deviation of split frequencies: 0.004532
890500 -- [-943.030] (-944.564) (-943.845) (-942.010) * (-942.134) (-942.791) (-941.849) [-943.418] -- 0:00:06
891000 -- (-945.363) (-942.755) (-945.304) [-942.095] * [-944.677] (-945.706) (-943.347) (-947.595) -- 0:00:06
891500 -- [-941.905] (-942.297) (-943.430) (-942.540) * [-943.703] (-943.365) (-944.095) (-941.911) -- 0:00:06
892000 -- (-947.531) [-942.837] (-942.360) (-942.908) * (-946.539) (-944.694) (-942.624) [-942.815] -- 0:00:06
892500 -- (-942.706) (-942.544) [-945.815] (-943.284) * (-947.277) (-944.921) (-942.097) [-942.217] -- 0:00:06
893000 -- (-941.346) [-946.551] (-942.753) (-944.209) * [-944.323] (-945.130) (-945.538) (-944.233) -- 0:00:06
893500 -- [-943.135] (-942.681) (-941.935) (-945.346) * [-942.577] (-941.387) (-946.313) (-943.449) -- 0:00:06
894000 -- (-943.208) [-941.813] (-941.870) (-943.045) * (-941.961) (-941.313) (-945.953) [-941.979] -- 0:00:06
894500 -- [-942.568] (-943.210) (-943.398) (-946.258) * (-942.310) (-946.555) (-942.612) [-941.864] -- 0:00:06
895000 -- [-941.671] (-950.108) (-944.445) (-943.026) * (-942.901) (-944.348) [-942.011] (-942.803) -- 0:00:06
Average standard deviation of split frequencies: 0.004801
895500 -- (-944.661) (-946.274) (-949.050) [-944.045] * (-945.132) (-946.476) (-948.406) [-944.667] -- 0:00:06
896000 -- (-942.038) [-942.971] (-943.602) (-945.008) * [-941.857] (-943.731) (-944.251) (-941.540) -- 0:00:06
896500 -- [-941.910] (-941.488) (-942.962) (-944.584) * (-943.093) (-943.906) [-941.761] (-942.708) -- 0:00:06
897000 -- (-941.984) [-944.514] (-941.936) (-943.466) * (-944.851) (-945.563) [-944.635] (-943.195) -- 0:00:06
897500 -- (-942.413) [-943.091] (-942.466) (-945.397) * (-941.551) (-942.281) [-944.732] (-944.423) -- 0:00:06
898000 -- (-944.299) (-942.239) (-941.952) [-942.626] * (-943.070) (-944.121) [-942.556] (-943.050) -- 0:00:06
898500 -- (-943.271) (-943.975) [-942.648] (-942.093) * (-943.442) (-945.881) [-942.670] (-946.187) -- 0:00:06
899000 -- (-943.358) (-945.710) (-945.418) [-943.059] * (-941.684) (-946.909) [-942.428] (-947.521) -- 0:00:06
899500 -- (-943.291) [-942.235] (-948.116) (-944.758) * (-943.793) [-941.645] (-943.785) (-946.869) -- 0:00:06
900000 -- (-946.040) (-941.439) (-944.330) [-941.049] * (-947.074) (-942.572) (-944.085) [-941.918] -- 0:00:06
Average standard deviation of split frequencies: 0.004678
900500 -- (-944.125) (-941.461) (-944.577) [-947.754] * (-947.844) (-942.370) [-945.822] (-944.549) -- 0:00:06
901000 -- (-944.199) (-943.688) [-941.911] (-944.388) * (-944.814) (-942.755) [-942.392] (-944.903) -- 0:00:06
901500 -- [-944.994] (-943.438) (-943.144) (-942.432) * (-943.674) (-946.063) (-941.709) [-942.271] -- 0:00:06
902000 -- (-944.409) (-941.853) (-942.771) [-944.215] * (-944.852) (-942.362) (-943.923) [-944.279] -- 0:00:05
902500 -- (-946.067) [-943.440] (-945.135) (-942.100) * (-942.680) [-942.594] (-942.609) (-944.219) -- 0:00:05
903000 -- [-942.947] (-944.055) (-948.480) (-950.152) * (-943.615) [-944.528] (-941.855) (-943.149) -- 0:00:05
903500 -- [-943.407] (-943.229) (-943.482) (-943.928) * (-944.259) (-943.305) [-942.984] (-943.538) -- 0:00:05
904000 -- [-941.751] (-942.342) (-942.391) (-943.595) * [-943.766] (-941.708) (-942.660) (-942.504) -- 0:00:05
904500 -- (-943.208) (-943.098) [-945.176] (-944.818) * (-942.864) (-941.453) (-944.074) [-943.345] -- 0:00:05
905000 -- (-941.803) (-942.956) [-944.064] (-944.525) * [-942.238] (-943.066) (-944.399) (-944.448) -- 0:00:05
Average standard deviation of split frequencies: 0.004650
905500 -- (-944.375) (-943.153) [-944.184] (-944.533) * (-943.643) (-943.630) [-942.979] (-943.142) -- 0:00:05
906000 -- (-946.694) (-942.921) (-942.264) [-942.493] * (-944.439) (-946.581) (-944.311) [-944.498] -- 0:00:05
906500 -- (-945.611) (-943.353) (-943.744) [-943.020] * (-941.900) (-943.305) [-948.554] (-941.743) -- 0:00:05
907000 -- (-942.275) (-944.858) (-941.748) [-943.678] * (-944.007) (-944.939) [-943.310] (-943.686) -- 0:00:05
907500 -- (-941.982) (-943.824) [-941.822] (-942.907) * (-946.065) [-942.456] (-942.680) (-944.256) -- 0:00:05
908000 -- [-942.287] (-947.110) (-943.259) (-945.319) * (-943.998) [-941.929] (-944.702) (-943.790) -- 0:00:05
908500 -- (-942.126) (-945.504) [-941.754] (-948.443) * (-942.360) (-943.191) [-943.087] (-946.326) -- 0:00:05
909000 -- (-943.682) (-943.770) [-941.291] (-945.039) * [-942.902] (-942.497) (-946.200) (-943.147) -- 0:00:05
909500 -- (-945.565) [-945.858] (-942.990) (-942.147) * (-948.612) [-942.821] (-942.188) (-942.094) -- 0:00:05
910000 -- [-943.507] (-945.351) (-943.820) (-942.511) * (-943.241) [-942.351] (-943.087) (-942.114) -- 0:00:05
Average standard deviation of split frequencies: 0.004521
910500 -- (-942.673) [-943.486] (-945.065) (-942.892) * (-943.155) (-945.667) (-947.355) [-942.955] -- 0:00:05
911000 -- (-941.916) [-942.168] (-943.744) (-941.508) * [-943.005] (-941.910) (-947.044) (-943.060) -- 0:00:05
911500 -- (-941.340) [-942.648] (-943.095) (-950.643) * (-943.800) [-942.560] (-942.820) (-945.736) -- 0:00:05
912000 -- (-942.304) (-943.198) [-947.963] (-944.616) * [-944.999] (-943.244) (-943.413) (-944.635) -- 0:00:05
912500 -- (-943.359) [-942.013] (-944.893) (-943.792) * (-946.271) (-943.015) [-942.392] (-942.424) -- 0:00:05
913000 -- (-943.095) [-941.289] (-944.457) (-942.269) * (-944.520) [-942.622] (-947.076) (-942.995) -- 0:00:05
913500 -- (-947.274) [-942.543] (-945.275) (-942.913) * [-942.300] (-943.986) (-945.815) (-942.929) -- 0:00:05
914000 -- [-946.989] (-941.579) (-945.288) (-942.662) * (-944.501) (-941.086) [-944.349] (-942.610) -- 0:00:05
914500 -- (-946.327) (-942.017) [-942.226] (-941.949) * (-943.514) [-941.112] (-948.848) (-942.264) -- 0:00:05
915000 -- (-947.264) (-941.808) (-946.565) [-942.002] * (-943.940) [-941.385] (-949.055) (-942.582) -- 0:00:05
Average standard deviation of split frequencies: 0.004632
915500 -- (-947.248) (-942.975) (-944.097) [-942.514] * (-945.321) (-946.836) (-946.245) [-941.494] -- 0:00:05
916000 -- [-944.523] (-942.373) (-945.847) (-945.970) * (-943.135) [-946.662] (-942.776) (-945.750) -- 0:00:05
916500 -- [-941.932] (-942.877) (-942.340) (-945.486) * (-950.002) (-941.930) [-941.722] (-943.851) -- 0:00:05
917000 -- [-947.081] (-943.679) (-943.536) (-944.247) * (-943.819) (-941.586) (-943.268) [-942.171] -- 0:00:05
917500 -- (-942.876) (-946.096) (-942.729) [-941.862] * (-946.614) (-946.943) [-942.479] (-942.250) -- 0:00:05
918000 -- (-942.153) (-945.620) (-943.540) [-945.116] * (-945.719) (-944.933) [-943.649] (-942.128) -- 0:00:05
918500 -- (-942.029) (-947.601) [-946.969] (-943.225) * (-942.112) (-944.455) [-945.703] (-944.334) -- 0:00:04
919000 -- (-946.497) (-942.826) [-946.981] (-945.681) * (-944.002) [-946.283] (-945.218) (-947.834) -- 0:00:04
919500 -- (-943.898) [-941.789] (-946.785) (-948.105) * (-942.302) (-942.403) (-943.815) [-942.427] -- 0:00:04
920000 -- (-943.218) [-945.401] (-945.430) (-946.291) * (-943.911) [-943.224] (-941.676) (-944.887) -- 0:00:04
Average standard deviation of split frequencies: 0.005086
920500 -- [-942.934] (-947.742) (-943.302) (-946.356) * [-942.814] (-943.700) (-949.427) (-945.802) -- 0:00:04
921000 -- (-946.040) (-943.057) [-942.064] (-944.663) * [-944.036] (-942.350) (-944.841) (-947.277) -- 0:00:04
921500 -- [-946.011] (-943.546) (-941.745) (-944.110) * (-945.765) (-948.752) [-943.182] (-943.997) -- 0:00:04
922000 -- (-942.828) (-943.868) (-945.366) [-944.334] * (-941.891) (-946.465) (-942.626) [-942.818] -- 0:00:04
922500 -- (-944.937) (-947.814) (-944.623) [-945.533] * (-942.651) (-944.357) (-941.102) [-942.380] -- 0:00:04
923000 -- (-942.666) [-943.057] (-945.209) (-944.117) * [-942.280] (-945.177) (-941.347) (-942.455) -- 0:00:04
923500 -- (-943.042) [-945.022] (-941.777) (-948.292) * (-944.390) (-946.275) [-943.173] (-942.155) -- 0:00:04
924000 -- (-942.508) (-945.060) (-944.257) [-944.390] * (-945.473) (-945.078) (-945.889) [-941.992] -- 0:00:04
924500 -- (-943.331) [-942.336] (-945.851) (-943.571) * [-946.423] (-943.864) (-942.949) (-943.255) -- 0:00:04
925000 -- (-941.924) [-943.517] (-944.508) (-945.213) * [-943.186] (-942.665) (-943.080) (-943.899) -- 0:00:04
Average standard deviation of split frequencies: 0.005091
925500 -- (-942.559) (-943.014) (-944.745) [-942.372] * (-947.669) (-943.789) [-941.574] (-942.505) -- 0:00:04
926000 -- (-943.462) (-943.982) [-943.760] (-941.613) * (-942.791) (-943.386) (-941.569) [-942.324] -- 0:00:04
926500 -- (-943.860) (-943.980) (-941.359) [-942.168] * (-942.903) [-945.123] (-942.123) (-945.103) -- 0:00:04
927000 -- (-942.456) (-946.834) (-945.072) [-943.494] * [-944.362] (-945.702) (-944.405) (-945.556) -- 0:00:04
927500 -- (-945.443) (-943.734) (-945.437) [-941.708] * (-946.123) (-944.386) [-941.580] (-946.786) -- 0:00:04
928000 -- (-942.796) [-945.532] (-943.001) (-947.419) * (-945.086) [-942.091] (-943.247) (-943.120) -- 0:00:04
928500 -- (-944.096) [-943.102] (-942.546) (-945.064) * (-942.117) [-943.117] (-944.103) (-943.833) -- 0:00:04
929000 -- (-941.851) (-942.838) (-941.286) [-942.153] * [-943.616] (-943.210) (-944.460) (-942.056) -- 0:00:04
929500 -- (-944.837) (-942.588) [-941.106] (-943.861) * (-943.052) (-943.771) (-942.671) [-942.463] -- 0:00:04
930000 -- (-942.054) (-941.296) [-941.518] (-941.823) * (-944.204) (-943.975) [-942.256] (-944.197) -- 0:00:04
Average standard deviation of split frequencies: 0.005635
930500 -- (-944.314) (-944.528) [-942.016] (-942.801) * (-942.993) (-943.289) (-942.057) [-942.153] -- 0:00:04
931000 -- (-943.969) [-942.505] (-942.582) (-942.055) * (-943.688) (-941.733) (-945.763) [-945.201] -- 0:00:04
931500 -- (-943.596) (-941.802) (-943.134) [-947.108] * (-943.314) [-944.534] (-945.155) (-941.416) -- 0:00:04
932000 -- (-945.139) (-941.839) (-944.697) [-942.155] * [-946.570] (-944.341) (-947.751) (-943.066) -- 0:00:04
932500 -- [-947.279] (-947.058) (-942.779) (-942.132) * (-948.654) (-942.119) (-943.047) [-946.364] -- 0:00:04
933000 -- (-944.461) (-943.358) (-943.761) [-942.124] * [-943.954] (-944.569) (-941.473) (-943.151) -- 0:00:04
933500 -- (-948.507) (-942.766) [-941.902] (-942.132) * (-944.250) (-942.940) (-944.700) [-943.612] -- 0:00:04
934000 -- [-944.757] (-942.808) (-946.985) (-942.423) * (-944.111) (-942.047) (-946.137) [-943.854] -- 0:00:04
934500 -- (-943.216) (-941.969) [-942.755] (-942.932) * (-942.446) [-942.916] (-944.482) (-943.562) -- 0:00:03
935000 -- (-942.880) (-942.985) (-945.516) [-941.441] * (-943.304) (-942.898) [-945.130] (-942.774) -- 0:00:03
Average standard deviation of split frequencies: 0.006077
935500 -- (-943.518) (-943.395) [-945.498] (-941.317) * (-943.584) [-942.042] (-948.399) (-941.560) -- 0:00:03
936000 -- (-948.085) (-943.370) (-943.394) [-944.314] * [-944.976] (-943.265) (-947.583) (-944.673) -- 0:00:03
936500 -- [-946.128] (-946.018) (-942.796) (-945.349) * (-942.011) (-943.618) [-942.498] (-944.249) -- 0:00:03
937000 -- (-946.114) (-945.740) (-942.754) [-942.434] * (-942.545) (-943.471) (-941.762) [-944.129] -- 0:00:03
937500 -- [-942.859] (-947.045) (-944.486) (-942.304) * (-944.873) (-943.975) (-941.484) [-943.283] -- 0:00:03
938000 -- [-941.901] (-946.125) (-941.526) (-943.871) * (-945.975) (-944.012) [-941.256] (-942.290) -- 0:00:03
938500 -- [-941.217] (-941.839) (-945.788) (-946.126) * (-944.912) [-947.853] (-942.511) (-942.612) -- 0:00:03
939000 -- [-942.057] (-942.527) (-941.831) (-945.292) * [-944.806] (-945.172) (-943.676) (-942.165) -- 0:00:03
939500 -- (-942.825) [-944.238] (-941.991) (-941.182) * (-943.093) (-944.506) [-942.600] (-942.066) -- 0:00:03
940000 -- (-943.271) (-947.716) (-943.244) [-942.128] * (-943.936) (-941.885) (-943.227) [-941.774] -- 0:00:03
Average standard deviation of split frequencies: 0.005847
940500 -- [-945.073] (-942.677) (-946.031) (-943.328) * (-942.026) [-941.702] (-943.148) (-944.056) -- 0:00:03
941000 -- (-943.595) (-942.899) (-954.082) [-943.250] * (-950.318) (-947.306) (-942.618) [-942.525] -- 0:00:03
941500 -- (-943.751) (-942.326) [-943.098] (-941.763) * (-945.214) (-943.399) [-942.709] (-943.019) -- 0:00:03
942000 -- (-942.249) (-943.566) (-944.993) [-943.523] * (-945.344) (-945.055) (-946.481) [-943.825] -- 0:00:03
942500 -- [-942.588] (-947.514) (-942.419) (-943.318) * (-942.774) [-944.000] (-946.053) (-943.261) -- 0:00:03
943000 -- (-942.510) (-947.390) (-942.685) [-942.129] * (-946.246) (-942.750) (-945.445) [-943.866] -- 0:00:03
943500 -- [-943.948] (-944.189) (-943.333) (-944.212) * (-946.877) (-944.610) (-943.213) [-941.348] -- 0:00:03
944000 -- (-943.084) (-943.888) (-946.063) [-944.545] * (-943.285) (-944.758) (-943.491) [-943.181] -- 0:00:03
944500 -- [-942.304] (-942.930) (-942.399) (-945.135) * (-942.649) (-946.217) (-943.531) [-943.035] -- 0:00:03
945000 -- (-942.569) (-949.558) [-943.220] (-944.019) * (-942.365) (-942.499) [-944.232] (-942.461) -- 0:00:03
Average standard deviation of split frequencies: 0.005814
945500 -- (-943.592) [-941.443] (-944.435) (-942.449) * (-942.173) (-944.463) [-941.913] (-942.070) -- 0:00:03
946000 -- (-943.087) (-941.443) (-942.967) [-942.551] * [-941.686] (-944.498) (-943.292) (-942.386) -- 0:00:03
946500 -- [-943.897] (-941.447) (-945.133) (-945.874) * (-949.439) (-946.879) (-942.322) [-943.034] -- 0:00:03
947000 -- (-942.586) (-942.712) [-944.897] (-942.632) * (-943.013) (-945.070) [-944.257] (-945.091) -- 0:00:03
947500 -- (-943.531) (-943.739) [-943.165] (-943.677) * (-942.402) (-943.137) (-941.846) [-944.914] -- 0:00:03
948000 -- (-944.847) (-941.833) (-942.834) [-945.708] * (-942.047) (-942.572) (-942.955) [-942.435] -- 0:00:03
948500 -- (-942.083) [-944.947] (-942.202) (-946.210) * (-943.971) (-942.944) (-942.034) [-943.699] -- 0:00:03
949000 -- (-943.027) (-947.282) (-942.594) [-942.311] * (-943.343) [-944.621] (-945.177) (-944.784) -- 0:00:03
949500 -- (-942.522) (-944.297) [-942.318] (-943.669) * (-947.008) [-942.924] (-942.011) (-942.419) -- 0:00:03
950000 -- (-943.328) (-942.853) (-945.637) [-943.139] * (-950.449) (-945.511) (-943.452) [-943.418] -- 0:00:03
Average standard deviation of split frequencies: 0.005620
950500 -- (-942.028) (-943.284) (-943.608) [-942.363] * (-944.135) [-943.101] (-948.223) (-943.933) -- 0:00:03
951000 -- [-941.432] (-943.302) (-942.215) (-941.923) * (-944.265) [-943.953] (-944.239) (-941.537) -- 0:00:02
951500 -- (-942.496) (-942.537) [-941.919] (-942.863) * [-948.367] (-941.924) (-943.049) (-945.268) -- 0:00:02
952000 -- (-941.421) (-941.749) (-944.520) [-942.802] * [-943.804] (-948.499) (-943.551) (-942.410) -- 0:00:02
952500 -- (-944.158) (-944.554) (-943.683) [-942.732] * (-942.678) [-943.759] (-941.902) (-943.554) -- 0:00:02
953000 -- (-947.801) [-944.955] (-943.489) (-942.097) * (-942.687) (-942.954) (-944.597) [-942.566] -- 0:00:02
953500 -- (-944.116) (-943.031) [-944.341] (-942.935) * (-942.204) (-942.923) [-942.111] (-944.123) -- 0:00:02
954000 -- (-943.754) (-944.994) [-942.830] (-944.352) * (-942.626) (-942.998) [-942.328] (-942.385) -- 0:00:02
954500 -- (-941.942) (-944.158) [-943.973] (-943.748) * (-942.474) (-944.355) [-945.363] (-944.865) -- 0:00:02
955000 -- (-945.635) (-945.754) (-941.685) [-942.524] * (-942.823) (-942.641) (-947.986) [-942.410] -- 0:00:02
Average standard deviation of split frequencies: 0.004964
955500 -- (-942.868) [-945.172] (-944.270) (-945.870) * (-942.429) [-942.619] (-947.490) (-946.621) -- 0:00:02
956000 -- (-941.790) (-955.324) [-948.790] (-942.913) * [-945.597] (-941.918) (-946.450) (-945.427) -- 0:00:02
956500 -- [-941.378] (-942.632) (-947.184) (-944.226) * (-945.343) (-943.295) (-943.326) [-943.351] -- 0:00:02
957000 -- (-942.290) (-942.908) (-946.334) [-944.807] * (-945.629) (-942.825) [-943.927] (-943.966) -- 0:00:02
957500 -- (-942.419) [-943.830] (-942.403) (-946.018) * (-941.844) [-942.534] (-942.476) (-943.425) -- 0:00:02
958000 -- (-944.251) (-943.505) (-945.451) [-948.462] * (-945.581) (-943.596) (-944.569) [-942.520] -- 0:00:02
958500 -- [-943.584] (-943.327) (-942.280) (-943.690) * (-942.440) (-944.902) (-943.570) [-943.420] -- 0:00:02
959000 -- (-947.248) (-943.345) [-943.781] (-943.928) * (-942.209) [-944.354] (-942.516) (-941.502) -- 0:00:02
959500 -- (-946.323) (-943.313) [-942.619] (-945.490) * (-941.729) [-943.500] (-942.502) (-943.540) -- 0:00:02
960000 -- (-944.791) (-942.756) [-943.241] (-944.776) * (-941.730) (-942.179) (-941.366) [-941.965] -- 0:00:02
Average standard deviation of split frequencies: 0.004384
960500 -- (-946.171) (-947.917) [-942.773] (-942.360) * [-944.989] (-943.088) (-942.665) (-941.939) -- 0:00:02
961000 -- (-942.878) (-947.051) (-944.858) [-942.888] * [-943.427] (-943.657) (-942.037) (-944.820) -- 0:00:02
961500 -- (-942.677) [-942.455] (-943.280) (-941.982) * (-944.241) (-943.705) (-942.986) [-945.711] -- 0:00:02
962000 -- (-943.391) [-944.701] (-941.920) (-942.285) * (-942.595) [-942.516] (-944.417) (-945.107) -- 0:00:02
962500 -- [-946.843] (-942.258) (-942.010) (-949.200) * (-942.513) (-942.079) (-941.990) [-943.550] -- 0:00:02
963000 -- (-946.401) [-943.818] (-941.583) (-945.131) * [-943.556] (-942.391) (-941.818) (-942.402) -- 0:00:02
963500 -- (-946.676) (-942.050) (-943.176) [-943.582] * (-943.758) (-945.489) [-941.840] (-944.523) -- 0:00:02
964000 -- [-942.099] (-942.298) (-943.160) (-942.259) * (-944.497) (-944.189) [-945.504] (-942.527) -- 0:00:02
964500 -- (-942.620) (-944.957) (-942.729) [-942.650] * (-942.795) [-944.238] (-946.707) (-948.181) -- 0:00:02
965000 -- [-945.116] (-944.338) (-942.578) (-941.910) * (-942.415) (-941.227) [-945.079] (-946.470) -- 0:00:02
Average standard deviation of split frequencies: 0.004327
965500 -- (-945.147) (-941.611) (-945.798) [-942.609] * [-942.724] (-943.281) (-943.826) (-941.546) -- 0:00:02
966000 -- (-951.517) (-942.804) [-945.111] (-941.173) * [-941.830] (-943.442) (-943.122) (-942.017) -- 0:00:02
966500 -- (-943.118) (-942.196) [-948.463] (-949.539) * (-944.262) (-945.482) (-943.335) [-941.799] -- 0:00:02
967000 -- [-943.948] (-944.684) (-944.014) (-943.944) * [-944.056] (-942.808) (-944.048) (-941.410) -- 0:00:02
967500 -- (-944.702) [-942.130] (-942.410) (-942.271) * (-953.690) (-943.870) [-942.827] (-942.163) -- 0:00:01
968000 -- (-943.407) (-943.031) (-944.596) [-942.459] * (-942.970) [-943.216] (-943.789) (-943.274) -- 0:00:01
968500 -- (-943.016) [-945.856] (-941.528) (-941.926) * (-942.331) (-945.200) (-941.082) [-948.781] -- 0:00:01
969000 -- [-943.139] (-944.107) (-943.508) (-942.279) * (-942.768) (-943.037) [-942.892] (-945.366) -- 0:00:01
969500 -- [-942.104] (-943.291) (-942.436) (-945.998) * (-943.773) [-941.895] (-942.684) (-949.188) -- 0:00:01
970000 -- (-941.541) (-944.698) (-942.055) [-946.426] * (-944.196) (-941.588) [-942.798] (-943.800) -- 0:00:01
Average standard deviation of split frequencies: 0.004662
970500 -- (-941.154) (-944.215) (-946.410) [-941.853] * (-944.893) (-941.966) [-944.159] (-945.033) -- 0:00:01
971000 -- (-941.960) (-944.702) (-944.349) [-946.565] * (-945.165) (-942.974) (-943.367) [-943.316] -- 0:00:01
971500 -- (-942.277) (-943.275) (-944.784) [-943.954] * [-942.795] (-941.206) (-943.053) (-943.176) -- 0:00:01
972000 -- (-943.123) (-945.065) (-941.799) [-941.798] * (-941.270) (-941.159) (-942.667) [-943.306] -- 0:00:01
972500 -- (-943.156) (-943.796) (-942.569) [-942.464] * [-941.768] (-945.876) (-943.303) (-943.440) -- 0:00:01
973000 -- (-945.185) (-945.069) (-943.316) [-942.919] * (-943.775) (-946.725) (-944.279) [-944.956] -- 0:00:01
973500 -- [-942.363] (-944.112) (-941.940) (-946.230) * (-944.550) (-950.337) [-945.711] (-942.519) -- 0:00:01
974000 -- (-941.921) [-941.995] (-942.361) (-952.115) * (-942.558) (-943.373) [-943.005] (-941.753) -- 0:00:01
974500 -- (-942.678) (-941.327) [-942.151] (-949.819) * (-943.315) (-944.316) (-942.605) [-942.154] -- 0:00:01
975000 -- [-944.128] (-942.597) (-943.217) (-949.664) * (-942.374) (-947.936) [-944.408] (-944.154) -- 0:00:01
Average standard deviation of split frequencies: 0.004315
975500 -- [-946.043] (-943.535) (-941.401) (-947.469) * (-942.147) [-943.555] (-942.889) (-945.249) -- 0:00:01
976000 -- [-943.387] (-942.689) (-945.189) (-944.224) * (-946.595) (-942.407) [-949.184] (-943.921) -- 0:00:01
976500 -- (-943.177) [-941.818] (-943.605) (-946.335) * (-943.116) [-945.125] (-942.410) (-946.229) -- 0:00:01
977000 -- [-945.648] (-942.038) (-943.067) (-943.752) * (-943.520) (-948.944) [-943.982] (-942.964) -- 0:00:01
977500 -- [-949.237] (-944.210) (-942.168) (-945.626) * (-942.355) (-942.579) (-942.013) [-943.748] -- 0:00:01
978000 -- [-942.181] (-943.950) (-943.919) (-948.774) * [-942.654] (-944.340) (-948.160) (-943.528) -- 0:00:01
978500 -- (-941.536) (-941.633) (-946.603) [-944.279] * (-944.392) [-941.816] (-942.773) (-946.170) -- 0:00:01
979000 -- (-943.233) (-941.628) (-942.175) [-942.383] * (-941.966) (-944.372) [-944.134] (-951.496) -- 0:00:01
979500 -- [-946.529] (-946.303) (-942.963) (-942.509) * (-942.207) [-944.203] (-944.493) (-944.879) -- 0:00:01
980000 -- [-943.056] (-944.639) (-941.648) (-945.037) * [-943.253] (-944.413) (-945.556) (-943.143) -- 0:00:01
Average standard deviation of split frequencies: 0.004230
980500 -- (-941.852) (-944.176) [-942.339] (-943.749) * (-943.106) [-941.837] (-946.437) (-942.248) -- 0:00:01
981000 -- [-942.947] (-943.098) (-942.555) (-942.780) * (-944.017) [-941.781] (-945.217) (-942.060) -- 0:00:01
981500 -- (-944.029) (-944.292) (-941.572) [-942.395] * (-944.782) [-941.538] (-942.324) (-941.878) -- 0:00:01
982000 -- (-944.137) (-943.170) (-945.244) [-942.360] * (-942.065) [-942.475] (-943.717) (-942.313) -- 0:00:01
982500 -- (-942.161) [-943.310] (-942.700) (-942.002) * (-944.471) [-945.155] (-944.479) (-945.976) -- 0:00:01
983000 -- (-944.284) (-941.946) [-943.341] (-942.173) * [-944.509] (-945.064) (-948.689) (-941.699) -- 0:00:01
983500 -- (-942.881) (-944.792) [-941.218] (-942.635) * (-944.906) (-946.455) (-946.852) [-942.737] -- 0:00:01
984000 -- [-942.527] (-945.673) (-943.159) (-945.592) * (-944.056) (-947.615) (-947.343) [-942.627] -- 0:00:00
984500 -- (-942.561) (-942.157) (-943.388) [-943.258] * (-945.005) [-943.463] (-947.792) (-942.027) -- 0:00:00
985000 -- (-943.592) [-941.151] (-942.407) (-943.814) * (-943.304) [-943.169] (-944.378) (-943.646) -- 0:00:00
Average standard deviation of split frequencies: 0.004064
985500 -- (-942.500) (-942.193) [-946.973] (-946.711) * (-945.704) (-941.310) [-942.930] (-943.008) -- 0:00:00
986000 -- [-941.740] (-942.775) (-949.246) (-942.307) * (-945.691) (-941.312) (-943.788) [-943.768] -- 0:00:00
986500 -- (-945.042) (-943.346) (-943.960) [-941.486] * (-942.369) (-942.333) (-941.549) [-942.095] -- 0:00:00
987000 -- (-943.789) (-944.173) (-943.733) [-941.717] * (-943.050) (-944.061) [-941.807] (-941.377) -- 0:00:00
987500 -- (-942.966) [-944.009] (-943.988) (-944.290) * [-943.361] (-947.947) (-944.689) (-941.343) -- 0:00:00
988000 -- [-943.365] (-944.624) (-945.727) (-941.561) * (-944.363) (-950.937) [-944.435] (-941.921) -- 0:00:00
988500 -- (-941.805) (-945.351) [-942.067] (-942.806) * (-942.578) (-942.994) (-944.534) [-942.307] -- 0:00:00
989000 -- (-943.512) [-942.851] (-943.012) (-943.834) * (-942.653) (-945.184) [-941.418] (-949.663) -- 0:00:00
989500 -- (-943.218) (-946.365) (-944.072) [-944.416] * (-944.447) (-942.984) (-943.750) [-944.195] -- 0:00:00
990000 -- (-946.070) (-945.379) (-942.189) [-942.376] * [-943.363] (-943.883) (-943.450) (-942.936) -- 0:00:00
Average standard deviation of split frequencies: 0.004164
990500 -- [-943.503] (-944.113) (-945.433) (-941.939) * (-943.655) (-944.747) [-943.283] (-945.030) -- 0:00:00
991000 -- (-947.166) (-943.472) (-942.971) [-941.914] * (-941.650) (-945.848) (-945.204) [-943.442] -- 0:00:00
991500 -- (-943.786) (-945.338) [-943.445] (-944.838) * (-943.647) (-944.959) (-944.674) [-943.756] -- 0:00:00
992000 -- (-944.555) [-942.460] (-948.283) (-942.969) * (-946.085) (-950.575) [-942.543] (-943.665) -- 0:00:00
992500 -- (-941.884) [-942.474] (-942.816) (-942.365) * (-946.293) (-943.536) [-941.917] (-943.188) -- 0:00:00
993000 -- [-942.485] (-945.763) (-942.002) (-948.191) * (-947.506) (-942.871) [-942.969] (-942.536) -- 0:00:00
993500 -- (-944.415) [-942.336] (-941.925) (-946.223) * (-943.966) [-942.079] (-941.866) (-941.147) -- 0:00:00
994000 -- (-943.209) (-947.758) [-943.519] (-950.049) * (-948.728) (-946.590) (-941.825) [-942.454] -- 0:00:00
994500 -- (-942.487) (-944.153) (-942.282) [-943.655] * (-944.177) [-946.749] (-942.504) (-941.649) -- 0:00:00
995000 -- (-941.725) (-946.266) (-941.906) [-942.953] * (-943.747) [-941.896] (-943.896) (-942.555) -- 0:00:00
Average standard deviation of split frequencies: 0.004082
995500 -- (-943.765) (-943.174) (-941.561) [-943.058] * (-943.675) [-941.547] (-943.835) (-946.677) -- 0:00:00
996000 -- (-944.864) (-943.417) (-941.936) [-942.793] * (-945.696) (-941.977) (-944.224) [-942.060] -- 0:00:00
996500 -- [-942.679] (-945.229) (-943.219) (-944.977) * [-944.452] (-942.878) (-943.198) (-941.457) -- 0:00:00
997000 -- [-946.153] (-943.407) (-943.036) (-946.069) * [-943.346] (-943.666) (-945.013) (-944.152) -- 0:00:00
997500 -- (-943.165) (-946.865) [-941.826] (-944.712) * (-945.612) (-949.550) (-945.017) [-942.495] -- 0:00:00
998000 -- (-942.785) (-943.449) (-943.613) [-942.652] * [-946.402] (-945.278) (-946.418) (-942.006) -- 0:00:00
998500 -- (-945.936) (-943.453) (-946.417) [-943.632] * (-950.719) (-942.763) (-945.150) [-941.959] -- 0:00:00
999000 -- (-943.358) (-945.573) (-942.303) [-946.183] * (-943.641) (-947.094) [-943.322] (-946.057) -- 0:00:00
999500 -- (-942.575) [-942.504] (-942.949) (-948.947) * [-944.384] (-944.069) (-941.745) (-945.639) -- 0:00:00
1000000 -- (-942.168) (-941.598) [-942.029] (-943.378) * (-946.740) (-943.225) [-948.065] (-946.127) -- 0:00:00
Average standard deviation of split frequencies: 0.004365
Analysis completed in 1 mins 1 seconds
Analysis used 58.96 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -940.94
Likelihood of best state for "cold" chain of run 2 was -940.94
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 79 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.8 % ( 22 %) Dirichlet(Pi{all})
30.6 % ( 24 %) Slider(Pi{all})
78.9 % ( 54 %) Multiplier(Alpha{1,2})
77.8 % ( 46 %) Multiplier(Alpha{3})
20.2 % ( 27 %) Slider(Pinvar{all})
98.7 % ( 96 %) ExtSPR(Tau{all},V{all})
70.3 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.0 % ( 18 %) Dirichlet(Pi{all})
29.1 % ( 23 %) Slider(Pi{all})
78.9 % ( 51 %) Multiplier(Alpha{1,2})
77.8 % ( 54 %) Multiplier(Alpha{3})
21.0 % ( 25 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.3 % ( 21 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.3 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166911 0.82 0.67
3 | 166315 166019 0.84
4 | 167256 167308 166191
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167025 0.82 0.67
3 | 166012 166989 0.84
4 | 167489 166306 166179
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -942.68
| 2 |
| 2 2 |
| 1 2 |
| 2 2 1 2 |
| 1 2 12 2 2 1 2 2 1 1 1|
| 122 1 1 2 * 2 1 2 1 |
| 1 1 1 1 2 2 12 2 1 2 1 2 12 |
| 11 2 1 2 1 2 2 *2|
| 1 2 2 1 2 2 1 1 12 2 *21 2 1 2 |
|2 2 *21 12 1 111 1 2 |
| 2 2 2 2 *1 |
|1 2 2 *1 1 2 |
| 1 21 2 1 |
| 1 1 1 1 1 |
| 1 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -944.11
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -942.71 -945.54
2 -942.66 -946.98
--------------------------------------
TOTAL -942.69 -946.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887379 0.088647 0.373058 1.474527 0.857295 1441.05 1471.02 1.000
r(A<->C){all} 0.175748 0.021344 0.000018 0.473965 0.136436 177.21 232.09 1.001
r(A<->G){all} 0.156525 0.020323 0.000014 0.455880 0.114931 175.23 183.69 1.001
r(A<->T){all} 0.168693 0.019608 0.000107 0.456742 0.129109 241.27 273.49 1.000
r(C<->G){all} 0.153153 0.017252 0.000317 0.416298 0.115214 292.09 293.13 1.000
r(C<->T){all} 0.168390 0.021203 0.000095 0.469610 0.126774 126.89 183.37 1.001
r(G<->T){all} 0.177491 0.023232 0.000054 0.484169 0.138758 192.48 208.90 1.006
pi(A){all} 0.216106 0.000239 0.185664 0.245908 0.215912 1132.13 1166.68 1.000
pi(C){all} 0.312987 0.000330 0.280179 0.349543 0.312382 1130.87 1207.14 1.000
pi(G){all} 0.288316 0.000311 0.254201 0.321129 0.287620 1392.77 1446.88 1.000
pi(T){all} 0.182590 0.000210 0.152976 0.208320 0.182432 1274.27 1338.67 1.000
alpha{1,2} 0.417395 0.213806 0.000121 1.373769 0.244972 782.60 1001.93 1.000
alpha{3} 0.449296 0.246273 0.000171 1.442283 0.288622 1200.42 1258.92 1.000
pinvar{all} 0.997866 0.000006 0.992907 1.000000 0.998690 1201.41 1245.68 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .*.***
9 -- ..*..*
10 -- ...**.
11 -- .*..*.
12 -- ....**
13 -- .***.*
14 -- .*...*
15 -- .*.*..
16 -- .****.
17 -- .**.**
18 -- ..*.*.
19 -- ..****
20 -- .**...
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.002355 0.153231 0.156562 2
8 463 0.154231 0.001413 0.153231 0.155230 2
9 460 0.153231 0.004711 0.149900 0.156562 2
10 446 0.148568 0.000942 0.147901 0.149234 2
11 440 0.146569 0.001884 0.145237 0.147901 2
12 434 0.144570 0.004711 0.141239 0.147901 2
13 434 0.144570 0.003769 0.141905 0.147235 2
14 433 0.144237 0.000471 0.143904 0.144570 2
15 424 0.141239 0.000942 0.140573 0.141905 2
16 421 0.140240 0.006124 0.135909 0.144570 2
17 415 0.138241 0.004240 0.135243 0.141239 2
18 405 0.134910 0.001413 0.133911 0.135909 2
19 404 0.134577 0.016017 0.123251 0.145903 2
20 398 0.132578 0.011306 0.124584 0.140573 2
21 395 0.131579 0.005182 0.127915 0.135243 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100717 0.009853 0.000007 0.297732 0.069536 1.000 2
length{all}[2] 0.101029 0.010507 0.000007 0.306108 0.068980 1.000 2
length{all}[3] 0.100441 0.010813 0.000064 0.308633 0.068649 1.000 2
length{all}[4] 0.099710 0.009660 0.000001 0.292218 0.072149 1.000 2
length{all}[5] 0.096396 0.009442 0.000006 0.294751 0.066139 1.000 2
length{all}[6] 0.097871 0.009500 0.000010 0.302395 0.067874 1.000 2
length{all}[7] 0.098769 0.008979 0.000211 0.291006 0.071831 1.000 2
length{all}[8] 0.101640 0.010785 0.000040 0.305367 0.068342 0.998 2
length{all}[9] 0.094083 0.008619 0.000440 0.275737 0.067233 1.000 2
length{all}[10] 0.095428 0.008526 0.000601 0.277755 0.070743 1.000 2
length{all}[11] 0.094316 0.008161 0.000373 0.267289 0.062010 0.999 2
length{all}[12] 0.099432 0.010183 0.000288 0.291666 0.070091 0.998 2
length{all}[13] 0.096715 0.011130 0.000092 0.284822 0.063834 1.008 2
length{all}[14] 0.096138 0.009505 0.000024 0.268412 0.060202 0.999 2
length{all}[15] 0.087110 0.007699 0.000068 0.244106 0.061800 1.008 2
length{all}[16] 0.100760 0.011506 0.000094 0.306579 0.065514 1.002 2
length{all}[17] 0.103314 0.012423 0.000227 0.308013 0.073268 0.999 2
length{all}[18] 0.093423 0.009655 0.000180 0.300747 0.061599 0.999 2
length{all}[19] 0.101050 0.009072 0.000233 0.296664 0.070429 1.002 2
length{all}[20] 0.095741 0.011364 0.000183 0.319309 0.063748 1.002 2
length{all}[21] 0.102317 0.010282 0.000185 0.323926 0.075848 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004365
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 690
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 230 / 230 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 230 / 230 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046537 0.049689 0.075516 0.052063 0.025707 0.064193 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -982.941478
Iterating by ming2
Initial: fx= 982.941478
x= 0.04654 0.04969 0.07552 0.05206 0.02571 0.06419 0.30000 1.30000
1 h-m-p 0.0000 0.0001 552.7166 ++ 948.226641 m 0.0001 13 | 1/8
2 h-m-p 0.0011 0.0072 53.2916 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 506.3481 ++ 924.539888 m 0.0001 44 | 2/8
4 h-m-p 0.0011 0.0126 38.3144 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 454.3164 ++ 921.656884 m 0.0000 75 | 3/8
6 h-m-p 0.0002 0.0207 28.9471 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 393.4211 ++ 920.028348 m 0.0000 105 | 4/8
8 h-m-p 0.0002 0.0268 22.0392 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 321.0271 ++ 914.470673 m 0.0001 135 | 5/8
10 h-m-p 0.0008 0.0421 14.7009 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 227.2561 ++ 911.865702 m 0.0001 166 | 6/8
12 h-m-p 0.1578 8.0000 0.0000 +++ 911.865702 m 8.0000 178 | 6/8
13 h-m-p 0.4555 8.0000 0.0001 +++ 911.865702 m 8.0000 192 | 6/8
14 h-m-p 0.0011 0.5644 0.5863 ------Y 911.865702 0 0.0000 211 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 ------------C 911.865702 0 0.0000 236 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 ---------C 911.865702 0 0.0000 258
Out..
lnL = -911.865702
259 lfun, 259 eigenQcodon, 1554 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038275 0.017898 0.017731 0.056796 0.075958 0.078419 0.300521 0.727199 0.109320
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 15.432469
np = 9
lnL0 = -971.566681
Iterating by ming2
Initial: fx= 971.566681
x= 0.03827 0.01790 0.01773 0.05680 0.07596 0.07842 0.30052 0.72720 0.10932
1 h-m-p 0.0000 0.0001 480.4698 ++ 950.374729 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 286.6169 ++ 950.194364 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0001 335.1106 ++ 935.142358 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0002 454.3868 ++ 923.160281 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0000 12947.2267 ++ 921.509542 m 0.0000 62 | 5/9
6 h-m-p 0.0003 0.0076 22.4983 +++ 920.343642 m 0.0076 75 | 6/9
7 h-m-p 0.0002 0.0009 1008.7790 ++ 911.865692 m 0.0009 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ------C 911.865692 0 0.0001 105 | 7/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 911.865692 m 8.0000 122 | 7/9
10 h-m-p 0.0005 0.2408 0.5916 ------C 911.865692 0 0.0000 142 | 7/9
11 h-m-p 0.0160 8.0000 0.0002 -------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 911.865692 m 8.0000 184 | 7/9
13 h-m-p 0.0008 0.3098 0.4390 ----------C 911.865692 0 0.0000 208 | 7/9
14 h-m-p 0.0160 8.0000 0.0734 +++++ 911.865641 m 8.0000 225 | 7/9
15 h-m-p 0.1875 0.9373 0.7733 -------------Y 911.865641 0 0.0000 252 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
17 h-m-p 0.0160 8.0000 0.0002 +++++ 911.865641 m 8.0000 294 | 7/9
18 h-m-p 0.0046 2.3035 0.3048 --------Y 911.865641 0 0.0000 316 | 7/9
19 h-m-p 0.0160 8.0000 0.0403 +++++ 911.865523 m 8.0000 333 | 7/9
20 h-m-p 0.4825 2.4124 0.4185 ----------------.. | 7/9
21 h-m-p 0.0160 8.0000 0.0008 +++++ 911.865518 m 8.0000 378 | 7/9
22 h-m-p 0.0402 6.6135 0.1515 -----------Y 911.865518 0 0.0000 403 | 7/9
23 h-m-p 0.0160 8.0000 0.0013 +++++ 911.865512 m 8.0000 420 | 7/9
24 h-m-p 0.0562 2.6032 0.1803 --------------.. | 7/9
25 h-m-p 0.0160 8.0000 0.0008 +++++ 911.865506 m 8.0000 463 | 7/9
26 h-m-p 0.0464 7.0365 0.1443 -----------Y 911.865506 0 0.0000 488 | 7/9
27 h-m-p 0.0000 0.0123 0.6761 +++++ 911.865499 m 0.0123 505 | 8/9
28 h-m-p 0.0399 8.0000 0.0375 ---------Y 911.865499 0 0.0000 528 | 8/9
29 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/9
30 h-m-p 0.0160 8.0000 0.0002 +++++ 911.865499 m 8.0000 568 | 8/9
31 h-m-p 0.0160 8.0000 0.8821 ------------Y 911.865499 0 0.0000 593 | 8/9
32 h-m-p 0.0160 8.0000 1.8579 ------------C 911.865499 0 0.0000 618 | 8/9
33 h-m-p 0.0160 8.0000 0.0000 --------Y 911.865499 0 0.0000 638 | 8/9
34 h-m-p 0.0160 8.0000 0.0000 ---N 911.865499 0 0.0001 654
Out..
lnL = -911.865499
655 lfun, 1965 eigenQcodon, 7860 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059232 0.037456 0.049807 0.020438 0.023125 0.067314 0.244812 1.214608 0.374728 0.259632 1.332290
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.945451
np = 11
lnL0 = -967.731705
Iterating by ming2
Initial: fx= 967.731705
x= 0.05923 0.03746 0.04981 0.02044 0.02313 0.06731 0.24481 1.21461 0.37473 0.25963 1.33229
1 h-m-p 0.0000 0.0001 510.8917 ++ 941.798271 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0001 159.7149 ++ 938.736063 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0001 1122.9199 ++ 926.656187 m 0.0001 44 | 3/11
4 h-m-p 0.0000 0.0001 947.6505 ++ 918.238945 m 0.0001 58 | 4/11
5 h-m-p 0.0000 0.0000 16673.9993 ++ 913.786312 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 20965.4376 ++ 913.693874 m 0.0000 86 | 6/11
7 h-m-p 0.0003 0.1011 4.3981 ----------.. | 6/11
8 h-m-p 0.0000 0.0000 223.7983 ++ 911.865654 m 0.0000 122 | 7/11
9 h-m-p 0.0775 8.0000 0.0000 ++++ 911.865654 m 8.0000 138 | 7/11
10 h-m-p 0.0415 8.0000 0.0023 ++++ 911.865654 m 8.0000 158 | 7/11
11 h-m-p 0.0160 8.0000 2.6081 ---------C 911.865654 0 0.0000 185 | 7/11
12 h-m-p 0.0143 7.1537 0.0613 +++++ 911.865649 m 7.1537 202 | 8/11
13 h-m-p 0.0433 8.0000 5.6652 +C 911.865638 0 0.2536 221 | 8/11
14 h-m-p 1.6000 8.0000 0.0779 C 911.865638 0 0.5065 235 | 8/11
15 h-m-p 1.6000 8.0000 0.0001 ++ 911.865638 m 8.0000 252 | 8/11
16 h-m-p 0.0160 8.0000 0.1574 ++++Y 911.865637 0 2.5778 273 | 8/11
17 h-m-p 1.6000 8.0000 0.0674 ++ 911.865628 m 8.0000 290 | 8/11
18 h-m-p 0.0555 0.4699 9.7165 ++ 911.865587 m 0.4699 307 | 9/11
19 h-m-p 1.6000 8.0000 2.3038 ++ 911.865444 m 8.0000 321 | 9/11
20 h-m-p 1.6000 8.0000 0.0000 N 911.865444 0 1.6000 335
Out..
lnL = -911.865444
336 lfun, 1344 eigenQcodon, 6048 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -911.918366 S = -911.866515 -0.020041
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:04
did 20 / 52 patterns 0:04
did 30 / 52 patterns 0:04
did 40 / 52 patterns 0:04
did 50 / 52 patterns 0:04
did 52 / 52 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090478 0.049130 0.096016 0.057506 0.101533 0.034124 0.000100 0.652031 1.361949
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.753021
np = 9
lnL0 = -1001.923478
Iterating by ming2
Initial: fx= 1001.923478
x= 0.09048 0.04913 0.09602 0.05751 0.10153 0.03412 0.00011 0.65203 1.36195
1 h-m-p 0.0000 0.0000 484.1706 ++ 1001.595242 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0078 82.7831 +++++ 956.096177 m 0.0078 29 | 2/9
3 h-m-p 0.0000 0.0000 796.9807 ++ 955.842842 m 0.0000 41 | 3/9
4 h-m-p 0.0001 0.0054 23.1088 ++++ 931.352497 m 0.0054 55 | 4/9
5 h-m-p 0.0000 0.0001 61.7292 ++ 930.835741 m 0.0001 67 | 5/9
6 h-m-p 0.0000 0.0002 230.3678 ++ 922.722536 m 0.0002 79 | 6/9
7 h-m-p 0.0002 0.0016 151.5680 ++ 915.248297 m 0.0016 91 | 7/9
8 h-m-p 0.0005 0.0034 508.4408 -----------.. | 7/9
9 h-m-p 0.0000 0.0001 213.5930 ++ 911.865444 m 0.0001 124 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 N 911.865444 0 0.4000 136
Out..
lnL = -911.865444
137 lfun, 1507 eigenQcodon, 8220 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052662 0.016620 0.025112 0.077737 0.052796 0.060062 0.000100 0.900000 0.294509 1.660161 1.299684
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 20.912373
np = 11
lnL0 = -969.622919
Iterating by ming2
Initial: fx= 969.622919
x= 0.05266 0.01662 0.02511 0.07774 0.05280 0.06006 0.00011 0.90000 0.29451 1.66016 1.29968
1 h-m-p 0.0000 0.0000 455.9159 ++ 969.258576 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 195.1403 +++ 949.798717 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0001 432.6259 ++ 941.270662 m 0.0001 45 | 3/11
4 h-m-p 0.0003 0.0022 111.0078 ++ 926.611613 m 0.0022 59 | 4/11
5 h-m-p 0.0004 0.0022 43.1040 ++ 924.172703 m 0.0022 73 | 5/11
6 h-m-p 0.0000 0.0001 1920.2137 ++ 918.755710 m 0.0001 87 | 6/11
7 h-m-p 0.0001 0.0003 661.2353 ++ 914.633813 m 0.0003 101 | 7/11
8 h-m-p 0.0014 0.0068 16.3008 ++ 911.865594 m 0.0068 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0004 ++ 911.865594 m 8.0000 129 | 8/11
10 h-m-p 0.0008 0.3823 11.4630 -----------.. | 8/11
11 h-m-p 0.0160 8.0000 0.0005 +++++ 911.865592 m 8.0000 172 | 8/11
12 h-m-p 0.0222 4.9724 0.1701 -----------Y 911.865592 0 0.0000 200 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 911.865592 m 8.0000 220 | 8/11
14 h-m-p 0.0061 3.0315 1.1989 -----------Y 911.865592 0 0.0000 248 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 -----N 911.865592 0 0.0000 267 | 8/11
16 h-m-p 0.0031 1.5694 0.4450 ------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0005 +++++ 911.865590 m 8.0000 314 | 8/11
18 h-m-p 0.0230 5.0589 0.1679 -----------Y 911.865590 0 0.0000 342 | 8/11
19 h-m-p 0.0160 8.0000 0.0001 -----Y 911.865590 0 0.0000 364 | 8/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 911.865590 m 8.0000 384 | 8/11
21 h-m-p 0.0096 4.8201 0.2394 -----------N 911.865590 0 0.0000 412 | 8/11
22 h-m-p 0.0160 8.0000 0.0010 +++++ 911.865587 m 8.0000 432 | 8/11
23 h-m-p 0.0246 4.7175 0.3085 -----------Y 911.865587 0 0.0000 460 | 8/11
24 h-m-p 0.0160 8.0000 0.0002 -------C 911.865587 0 0.0000 484 | 8/11
25 h-m-p 0.0160 8.0000 0.0002 +++++ 911.865587 m 8.0000 504 | 8/11
26 h-m-p 0.0084 4.2163 0.9017 ------------C 911.865587 0 0.0000 533 | 8/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 911.865587 m 8.0000 553 | 8/11
28 h-m-p 0.0099 4.9579 0.2086 -----------N 911.865587 0 0.0000 581 | 8/11
29 h-m-p 0.0160 8.0000 0.0014 --------Y 911.865587 0 0.0000 606 | 8/11
30 h-m-p 0.0160 8.0000 0.0000 +++++ 911.865587 m 8.0000 626 | 8/11
31 h-m-p 0.0100 5.0145 0.2165 ----------Y 911.865587 0 0.0000 653 | 8/11
32 h-m-p 0.0160 8.0000 0.0000 +++++ 911.865587 m 8.0000 673 | 8/11
33 h-m-p 0.0100 5.0074 0.2189 ----------Y 911.865587 0 0.0000 700 | 8/11
34 h-m-p 0.0160 8.0000 0.0003 +++++ 911.865586 m 8.0000 720 | 8/11
35 h-m-p 0.0100 5.0169 0.2214 -------------.. | 8/11
36 h-m-p 0.0160 8.0000 0.0005 +++++ 911.865584 m 8.0000 768 | 8/11
37 h-m-p 0.0256 5.3028 0.1623 -----------Y 911.865584 0 0.0000 796 | 8/11
38 h-m-p 0.0160 8.0000 0.0041 +++++ 911.865566 m 8.0000 816 | 8/11
39 h-m-p 0.1724 5.1697 0.1898 -------------Y 911.865566 0 0.0000 846 | 8/11
40 h-m-p 0.0160 8.0000 0.0004 +++++ 911.865565 m 8.0000 866 | 8/11
41 h-m-p 0.0118 4.3563 0.2812 ------------N 911.865565 0 0.0000 895 | 8/11
42 h-m-p 0.0160 8.0000 0.0009 ---------N 911.865565 0 0.0000 921 | 8/11
43 h-m-p 0.0160 8.0000 0.0025 -------------.. | 8/11
44 h-m-p 0.0160 8.0000 0.0007 +++++ 911.865561 m 8.0000 969 | 8/11
45 h-m-p 0.0361 6.1855 0.1448 ------------C 911.865561 0 0.0000 998 | 8/11
46 h-m-p 0.0160 8.0000 0.0004 +++++ 911.865560 m 8.0000 1018 | 8/11
47 h-m-p 0.0130 2.7101 0.2425 ----------C 911.865560 0 0.0000 1045 | 8/11
48 h-m-p 0.0002 0.1153 1.9479 +++++ 911.865444 m 0.1153 1065 | 9/11
49 h-m-p 1.6000 8.0000 0.0002 --N 911.865444 0 0.0250 1081 | 9/11
50 h-m-p 1.6000 8.0000 0.0000 +Y 911.865444 0 4.0000 1098 | 9/11
51 h-m-p 0.0328 8.0000 0.0002 Y 911.865444 0 0.0328 1114 | 9/11
52 h-m-p 0.0167 8.0000 0.0004 ----Y 911.865444 0 0.0000 1134
Out..
lnL = -911.865444
1135 lfun, 13620 eigenQcodon, 74910 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -911.933905 S = -911.866515 -0.030006
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:24
did 20 / 52 patterns 0:24
did 30 / 52 patterns 0:24
did 40 / 52 patterns 0:25
did 50 / 52 patterns 0:25
did 52 / 52 patterns 0:25
Time used: 0:25
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=230
NC_011896_1_WP_010907910_1_792_MLBR_RS03730 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
NC_002677_1_NP_301586_1_458_ML0757 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM
**************************************************
NC_011896_1_WP_010907910_1_792_MLBR_RS03730 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
NC_002677_1_NP_301586_1_458_ML0757 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190 LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA
**************************************************
NC_011896_1_WP_010907910_1_792_MLBR_RS03730 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
NC_002677_1_NP_301586_1_458_ML0757 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190 FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL
**************************************************
NC_011896_1_WP_010907910_1_792_MLBR_RS03730 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
NC_002677_1_NP_301586_1_458_ML0757 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190 APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD
**************************************************
NC_011896_1_WP_010907910_1_792_MLBR_RS03730 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
NC_002677_1_NP_301586_1_458_ML0757 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190 PQSPLRIERFNTDMYHSYHARFQGLPPHAT
******************************
>NC_011896_1_WP_010907910_1_792_MLBR_RS03730 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC >NC_002677_1_NP_301586_1_458_ML0757 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC >NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC >NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC >NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC >NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190 TTGCAGCCGATGCCTGGGATCAACCTGCCCAAAGATGAGCTCACCGCTTT CGGCCGAAAATGGCTCTTCAGCTCGAAGTTTTCCAAGAAGGACGGGATGG ACTTTGGCACGTTGATCGACGTGGCTGTCGGGGGCGCACTGTCGGTGATG CTCGGAAACATCCCTATCGTGGTTCCCACCGCCAGCCAGTTGCAACCATC GCAGCCCGATTGTGTGGAAGTTGGTGCCGTGCGAATAGTCGGCGGCGTGC GCCCGCAGAACTTCGATGTGGGCTACCGGCCGGACGGTGCGCGCATCGCG TTTGACAGCAAGACGCTGAACGATCACGACAGCGTCGGGAAGAACTGGCA GAACATGATCAACGATTTGGCAACCGAGGCAACCACAGTCCACAGCCGGT TTCCCAGCGCTGTCGTAGGATTTGTGGTCGCCATCCCAACGCCGTGCCTA GCTCCAGGAGCACGAACGAATGCCATCATCGGGGCCTTGGCTCGGCTGGG TAACCGAGAACTTGTGGACGAGCCCGACCATCGAGCAGAAGCAATGAGTC TGGTCTCCTGGGATCCAGTAACCGGCCGAGTCGACTCCAACCTGCCCGAC CCGCAGAGCCCACTGCGGATCGAACGATTCAACACCGACATGTACCACTC GTACCACGCCCGATTCCAGGGCCTCCCACCTCATGCCACC
>NC_011896_1_WP_010907910_1_792_MLBR_RS03730 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD PQSPLRIERFNTDMYHSYHARFQGLPPHAT >NC_002677_1_NP_301586_1_458_ML0757 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD PQSPLRIERFNTDMYHSYHARFQGLPPHAT >NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD PQSPLRIERFNTDMYHSYHARFQGLPPHAT >NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD PQSPLRIERFNTDMYHSYHARFQGLPPHAT >NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD PQSPLRIERFNTDMYHSYHARFQGLPPHAT >NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190 LQPMPGINLPKDELTAFGRKWLFSSKFSKKDGMDFGTLIDVAVGGALSVM LGNIPIVVPTASQLQPSQPDCVEVGAVRIVGGVRPQNFDVGYRPDGARIA FDSKTLNDHDSVGKNWQNMINDLATEATTVHSRFPSAVVGFVVAIPTPCL APGARTNAIIGALARLGNRELVDEPDHRAEAMSLVSWDPVTGRVDSNLPD PQSPLRIERFNTDMYHSYHARFQGLPPHAT
#NEXUS
[ID: 0723475237]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907910_1_792_MLBR_RS03730
NC_002677_1_NP_301586_1_458_ML0757
NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885
NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825
NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135
NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907910_1_792_MLBR_RS03730,
2 NC_002677_1_NP_301586_1_458_ML0757,
3 NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885,
4 NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825,
5 NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135,
6 NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06953588,2:0.06898049,3:0.06864872,4:0.07214872,5:0.06613908,6:0.06787423);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06953588,2:0.06898049,3:0.06864872,4:0.07214872,5:0.06613908,6:0.06787423);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -942.71 -945.54
2 -942.66 -946.98
--------------------------------------
TOTAL -942.69 -946.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0757/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887379 0.088647 0.373058 1.474527 0.857295 1441.05 1471.02 1.000
r(A<->C){all} 0.175748 0.021344 0.000018 0.473965 0.136436 177.21 232.09 1.001
r(A<->G){all} 0.156525 0.020323 0.000014 0.455880 0.114931 175.23 183.69 1.001
r(A<->T){all} 0.168693 0.019608 0.000107 0.456742 0.129109 241.27 273.49 1.000
r(C<->G){all} 0.153153 0.017252 0.000317 0.416298 0.115214 292.09 293.13 1.000
r(C<->T){all} 0.168390 0.021203 0.000095 0.469610 0.126774 126.89 183.37 1.001
r(G<->T){all} 0.177491 0.023232 0.000054 0.484169 0.138758 192.48 208.90 1.006
pi(A){all} 0.216106 0.000239 0.185664 0.245908 0.215912 1132.13 1166.68 1.000
pi(C){all} 0.312987 0.000330 0.280179 0.349543 0.312382 1130.87 1207.14 1.000
pi(G){all} 0.288316 0.000311 0.254201 0.321129 0.287620 1392.77 1446.88 1.000
pi(T){all} 0.182590 0.000210 0.152976 0.208320 0.182432 1274.27 1338.67 1.000
alpha{1,2} 0.417395 0.213806 0.000121 1.373769 0.244972 782.60 1001.93 1.000
alpha{3} 0.449296 0.246273 0.000171 1.442283 0.288622 1200.42 1258.92 1.000
pinvar{all} 0.997866 0.000006 0.992907 1.000000 0.998690 1201.41 1245.68 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0757/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 230
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 5 5 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 5 5 5 5 5 5 | TCC 3 3 3 3 3 3 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 4 4 4 4 4 4 | CCC 6 6 6 6 6 6 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 6 6 6 6 6 6 | Gln CAA 1 1 1 1 1 1 | CGA 8 8 8 8 8 8
CTG 7 7 7 7 7 7 | CCG 5 5 5 5 5 5 | CAG 7 7 7 7 7 7 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 10 10 10 10 10 10 | ACC 7 7 7 7 7 7 | AAC 10 10 10 10 10 10 | AGC 7 7 7 7 7 7
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 4 4 4 4 4 4 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 6 6 6 6 6 6 | Gly GGT 3 3 3 3 3 3
GTC 8 8 8 8 8 8 | GCC 7 7 7 7 7 7 | GAC 11 11 11 11 11 11 | GGC 8 8 8 8 8 8
GTA 2 2 2 2 2 2 | GCA 6 6 6 6 6 6 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 9 9 9 9 9 9 | GCG 2 2 2 2 2 2 | GAG 3 3 3 3 3 3 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907910_1_792_MLBR_RS03730
position 1: T:0.13043 C:0.26522 A:0.23913 G:0.36522
position 2: T:0.28696 C:0.25652 A:0.25652 G:0.20000
position 3: T:0.13043 C:0.41739 A:0.15217 G:0.30000
Average T:0.18261 C:0.31304 A:0.21594 G:0.28841
#2: NC_002677_1_NP_301586_1_458_ML0757
position 1: T:0.13043 C:0.26522 A:0.23913 G:0.36522
position 2: T:0.28696 C:0.25652 A:0.25652 G:0.20000
position 3: T:0.13043 C:0.41739 A:0.15217 G:0.30000
Average T:0.18261 C:0.31304 A:0.21594 G:0.28841
#3: NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885
position 1: T:0.13043 C:0.26522 A:0.23913 G:0.36522
position 2: T:0.28696 C:0.25652 A:0.25652 G:0.20000
position 3: T:0.13043 C:0.41739 A:0.15217 G:0.30000
Average T:0.18261 C:0.31304 A:0.21594 G:0.28841
#4: NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825
position 1: T:0.13043 C:0.26522 A:0.23913 G:0.36522
position 2: T:0.28696 C:0.25652 A:0.25652 G:0.20000
position 3: T:0.13043 C:0.41739 A:0.15217 G:0.30000
Average T:0.18261 C:0.31304 A:0.21594 G:0.28841
#5: NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135
position 1: T:0.13043 C:0.26522 A:0.23913 G:0.36522
position 2: T:0.28696 C:0.25652 A:0.25652 G:0.20000
position 3: T:0.13043 C:0.41739 A:0.15217 G:0.30000
Average T:0.18261 C:0.31304 A:0.21594 G:0.28841
#6: NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190
position 1: T:0.13043 C:0.26522 A:0.23913 G:0.36522
position 2: T:0.28696 C:0.25652 A:0.25652 G:0.20000
position 3: T:0.13043 C:0.41739 A:0.15217 G:0.30000
Average T:0.18261 C:0.31304 A:0.21594 G:0.28841
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 30 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 6
TTC 30 | TCC 18 | TAC 18 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 24 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 0
CTC 24 | CCC 36 | CAC 24 | CGC 12
CTA 6 | CCA 36 | Gln Q CAA 6 | CGA 48
CTG 42 | CCG 30 | CAG 42 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 60 | ACC 42 | AAC 60 | AGC 42
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 36 | ACG 24 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 30 | Asp D GAT 36 | Gly G GGT 18
GTC 48 | GCC 42 | GAC 66 | GGC 48
GTA 12 | GCA 36 | Glu E GAA 24 | GGA 18
GTG 54 | GCG 12 | GAG 18 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13043 C:0.26522 A:0.23913 G:0.36522
position 2: T:0.28696 C:0.25652 A:0.25652 G:0.20000
position 3: T:0.13043 C:0.41739 A:0.15217 G:0.30000
Average T:0.18261 C:0.31304 A:0.21594 G:0.28841
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -911.865702 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300521 1.299684
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907910_1_792_MLBR_RS03730: 0.000004, NC_002677_1_NP_301586_1_458_ML0757: 0.000004, NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885: 0.000004, NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825: 0.000004, NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135: 0.000004, NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30052
omega (dN/dS) = 1.29968
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 543.5 146.5 1.2997 0.0000 0.0000 0.0 0.0
7..2 0.000 543.5 146.5 1.2997 0.0000 0.0000 0.0 0.0
7..3 0.000 543.5 146.5 1.2997 0.0000 0.0000 0.0 0.0
7..4 0.000 543.5 146.5 1.2997 0.0000 0.0000 0.0 0.0
7..5 0.000 543.5 146.5 1.2997 0.0000 0.0000 0.0 0.0
7..6 0.000 543.5 146.5 1.2997 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -911.865499 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.244812 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907910_1_792_MLBR_RS03730: 0.000004, NC_002677_1_NP_301586_1_458_ML0757: 0.000004, NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885: 0.000004, NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825: 0.000004, NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135: 0.000004, NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.24481
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 544.4 145.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 544.4 145.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 544.4 145.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 544.4 145.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 544.4 145.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 544.4 145.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -911.865444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907910_1_792_MLBR_RS03730: 0.000004, NC_002677_1_NP_301586_1_458_ML0757: 0.000004, NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885: 0.000004, NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825: 0.000004, NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135: 0.000004, NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907910_1_792_MLBR_RS03730)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -911.865444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.732465
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907910_1_792_MLBR_RS03730: 0.000004, NC_002677_1_NP_301586_1_458_ML0757: 0.000004, NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885: 0.000004, NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825: 0.000004, NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135: 0.000004, NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.73246
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -911.865444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.618774 1.675442
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907910_1_792_MLBR_RS03730: 0.000004, NC_002677_1_NP_301586_1_458_ML0757: 0.000004, NZ_LVXE01000001_1_WP_010907910_1_177_A3216_RS00885: 0.000004, NZ_LYPH01000001_1_WP_010907910_1_166_A8144_RS00825: 0.000004, NZ_CP029543_1_WP_010907910_1_813_DIJ64_RS04135: 0.000004, NZ_AP014567_1_WP_010907910_1_824_JK2ML_RS04190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.61877
(p1 = 0.00001) w = 1.67544
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.67544
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 548.8 141.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907910_1_792_MLBR_RS03730)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.102 0.100 0.099 0.098 0.097 0.096 0.095
Time used: 0:25
Model 1: NearlyNeutral -911.865499 Model 2: PositiveSelection -911.865444 Model 0: one-ratio -911.865702 Model 7: beta -911.865444 Model 8: beta&w>1 -911.865444 Model 0 vs 1 4.060000001118169E-4 Model 2 vs 1 1.0999999994965037E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
