--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:38:18 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0796/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -237.64 -241.52
2 -237.58 -242.57
--------------------------------------
TOTAL -237.61 -242.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889365 0.089527 0.371980 1.488276 0.855744 1346.00 1423.50 1.000
r(A<->C){all} 0.163272 0.017487 0.000178 0.424947 0.131666 214.40 230.91 1.000
r(A<->G){all} 0.162742 0.020441 0.000036 0.453449 0.122719 215.30 307.34 1.001
r(A<->T){all} 0.168292 0.019803 0.000008 0.452638 0.133621 227.91 232.39 1.001
r(C<->G){all} 0.169629 0.021630 0.000084 0.463604 0.128774 278.39 285.09 1.000
r(C<->T){all} 0.167002 0.020270 0.000004 0.458367 0.128547 173.87 206.15 1.001
r(G<->T){all} 0.169063 0.019363 0.000095 0.442165 0.133754 236.09 295.66 1.001
pi(A){all} 0.190062 0.000872 0.129423 0.243185 0.189803 1146.16 1186.54 1.000
pi(C){all} 0.331390 0.001274 0.268005 0.408101 0.330160 1005.91 1167.67 1.000
pi(G){all} 0.287011 0.001177 0.219680 0.352182 0.286376 1030.69 1150.20 1.000
pi(T){all} 0.191537 0.000892 0.133663 0.249243 0.190320 1277.78 1326.73 1.001
alpha{1,2} 0.410538 0.222613 0.000127 1.365882 0.250699 1289.13 1310.45 1.000
alpha{3} 0.447001 0.213666 0.000248 1.390457 0.295809 1333.60 1370.59 1.000
pinvar{all} 0.989763 0.000158 0.965762 0.999992 0.993820 1207.53 1245.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -228.43483
Model 2: PositiveSelection -228.434838
Model 0: one-ratio -228.434843
Model 7: beta -228.434822
Model 8: beta&w>1 -228.434817
Model 0 vs 1 2.599999999119973E-5
Model 2 vs 1 1.6000000016447302E-5
Model 8 vs 7 9.999999974752427E-6
>C1
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C2
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C3
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C4
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C5
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C6
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=58
C1 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C2 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C3 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C4 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C5 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C6 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
**************************************************
C1 VAFSTTRA
C2 VAFSTTRA
C3 VAFSTTRA
C4 VAFSTTRA
C5 VAFSTTRA
C6 VAFSTTRA
********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1740]--->[1740]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.442 Mb, Max= 30.575 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C2 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C3 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C4 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C5 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
C6 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
**************************************************
C1 VAFSTTRA
C2 VAFSTTRA
C3 VAFSTTRA
C4 VAFSTTRA
C5 VAFSTTRA
C6 VAFSTTRA
********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
C2 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
C3 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
C4 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
C5 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
C6 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
**************************************************
C1 TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
C2 TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
C3 TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
C4 TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
C5 TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
C6 TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
**************************************************
C1 TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
C2 TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
C3 TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
C4 TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
C5 TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
C6 TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
**************************************************
C1 GTCGCCTTTTCGACTACAAGAGCC
C2 GTCGCCTTTTCGACTACAAGAGCC
C3 GTCGCCTTTTCGACTACAAGAGCC
C4 GTCGCCTTTTCGACTACAAGAGCC
C5 GTCGCCTTTTCGACTACAAGAGCC
C6 GTCGCCTTTTCGACTACAAGAGCC
************************
>C1
ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
GTCGCCTTTTCGACTACAAGAGCC
>C2
ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
GTCGCCTTTTCGACTACAAGAGCC
>C3
ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
GTCGCCTTTTCGACTACAAGAGCC
>C4
ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
GTCGCCTTTTCGACTACAAGAGCC
>C5
ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
GTCGCCTTTTCGACTACAAGAGCC
>C6
ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT
TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG
TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG
GTCGCCTTTTCGACTACAAGAGCC
>C1
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C2
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C3
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C4
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C5
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
>C6
MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
VAFSTTRA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 174 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579797420
Setting output file names to "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1814317009
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0350163234
Seed = 63394278
Swapseed = 1579797420
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -389.420342 -- -24.965149
Chain 2 -- -389.420342 -- -24.965149
Chain 3 -- -389.420342 -- -24.965149
Chain 4 -- -389.420320 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -389.420342 -- -24.965149
Chain 2 -- -389.420342 -- -24.965149
Chain 3 -- -389.420320 -- -24.965149
Chain 4 -- -389.420283 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-389.420] (-389.420) (-389.420) (-389.420) * [-389.420] (-389.420) (-389.420) (-389.420)
500 -- (-245.060) [-251.058] (-245.936) (-248.911) * [-257.574] (-249.368) (-244.396) (-251.952) -- 0:00:00
1000 -- [-241.886] (-252.401) (-245.725) (-247.697) * (-249.093) (-247.307) (-252.038) [-250.641] -- 0:00:00
1500 -- (-244.098) (-252.654) [-245.308] (-250.560) * (-243.870) (-246.645) (-240.076) [-240.661] -- 0:00:00
2000 -- (-249.286) [-242.638] (-245.350) (-247.557) * (-249.335) (-242.083) [-253.717] (-245.387) -- 0:00:00
2500 -- [-243.205] (-247.660) (-249.544) (-244.243) * [-245.758] (-250.782) (-250.141) (-246.689) -- 0:00:00
3000 -- [-244.666] (-250.000) (-244.033) (-243.419) * (-247.174) (-247.095) [-245.715] (-254.571) -- 0:00:00
3500 -- (-243.416) (-250.570) (-252.987) [-246.233] * [-248.019] (-257.888) (-247.470) (-247.228) -- 0:00:00
4000 -- (-264.999) (-251.206) [-245.197] (-253.546) * (-244.244) (-247.952) [-244.482] (-254.305) -- 0:00:00
4500 -- [-245.016] (-247.629) (-254.548) (-250.649) * (-243.174) [-245.991] (-240.720) (-255.601) -- 0:00:00
5000 -- (-243.676) (-247.519) (-244.590) [-242.560] * [-246.028] (-251.599) (-249.415) (-251.423) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- (-243.854) (-247.314) (-243.444) [-247.958] * [-246.002] (-248.421) (-252.244) (-247.633) -- 0:00:00
6000 -- (-249.220) (-247.130) (-244.080) [-245.702] * (-252.464) (-252.003) (-244.637) [-247.397] -- 0:00:00
6500 -- [-256.548] (-250.731) (-243.660) (-250.798) * [-248.100] (-242.697) (-246.626) (-243.571) -- 0:00:00
7000 -- (-248.691) [-244.425] (-241.611) (-246.000) * (-241.572) (-246.489) [-253.651] (-241.590) -- 0:00:00
7500 -- (-250.135) [-243.026] (-244.076) (-261.768) * (-249.187) [-245.439] (-257.813) (-241.966) -- 0:00:00
8000 -- [-242.574] (-250.950) (-245.909) (-246.664) * (-251.293) (-244.317) (-249.744) [-241.886] -- 0:00:00
8500 -- (-248.063) (-260.234) (-245.799) [-236.460] * (-251.725) (-245.554) [-247.548] (-241.166) -- 0:01:56
9000 -- (-248.689) [-249.391] (-258.775) (-237.004) * (-252.679) [-248.918] (-247.867) (-238.557) -- 0:01:50
9500 -- [-252.057] (-254.267) (-244.183) (-240.165) * (-251.871) [-246.266] (-257.135) (-238.664) -- 0:01:44
10000 -- (-245.828) (-246.290) (-253.795) [-238.574] * (-246.294) (-253.298) [-254.273] (-240.849) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- (-247.976) [-237.604] (-256.612) (-241.846) * (-245.469) (-257.338) (-249.344) [-242.176] -- 0:01:34
11000 -- (-248.533) [-239.713] (-259.384) (-238.226) * [-250.775] (-247.566) (-250.394) (-239.043) -- 0:01:29
11500 -- (-245.736) (-238.637) (-255.192) [-238.211] * [-250.923] (-240.953) (-247.857) (-236.753) -- 0:01:25
12000 -- (-261.951) [-238.911] (-247.990) (-238.047) * (-244.063) [-239.861] (-241.321) (-237.092) -- 0:01:22
12500 -- (-252.501) (-236.848) [-245.534] (-236.918) * (-244.786) (-240.873) [-245.556] (-236.222) -- 0:01:19
13000 -- (-252.806) (-239.971) (-248.358) [-237.528] * (-241.590) [-237.278] (-240.811) (-236.573) -- 0:01:15
13500 -- [-251.636] (-237.258) (-239.799) (-237.806) * [-249.749] (-239.307) (-235.852) (-239.932) -- 0:01:13
14000 -- (-253.231) (-242.376) (-237.056) [-236.958] * [-256.152] (-239.997) (-237.935) (-240.630) -- 0:01:10
14500 -- (-253.859) (-239.618) (-237.532) [-240.204] * (-252.520) (-238.546) (-237.949) [-238.654] -- 0:01:07
15000 -- (-242.566) (-236.462) [-236.916] (-242.608) * (-251.816) (-238.758) [-236.338] (-237.497) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-236.792) [-237.535] (-237.450) (-238.508) * (-247.221) (-239.032) (-238.142) [-240.764] -- 0:01:03
16000 -- [-236.149] (-240.107) (-237.725) (-237.753) * (-245.141) (-238.628) [-238.971] (-236.548) -- 0:01:01
16500 -- (-238.439) (-240.505) [-242.084] (-237.060) * (-246.461) (-236.382) [-236.613] (-239.034) -- 0:00:59
17000 -- (-237.621) [-241.696] (-239.680) (-241.085) * (-255.030) [-238.477] (-236.631) (-237.261) -- 0:00:57
17500 -- (-239.402) [-238.813] (-237.846) (-236.874) * [-249.686] (-238.917) (-237.290) (-236.617) -- 0:00:56
18000 -- (-239.363) (-241.388) [-237.240] (-237.309) * (-242.976) (-237.097) (-239.130) [-236.847] -- 0:00:54
18500 -- (-240.436) [-238.516] (-238.560) (-237.083) * (-242.101) [-238.420] (-237.296) (-237.013) -- 0:00:53
19000 -- (-244.678) (-236.723) (-238.859) [-238.516] * (-243.647) (-236.310) (-240.202) [-239.572] -- 0:00:51
19500 -- (-237.800) (-236.578) (-240.329) [-237.442] * (-251.373) [-239.082] (-241.733) (-238.323) -- 0:00:50
20000 -- (-238.851) [-236.584] (-239.079) (-238.174) * (-245.760) (-236.484) [-238.866] (-237.702) -- 0:00:49
Average standard deviation of split frequencies: 0.049645
20500 -- (-237.214) (-236.909) [-238.339] (-238.598) * (-252.536) (-237.052) [-237.361] (-238.434) -- 0:00:47
21000 -- (-238.405) [-237.090] (-238.601) (-239.001) * (-258.626) (-237.205) (-237.726) [-240.154] -- 0:00:46
21500 -- (-241.810) (-237.518) (-238.741) [-236.500] * (-258.775) (-237.314) [-238.830] (-242.723) -- 0:00:45
22000 -- (-237.810) [-237.212] (-237.615) (-238.417) * (-249.145) [-237.567] (-239.211) (-240.535) -- 0:00:44
22500 -- (-238.275) (-238.558) [-237.242] (-240.353) * (-241.778) (-237.466) [-239.718] (-238.869) -- 0:00:43
23000 -- [-237.863] (-237.328) (-236.493) (-240.178) * [-236.572] (-241.902) (-237.958) (-240.474) -- 0:00:42
23500 -- (-237.803) [-237.928] (-239.182) (-236.663) * (-236.415) [-239.109] (-237.773) (-238.004) -- 0:00:41
24000 -- (-239.753) (-242.319) [-237.391] (-237.502) * (-237.585) (-238.895) [-237.409] (-237.962) -- 0:00:40
24500 -- (-238.589) [-240.474] (-237.146) (-236.640) * [-237.093] (-238.017) (-239.853) (-237.726) -- 0:00:39
25000 -- (-237.542) (-239.263) (-237.328) [-236.758] * (-236.924) [-238.586] (-237.610) (-238.260) -- 0:00:39
Average standard deviation of split frequencies: 0.032808
25500 -- (-236.100) (-237.481) (-236.898) [-238.391] * [-236.488] (-238.289) (-238.008) (-238.373) -- 0:00:38
26000 -- (-237.913) [-238.729] (-239.245) (-238.290) * (-238.162) [-238.682] (-238.831) (-236.462) -- 0:01:14
26500 -- [-236.364] (-238.846) (-242.593) (-236.759) * (-239.257) (-237.704) [-238.014] (-238.031) -- 0:01:13
27000 -- (-238.460) (-239.387) [-236.855] (-238.787) * (-237.973) [-237.130] (-238.514) (-236.807) -- 0:01:12
27500 -- (-239.339) (-239.572) [-237.090] (-240.570) * (-237.319) (-239.620) [-236.728] (-237.462) -- 0:01:10
28000 -- (-238.002) [-238.907] (-239.372) (-239.049) * [-236.214] (-239.907) (-236.927) (-241.613) -- 0:01:09
28500 -- (-237.156) [-236.388] (-236.802) (-236.053) * (-239.497) (-240.089) [-237.160] (-239.784) -- 0:01:08
29000 -- (-236.276) (-238.738) (-236.956) [-237.662] * (-240.920) (-236.538) (-241.931) [-236.949] -- 0:01:06
29500 -- (-238.396) (-240.699) (-236.554) [-238.035] * [-237.329] (-238.079) (-243.675) (-240.972) -- 0:01:05
30000 -- (-238.825) (-236.896) [-236.861] (-239.620) * (-240.189) (-237.828) [-242.362] (-238.315) -- 0:01:04
Average standard deviation of split frequencies: 0.036124
30500 -- [-236.219] (-241.892) (-236.352) (-243.737) * (-241.712) (-239.040) [-241.858] (-237.813) -- 0:01:03
31000 -- (-236.285) [-238.744] (-239.601) (-244.122) * (-239.999) (-238.561) (-241.541) [-237.902] -- 0:01:02
31500 -- (-237.441) [-236.999] (-236.696) (-240.380) * (-241.983) [-238.099] (-242.241) (-242.881) -- 0:01:01
32000 -- [-236.826] (-238.070) (-238.134) (-237.329) * (-237.909) (-236.995) (-240.415) [-240.692] -- 0:01:00
32500 -- (-236.395) [-237.478] (-236.832) (-237.522) * (-239.849) (-237.220) [-237.686] (-241.059) -- 0:00:59
33000 -- (-239.001) (-238.958) (-240.794) [-237.293] * (-239.990) (-239.030) [-238.087] (-240.604) -- 0:00:58
33500 -- (-238.948) (-237.660) (-237.296) [-238.675] * [-237.254] (-236.873) (-238.862) (-239.108) -- 0:00:57
34000 -- (-238.655) (-237.719) [-237.109] (-237.127) * (-237.595) (-237.249) [-237.500] (-237.100) -- 0:00:56
34500 -- (-237.939) (-236.900) (-243.556) [-236.618] * (-237.085) (-243.534) [-236.676] (-236.365) -- 0:00:55
35000 -- (-241.109) (-236.455) [-237.471] (-241.723) * (-236.188) [-236.246] (-237.711) (-238.553) -- 0:00:55
Average standard deviation of split frequencies: 0.036166
35500 -- (-239.961) (-238.625) [-238.606] (-236.636) * (-238.021) (-240.619) (-240.242) [-236.176] -- 0:00:54
36000 -- (-237.238) (-238.890) [-239.077] (-238.098) * (-237.224) (-238.673) (-237.502) [-237.413] -- 0:00:53
36500 -- [-238.887] (-237.909) (-237.427) (-237.499) * (-237.798) (-237.734) (-237.999) [-241.353] -- 0:00:52
37000 -- (-239.329) (-236.419) (-240.718) [-236.328] * (-237.023) (-241.688) [-236.764] (-239.058) -- 0:00:52
37500 -- (-238.067) (-239.996) (-241.647) [-237.077] * (-242.362) (-249.957) (-237.358) [-236.585] -- 0:00:51
38000 -- (-239.580) (-240.307) [-239.283] (-238.024) * (-237.833) (-246.349) [-239.219] (-240.051) -- 0:00:50
38500 -- (-238.142) [-239.792] (-239.096) (-237.605) * (-236.703) (-237.890) [-236.981] (-245.328) -- 0:00:49
39000 -- (-237.443) (-237.306) [-238.106] (-237.539) * [-238.065] (-239.551) (-237.187) (-239.585) -- 0:00:49
39500 -- (-243.534) (-241.206) [-238.789] (-237.572) * (-238.093) (-238.403) [-236.625] (-238.710) -- 0:00:48
40000 -- (-239.216) [-237.016] (-239.866) (-239.649) * (-237.422) (-237.243) [-241.946] (-240.074) -- 0:00:48
Average standard deviation of split frequencies: 0.034776
40500 -- (-236.134) [-236.599] (-238.262) (-238.394) * (-239.178) [-236.616] (-237.400) (-238.959) -- 0:00:47
41000 -- (-238.030) (-237.751) [-237.206] (-242.800) * (-240.809) (-236.489) [-236.295] (-242.747) -- 0:00:46
41500 -- (-239.335) [-237.754] (-238.272) (-238.613) * (-236.800) (-240.148) (-237.514) [-237.008] -- 0:00:46
42000 -- (-237.257) [-237.716] (-239.594) (-237.297) * (-239.882) [-236.875] (-239.772) (-239.753) -- 0:00:45
42500 -- [-237.386] (-236.874) (-237.252) (-239.309) * (-241.059) (-242.000) [-238.233] (-239.567) -- 0:00:45
43000 -- [-239.839] (-241.548) (-238.805) (-237.973) * (-242.250) (-238.226) (-239.736) [-238.242] -- 0:01:06
43500 -- (-240.174) [-239.309] (-239.821) (-238.249) * (-236.406) [-237.858] (-238.903) (-241.820) -- 0:01:05
44000 -- (-237.520) (-239.774) [-237.402] (-236.373) * (-238.823) [-237.330] (-237.258) (-237.903) -- 0:01:05
44500 -- (-239.823) (-239.840) [-237.925] (-239.426) * (-237.965) (-238.564) (-239.254) [-236.109] -- 0:01:04
45000 -- (-236.708) [-238.997] (-240.009) (-239.673) * (-238.278) (-239.357) (-236.914) [-238.294] -- 0:01:03
Average standard deviation of split frequencies: 0.025107
45500 -- (-240.608) (-236.373) [-238.860] (-239.452) * (-239.142) [-238.429] (-237.495) (-242.060) -- 0:01:02
46000 -- (-238.765) (-237.632) (-238.152) [-238.902] * [-238.414] (-239.593) (-241.833) (-241.264) -- 0:01:02
46500 -- [-240.359] (-236.024) (-238.604) (-238.282) * (-241.162) (-244.067) [-238.116] (-238.336) -- 0:01:01
47000 -- (-240.085) (-236.814) [-237.655] (-238.602) * (-237.842) (-236.903) (-236.965) [-247.684] -- 0:01:00
47500 -- (-237.246) [-237.580] (-236.010) (-239.497) * (-237.970) (-240.409) [-238.118] (-239.534) -- 0:01:00
48000 -- (-238.128) [-236.983] (-238.299) (-240.372) * (-238.997) (-238.996) (-237.231) [-239.456] -- 0:00:59
48500 -- [-238.595] (-240.607) (-238.459) (-239.889) * [-239.115] (-239.693) (-237.122) (-237.954) -- 0:00:58
49000 -- (-239.177) (-237.525) [-239.524] (-238.768) * [-245.356] (-239.157) (-237.104) (-238.442) -- 0:00:58
49500 -- [-237.609] (-237.513) (-238.698) (-237.702) * (-241.239) (-242.626) (-237.512) [-239.284] -- 0:00:57
50000 -- (-239.908) (-237.143) (-237.619) [-236.517] * (-238.356) [-238.238] (-236.612) (-236.971) -- 0:00:57
Average standard deviation of split frequencies: 0.028355
50500 -- (-238.355) [-238.088] (-237.402) (-238.565) * (-239.652) (-240.884) [-243.731] (-242.353) -- 0:00:56
51000 -- [-237.809] (-236.902) (-237.556) (-242.360) * (-238.100) (-240.500) (-240.107) [-240.619] -- 0:00:55
51500 -- (-236.488) (-239.651) (-236.306) [-242.929] * (-237.531) [-238.107] (-244.701) (-239.105) -- 0:00:55
52000 -- [-237.728] (-236.107) (-237.727) (-236.893) * [-239.081] (-239.389) (-238.938) (-238.226) -- 0:00:54
52500 -- [-237.084] (-237.144) (-238.006) (-238.436) * (-237.880) (-238.613) [-238.251] (-240.743) -- 0:00:54
53000 -- (-239.021) [-237.356] (-236.980) (-238.603) * [-238.548] (-240.179) (-236.403) (-238.775) -- 0:00:53
53500 -- (-239.546) (-237.660) (-237.134) [-237.629] * (-237.259) (-238.964) (-244.392) [-238.284] -- 0:00:53
54000 -- (-238.120) [-236.658] (-236.773) (-237.571) * [-237.252] (-239.104) (-239.495) (-237.068) -- 0:00:52
54500 -- (-238.894) (-238.941) [-236.465] (-237.246) * (-239.667) (-239.669) (-238.239) [-238.196] -- 0:00:52
55000 -- [-237.334] (-237.053) (-236.173) (-236.986) * (-239.058) (-239.542) (-241.248) [-238.751] -- 0:00:51
Average standard deviation of split frequencies: 0.028621
55500 -- (-237.753) (-241.701) [-238.135] (-238.482) * (-237.158) [-237.024] (-237.889) (-237.441) -- 0:00:51
56000 -- [-239.226] (-238.269) (-239.078) (-239.354) * (-238.423) [-236.968] (-239.748) (-237.251) -- 0:00:50
56500 -- [-242.106] (-237.170) (-237.246) (-236.122) * (-242.749) (-236.818) (-240.771) [-236.857] -- 0:00:50
57000 -- (-238.111) (-241.702) [-237.750] (-238.333) * (-239.182) (-237.877) (-244.198) [-236.458] -- 0:00:49
57500 -- (-238.568) (-241.089) [-236.772] (-238.273) * [-238.695] (-236.679) (-237.484) (-240.700) -- 0:00:49
58000 -- (-238.375) (-239.968) (-239.218) [-237.683] * (-239.490) (-236.290) (-236.730) [-240.382] -- 0:00:48
58500 -- [-236.780] (-236.698) (-237.668) (-238.957) * (-240.618) (-239.010) [-237.031] (-237.311) -- 0:00:48
59000 -- (-236.323) (-239.995) (-240.415) [-237.752] * (-236.947) [-239.121] (-237.803) (-238.690) -- 0:00:47
59500 -- [-238.623] (-241.127) (-239.777) (-238.077) * (-238.096) [-236.812] (-236.775) (-237.877) -- 0:00:47
60000 -- (-237.547) (-239.378) [-237.755] (-238.447) * (-239.706) (-236.248) [-238.920] (-239.609) -- 0:01:02
Average standard deviation of split frequencies: 0.035580
60500 -- [-239.909] (-237.919) (-241.108) (-239.292) * (-237.820) (-237.120) [-239.100] (-242.370) -- 0:01:02
61000 -- (-237.451) (-238.425) (-239.673) [-236.667] * [-238.216] (-239.882) (-236.759) (-236.633) -- 0:01:01
61500 -- (-239.562) [-237.844] (-237.605) (-238.748) * [-238.745] (-239.180) (-238.522) (-240.361) -- 0:01:01
62000 -- (-239.806) (-238.758) (-240.870) [-239.226] * (-238.244) (-241.497) (-238.934) [-236.351] -- 0:01:00
62500 -- [-237.447] (-238.361) (-238.593) (-240.954) * (-236.728) (-237.938) [-237.179] (-237.257) -- 0:01:00
63000 -- [-239.790] (-241.347) (-237.324) (-242.311) * (-236.866) (-237.192) (-239.372) [-238.004] -- 0:00:59
63500 -- (-239.126) [-236.960] (-237.941) (-239.376) * [-238.842] (-236.815) (-238.848) (-237.704) -- 0:00:58
64000 -- (-237.064) [-239.539] (-239.654) (-239.341) * (-237.735) (-238.081) (-241.757) [-237.712] -- 0:00:58
64500 -- [-237.137] (-237.069) (-239.270) (-236.463) * [-238.982] (-238.648) (-236.692) (-236.965) -- 0:00:58
65000 -- (-239.813) (-240.038) [-240.512] (-241.890) * (-237.812) (-239.104) (-236.553) [-236.276] -- 0:00:57
Average standard deviation of split frequencies: 0.028230
65500 -- (-238.613) (-242.153) [-239.242] (-243.583) * (-239.257) (-241.345) [-237.680] (-238.978) -- 0:00:57
66000 -- (-239.445) (-240.611) [-238.390] (-240.988) * (-240.273) [-240.149] (-242.308) (-236.072) -- 0:00:56
66500 -- (-236.884) (-236.433) (-238.599) [-240.046] * (-238.372) (-237.757) (-243.022) [-239.627] -- 0:00:56
67000 -- (-236.997) [-238.142] (-237.554) (-241.187) * (-239.328) [-237.726] (-239.491) (-240.822) -- 0:00:55
67500 -- (-242.080) [-239.751] (-241.846) (-238.117) * (-238.387) (-236.642) (-238.492) [-236.275] -- 0:00:55
68000 -- [-241.387] (-239.368) (-239.647) (-238.333) * (-238.522) (-236.720) [-238.422] (-238.441) -- 0:00:54
68500 -- (-236.300) (-236.910) (-238.865) [-237.751] * (-237.566) [-236.950] (-240.592) (-240.567) -- 0:00:54
69000 -- (-237.203) (-239.665) (-239.293) [-237.853] * (-240.485) (-237.611) [-237.775] (-238.307) -- 0:00:53
69500 -- (-238.793) (-237.003) [-239.003] (-240.395) * (-241.160) (-238.252) [-236.568] (-236.376) -- 0:00:53
70000 -- (-236.580) [-236.721] (-237.656) (-239.182) * (-238.024) (-238.589) (-236.112) [-237.713] -- 0:00:53
Average standard deviation of split frequencies: 0.028017
70500 -- [-239.714] (-241.814) (-237.947) (-238.934) * (-237.039) (-236.259) (-236.007) [-237.016] -- 0:00:52
71000 -- (-242.337) (-240.371) [-238.610] (-239.723) * (-239.591) (-241.595) (-237.652) [-238.711] -- 0:00:52
71500 -- (-237.106) (-246.558) (-237.087) [-240.942] * (-246.100) (-238.251) [-237.179] (-236.516) -- 0:00:51
72000 -- (-238.328) (-241.432) [-236.776] (-238.073) * (-239.475) (-237.953) (-238.227) [-236.666] -- 0:00:51
72500 -- (-239.384) (-244.303) [-237.172] (-237.917) * [-239.095] (-237.352) (-237.940) (-239.921) -- 0:00:51
73000 -- [-238.542] (-242.140) (-237.976) (-238.355) * (-237.898) (-236.328) [-242.035] (-239.316) -- 0:00:50
73500 -- (-238.942) [-239.493] (-239.756) (-238.784) * (-237.582) (-236.607) [-238.526] (-237.535) -- 0:00:50
74000 -- (-236.945) (-241.390) [-236.646] (-239.717) * [-240.870] (-238.441) (-239.037) (-237.195) -- 0:00:50
74500 -- [-237.706] (-239.898) (-238.311) (-238.409) * [-239.810] (-241.772) (-239.385) (-237.543) -- 0:00:49
75000 -- (-238.772) (-238.203) (-239.701) [-237.592] * [-237.081] (-236.529) (-240.546) (-241.536) -- 0:00:49
Average standard deviation of split frequencies: 0.024811
75500 -- (-238.064) (-239.945) [-237.975] (-238.264) * [-240.052] (-240.193) (-238.282) (-241.094) -- 0:00:48
76000 -- (-238.038) [-238.883] (-239.583) (-238.612) * (-236.811) (-240.276) (-237.184) [-237.206] -- 0:00:48
76500 -- (-239.694) (-242.827) [-236.788] (-237.041) * [-239.517] (-238.383) (-236.978) (-240.221) -- 0:00:48
77000 -- (-237.342) (-242.072) [-237.392] (-236.901) * (-238.027) [-240.289] (-238.285) (-241.332) -- 0:00:59
77500 -- (-239.016) (-240.990) (-241.814) [-238.315] * (-239.805) (-240.674) [-239.646] (-241.232) -- 0:00:59
78000 -- (-238.895) (-239.308) (-243.385) [-236.905] * [-240.119] (-240.865) (-236.976) (-245.754) -- 0:00:59
78500 -- (-237.805) (-236.207) (-240.211) [-238.123] * (-236.636) (-240.080) [-236.630] (-238.308) -- 0:00:58
79000 -- (-239.301) (-238.608) [-237.583] (-238.294) * [-237.893] (-239.600) (-237.070) (-237.901) -- 0:00:58
79500 -- (-239.338) [-240.119] (-237.565) (-237.849) * [-237.972] (-237.740) (-237.297) (-237.118) -- 0:00:57
80000 -- (-237.086) (-241.666) [-237.390] (-239.486) * [-236.721] (-240.438) (-236.980) (-237.478) -- 0:00:57
Average standard deviation of split frequencies: 0.023683
80500 -- (-239.187) (-237.469) [-239.221] (-238.857) * (-237.435) (-239.397) [-236.294] (-238.469) -- 0:00:57
81000 -- (-240.843) (-238.607) [-240.360] (-237.937) * (-236.172) [-236.536] (-237.961) (-238.071) -- 0:00:56
81500 -- (-241.232) [-237.076] (-240.177) (-238.240) * [-237.250] (-239.203) (-239.533) (-237.745) -- 0:00:56
82000 -- (-244.106) (-236.501) [-237.465] (-240.655) * (-236.912) [-237.926] (-238.113) (-236.675) -- 0:00:55
82500 -- [-239.769] (-240.350) (-240.297) (-237.827) * (-236.990) (-238.783) [-239.228] (-237.354) -- 0:00:55
83000 -- (-238.363) (-239.245) [-237.842] (-238.248) * (-236.824) (-239.876) [-237.068] (-242.295) -- 0:00:55
83500 -- (-240.224) (-237.124) [-237.527] (-239.328) * [-236.448] (-241.210) (-236.594) (-238.354) -- 0:00:54
84000 -- [-237.309] (-238.938) (-236.880) (-239.925) * (-240.637) [-236.258] (-237.056) (-240.315) -- 0:00:54
84500 -- [-240.281] (-237.598) (-238.204) (-237.080) * (-240.133) (-236.753) [-238.167] (-238.182) -- 0:00:54
85000 -- (-240.382) [-236.480] (-236.705) (-240.648) * (-240.612) (-238.124) (-238.086) [-237.892] -- 0:00:53
Average standard deviation of split frequencies: 0.026363
85500 -- (-238.673) [-237.893] (-236.954) (-236.150) * (-242.564) (-236.794) (-241.213) [-239.401] -- 0:00:53
86000 -- [-237.462] (-237.244) (-240.627) (-238.175) * (-238.265) [-237.302] (-239.037) (-239.128) -- 0:00:53
86500 -- (-236.892) (-237.173) (-236.806) [-239.150] * (-239.133) [-242.651] (-244.411) (-240.071) -- 0:00:52
87000 -- [-237.803] (-237.379) (-237.228) (-238.310) * [-237.507] (-237.452) (-237.727) (-239.563) -- 0:00:52
87500 -- [-237.871] (-240.448) (-239.907) (-240.284) * (-238.547) [-239.323] (-237.483) (-240.261) -- 0:00:52
88000 -- (-238.818) [-237.618] (-240.213) (-239.696) * (-243.015) (-243.721) (-236.742) [-239.376] -- 0:00:51
88500 -- [-241.340] (-239.875) (-240.234) (-236.587) * [-238.850] (-239.622) (-239.884) (-242.454) -- 0:00:51
89000 -- (-238.993) (-237.461) (-239.587) [-237.957] * (-240.741) [-237.449] (-236.555) (-237.802) -- 0:00:51
89500 -- (-239.285) [-236.457] (-237.147) (-237.200) * (-237.397) [-237.396] (-236.941) (-240.291) -- 0:00:50
90000 -- (-243.585) (-236.699) [-237.640] (-239.131) * (-237.572) [-237.596] (-240.315) (-238.262) -- 0:00:50
Average standard deviation of split frequencies: 0.025477
90500 -- (-237.731) [-236.604] (-237.846) (-238.000) * [-239.173] (-239.047) (-244.198) (-240.861) -- 0:00:50
91000 -- (-236.648) (-238.915) [-237.861] (-238.054) * (-240.176) (-240.072) (-237.603) [-236.913] -- 0:00:49
91500 -- [-236.568] (-238.118) (-241.685) (-237.801) * (-237.007) (-239.352) (-237.791) [-238.811] -- 0:00:49
92000 -- (-237.650) [-236.664] (-239.858) (-237.204) * (-236.703) (-237.399) [-236.969] (-238.578) -- 0:00:49
92500 -- (-239.067) [-237.977] (-239.227) (-243.484) * (-238.961) (-239.788) (-237.801) [-237.232] -- 0:00:49
93000 -- [-237.592] (-238.633) (-239.061) (-240.608) * [-236.852] (-240.679) (-237.239) (-238.695) -- 0:00:48
93500 -- (-240.311) (-243.696) [-236.885] (-239.025) * (-237.941) (-240.864) [-238.320] (-236.781) -- 0:00:48
94000 -- (-239.998) (-245.234) (-238.443) [-237.920] * (-237.998) [-237.703] (-241.524) (-236.331) -- 0:00:57
94500 -- (-239.317) (-237.639) [-240.365] (-239.768) * (-237.229) (-236.393) [-236.398] (-238.585) -- 0:00:57
95000 -- (-239.771) [-239.069] (-241.525) (-238.085) * (-238.283) (-237.879) (-238.395) [-237.670] -- 0:00:57
Average standard deviation of split frequencies: 0.023079
95500 -- (-239.382) (-238.275) [-241.098] (-239.146) * (-238.760) (-237.496) (-236.544) [-238.943] -- 0:00:56
96000 -- (-237.895) (-239.232) (-239.829) [-237.911] * (-237.277) [-239.363] (-241.086) (-239.337) -- 0:00:56
96500 -- (-238.317) [-238.564] (-235.888) (-238.435) * (-239.985) (-237.276) (-245.435) [-237.234] -- 0:00:56
97000 -- (-238.602) (-238.811) [-235.971] (-240.846) * (-236.714) (-236.576) (-243.696) [-237.337] -- 0:00:55
97500 -- (-237.316) (-236.342) (-237.419) [-236.377] * (-238.886) (-242.072) (-240.758) [-239.216] -- 0:00:55
98000 -- (-237.796) (-237.499) [-237.025] (-239.788) * (-236.961) (-243.953) (-242.329) [-241.331] -- 0:00:55
98500 -- (-238.632) (-237.482) (-240.899) [-236.994] * (-238.641) (-239.957) [-238.645] (-244.825) -- 0:00:54
99000 -- [-239.617] (-240.981) (-242.221) (-237.164) * [-239.724] (-240.585) (-239.827) (-237.174) -- 0:00:54
99500 -- (-236.848) (-237.445) (-236.482) [-239.373] * (-238.098) (-236.688) (-235.956) [-238.665] -- 0:00:54
100000 -- (-236.657) [-238.785] (-238.625) (-239.492) * [-244.902] (-237.231) (-236.578) (-239.305) -- 0:00:54
Average standard deviation of split frequencies: 0.025287
100500 -- [-237.588] (-238.110) (-237.440) (-241.636) * (-245.139) (-243.853) [-238.302] (-238.192) -- 0:00:53
101000 -- [-236.810] (-239.963) (-237.458) (-240.656) * [-240.160] (-239.153) (-237.631) (-237.925) -- 0:00:53
101500 -- (-238.711) [-239.372] (-236.443) (-239.249) * (-241.034) (-240.223) (-238.182) [-243.557] -- 0:00:53
102000 -- (-239.884) (-243.740) (-237.879) [-237.424] * (-239.315) (-238.018) (-239.587) [-240.244] -- 0:00:52
102500 -- (-237.295) (-240.845) [-237.100] (-236.274) * (-238.143) (-238.204) [-243.166] (-238.230) -- 0:00:52
103000 -- (-237.376) (-242.436) [-237.628] (-238.625) * [-238.547] (-239.033) (-239.827) (-240.337) -- 0:00:52
103500 -- (-237.081) [-237.599] (-237.693) (-236.577) * (-237.099) (-241.088) [-238.028] (-238.629) -- 0:00:51
104000 -- (-237.031) (-238.758) [-239.325] (-239.196) * (-237.427) (-238.246) [-245.096] (-238.354) -- 0:00:51
104500 -- [-236.737] (-238.716) (-240.312) (-238.374) * (-237.163) (-239.448) [-247.478] (-238.208) -- 0:00:51
105000 -- (-236.800) (-237.384) [-237.866] (-237.806) * (-237.799) (-238.547) (-236.894) [-237.734] -- 0:00:51
Average standard deviation of split frequencies: 0.025875
105500 -- (-236.572) [-239.136] (-237.724) (-237.376) * (-242.590) [-238.258] (-239.519) (-243.242) -- 0:00:50
106000 -- (-237.263) [-236.379] (-237.642) (-242.029) * [-239.340] (-236.313) (-237.643) (-237.594) -- 0:00:50
106500 -- [-237.173] (-243.378) (-237.538) (-239.720) * (-238.341) [-237.879] (-239.681) (-239.195) -- 0:00:50
107000 -- (-240.365) [-236.272] (-237.621) (-242.854) * (-236.406) (-238.023) (-237.867) [-238.909] -- 0:00:50
107500 -- [-239.492] (-237.650) (-238.533) (-241.466) * (-239.626) (-238.178) (-239.982) [-238.768] -- 0:00:49
108000 -- (-237.871) (-238.682) (-237.909) [-236.367] * (-238.800) (-237.274) (-238.169) [-237.682] -- 0:00:49
108500 -- (-236.441) (-240.506) [-238.702] (-238.817) * [-236.579] (-236.900) (-238.964) (-237.863) -- 0:00:49
109000 -- [-236.829] (-237.765) (-236.102) (-238.942) * (-238.596) [-237.920] (-241.073) (-238.985) -- 0:00:49
109500 -- (-239.573) (-239.573) (-241.841) [-238.378] * (-237.433) [-236.270] (-238.185) (-239.928) -- 0:00:48
110000 -- (-238.648) [-237.044] (-243.484) (-237.007) * (-240.417) [-236.604] (-237.064) (-239.093) -- 0:00:48
Average standard deviation of split frequencies: 0.025752
110500 -- (-239.061) [-236.431] (-238.030) (-238.600) * (-245.168) [-238.177] (-238.401) (-238.105) -- 0:00:48
111000 -- [-243.918] (-237.561) (-237.888) (-237.919) * (-244.475) (-237.799) (-238.528) [-241.103] -- 0:00:48
111500 -- (-237.292) [-237.442] (-237.982) (-238.705) * (-237.412) (-238.721) (-237.861) [-237.308] -- 0:00:55
112000 -- [-238.222] (-238.174) (-237.765) (-238.887) * (-237.601) (-236.270) (-237.678) [-237.307] -- 0:00:55
112500 -- (-237.171) [-238.803] (-236.915) (-238.270) * (-240.255) (-241.541) [-236.162] (-245.198) -- 0:00:55
113000 -- (-240.574) (-236.539) (-238.219) [-241.006] * (-238.088) (-238.072) (-237.089) [-237.661] -- 0:00:54
113500 -- (-241.378) (-237.324) (-239.817) [-241.279] * (-237.129) [-240.877] (-239.059) (-237.406) -- 0:00:54
114000 -- (-238.462) (-237.331) (-240.188) [-239.027] * [-237.637] (-240.863) (-237.857) (-240.080) -- 0:00:54
114500 -- (-240.316) (-239.012) [-238.894] (-236.592) * (-238.391) (-239.347) [-239.588] (-238.429) -- 0:00:54
115000 -- (-238.189) [-238.579] (-237.707) (-236.419) * [-236.537] (-239.400) (-240.089) (-241.211) -- 0:00:53
Average standard deviation of split frequencies: 0.025602
115500 -- (-240.891) [-237.987] (-239.112) (-238.550) * (-236.943) (-237.425) [-241.754] (-237.506) -- 0:00:53
116000 -- [-236.700] (-237.047) (-240.255) (-239.167) * (-236.265) [-236.802] (-237.031) (-236.539) -- 0:00:53
116500 -- [-237.373] (-239.025) (-240.272) (-238.371) * (-236.754) [-237.726] (-236.990) (-236.589) -- 0:00:53
117000 -- (-239.126) [-239.120] (-237.921) (-243.370) * (-239.260) [-236.731] (-242.134) (-241.762) -- 0:00:52
117500 -- (-238.156) (-238.421) (-236.605) [-240.001] * (-243.176) (-236.966) [-237.739] (-238.589) -- 0:00:52
118000 -- (-237.839) (-237.172) [-238.957] (-241.165) * [-236.704] (-242.206) (-239.245) (-237.961) -- 0:00:52
118500 -- (-236.443) (-237.531) [-237.366] (-236.697) * [-237.870] (-238.536) (-237.362) (-237.541) -- 0:00:52
119000 -- (-238.667) (-240.608) [-238.737] (-239.340) * (-239.307) (-240.042) (-239.124) [-236.675] -- 0:00:51
119500 -- (-238.066) [-236.748] (-236.796) (-238.129) * [-244.931] (-241.660) (-237.503) (-238.755) -- 0:00:51
120000 -- (-241.167) (-239.423) [-236.396] (-242.756) * (-241.650) [-238.777] (-237.585) (-236.095) -- 0:00:51
Average standard deviation of split frequencies: 0.024370
120500 -- [-238.994] (-236.761) (-237.133) (-238.434) * [-238.474] (-238.847) (-239.133) (-236.791) -- 0:00:51
121000 -- (-246.537) (-240.685) [-241.456] (-237.652) * (-238.298) [-236.740] (-236.607) (-237.951) -- 0:00:50
121500 -- (-237.499) [-241.438] (-239.943) (-237.328) * (-242.298) [-237.871] (-236.277) (-238.788) -- 0:00:50
122000 -- (-238.265) (-238.279) (-239.228) [-237.629] * (-239.278) [-236.961] (-236.482) (-240.883) -- 0:00:50
122500 -- (-236.792) (-238.335) [-237.258] (-238.540) * (-237.861) [-237.950] (-240.154) (-243.596) -- 0:00:50
123000 -- [-236.610] (-236.940) (-238.204) (-239.414) * (-237.048) [-237.329] (-241.293) (-239.081) -- 0:00:49
123500 -- (-242.708) [-238.305] (-237.188) (-241.321) * (-238.114) (-237.468) [-242.286] (-239.520) -- 0:00:49
124000 -- [-236.676] (-241.179) (-242.162) (-236.838) * (-240.405) (-237.321) [-237.468] (-240.136) -- 0:00:49
124500 -- [-236.838] (-237.838) (-237.769) (-238.778) * (-238.563) (-237.542) [-237.183] (-239.270) -- 0:00:49
125000 -- (-236.614) (-236.240) [-238.479] (-237.396) * (-240.980) (-240.379) (-236.688) [-239.049] -- 0:00:49
Average standard deviation of split frequencies: 0.025441
125500 -- (-237.939) (-236.947) (-237.816) [-236.923] * (-239.401) (-238.037) [-236.963] (-237.868) -- 0:00:48
126000 -- (-237.283) (-239.773) [-238.139] (-236.855) * [-238.523] (-238.615) (-236.315) (-241.079) -- 0:00:48
126500 -- (-236.608) (-237.728) [-242.495] (-238.864) * [-237.703] (-237.105) (-237.672) (-240.909) -- 0:00:48
127000 -- (-239.868) (-237.320) (-241.505) [-241.522] * (-236.516) (-236.826) (-238.455) [-238.559] -- 0:00:48
127500 -- (-237.828) [-236.385] (-240.507) (-241.585) * (-238.983) (-236.918) (-240.777) [-238.603] -- 0:00:47
128000 -- (-236.310) (-238.536) (-237.491) [-237.336] * [-237.116] (-239.467) (-239.752) (-238.622) -- 0:00:47
128500 -- (-242.089) [-237.529] (-237.763) (-236.630) * (-239.633) (-241.380) [-237.968] (-236.138) -- 0:00:47
129000 -- (-240.314) [-236.942] (-238.998) (-236.360) * (-238.525) (-242.232) (-238.491) [-238.126] -- 0:00:54
129500 -- [-241.602] (-236.479) (-240.600) (-237.771) * (-238.441) (-239.768) (-236.715) [-238.247] -- 0:00:53
130000 -- [-238.145] (-242.388) (-241.217) (-239.883) * (-243.496) (-243.180) (-236.638) [-238.706] -- 0:00:53
Average standard deviation of split frequencies: 0.022909
130500 -- (-236.865) [-237.917] (-238.911) (-236.355) * (-238.735) (-239.427) (-237.188) [-238.385] -- 0:00:53
131000 -- (-236.452) (-236.503) [-238.556] (-240.346) * (-238.182) (-237.168) [-236.873] (-236.420) -- 0:00:53
131500 -- (-238.169) (-239.588) [-238.272] (-238.328) * [-238.836] (-238.108) (-236.757) (-236.830) -- 0:00:52
132000 -- [-239.898] (-238.956) (-236.470) (-238.184) * (-239.086) (-238.227) [-238.675] (-238.398) -- 0:00:52
132500 -- (-238.682) (-238.051) [-237.698] (-238.557) * (-238.362) (-241.357) [-238.196] (-237.819) -- 0:00:52
133000 -- (-236.967) [-236.453] (-238.061) (-236.324) * (-238.718) [-238.088] (-238.592) (-237.603) -- 0:00:52
133500 -- (-237.904) [-237.178] (-243.304) (-236.589) * [-237.886] (-237.804) (-237.492) (-239.940) -- 0:00:51
134000 -- (-238.152) (-239.794) (-242.441) [-237.969] * (-236.486) (-238.470) (-237.417) [-239.619] -- 0:00:51
134500 -- (-236.580) (-238.703) [-237.596] (-238.749) * [-237.658] (-236.575) (-238.176) (-237.306) -- 0:00:51
135000 -- (-240.125) [-241.626] (-238.816) (-237.775) * (-236.693) (-236.227) [-239.484] (-240.126) -- 0:00:51
Average standard deviation of split frequencies: 0.023744
135500 -- [-239.707] (-239.604) (-238.671) (-239.694) * [-239.362] (-237.559) (-237.495) (-239.465) -- 0:00:51
136000 -- [-243.069] (-240.129) (-238.778) (-239.754) * [-237.152] (-238.980) (-236.981) (-240.663) -- 0:00:50
136500 -- (-238.636) (-239.541) (-238.026) [-243.782] * (-236.829) [-236.741] (-236.306) (-236.712) -- 0:00:50
137000 -- (-237.395) [-238.408] (-241.203) (-240.530) * [-238.876] (-238.713) (-237.380) (-239.907) -- 0:00:50
137500 -- (-238.390) [-238.605] (-243.803) (-236.975) * [-236.896] (-238.482) (-236.495) (-237.246) -- 0:00:50
138000 -- (-240.948) (-236.685) [-238.813] (-236.972) * [-239.728] (-239.805) (-236.081) (-239.989) -- 0:00:49
138500 -- (-239.084) [-239.136] (-237.814) (-241.346) * (-237.519) [-237.961] (-238.214) (-236.826) -- 0:00:49
139000 -- (-237.983) (-238.701) (-237.962) [-238.211] * (-238.000) (-238.145) (-240.204) [-238.846] -- 0:00:49
139500 -- (-238.934) (-238.603) [-236.060] (-239.009) * (-236.586) [-238.602] (-239.418) (-241.142) -- 0:00:49
140000 -- (-237.111) [-238.420] (-236.973) (-237.825) * (-236.962) (-237.533) (-240.106) [-236.048] -- 0:00:49
Average standard deviation of split frequencies: 0.022900
140500 -- [-236.827] (-239.542) (-237.855) (-236.379) * [-238.134] (-238.289) (-241.936) (-238.731) -- 0:00:48
141000 -- (-237.540) (-241.257) (-239.342) [-237.308] * (-240.733) (-241.347) [-237.975] (-239.991) -- 0:00:48
141500 -- (-239.880) (-236.557) (-242.172) [-241.911] * [-245.622] (-240.817) (-237.649) (-237.177) -- 0:00:48
142000 -- (-240.525) (-240.283) [-237.241] (-239.702) * (-237.789) (-238.188) [-237.435] (-236.779) -- 0:00:48
142500 -- (-239.864) (-236.565) [-237.780] (-239.880) * [-241.866] (-237.737) (-236.746) (-237.657) -- 0:00:48
143000 -- [-236.330] (-236.956) (-236.975) (-238.965) * (-239.703) (-241.041) (-237.375) [-239.213] -- 0:00:47
143500 -- [-237.835] (-237.775) (-237.456) (-237.386) * [-238.716] (-243.461) (-238.895) (-240.073) -- 0:00:47
144000 -- (-239.645) [-238.684] (-240.037) (-238.721) * [-236.985] (-241.219) (-238.382) (-237.095) -- 0:00:47
144500 -- [-237.423] (-236.843) (-241.143) (-239.193) * (-238.064) (-237.176) (-236.230) [-237.251] -- 0:00:47
145000 -- [-237.601] (-236.689) (-238.250) (-238.203) * (-239.047) (-238.229) [-236.401] (-237.927) -- 0:00:47
Average standard deviation of split frequencies: 0.022602
145500 -- (-243.924) (-236.537) (-238.233) [-238.257] * (-236.829) [-237.870] (-238.001) (-237.945) -- 0:00:46
146000 -- (-243.151) (-238.533) (-240.878) [-238.152] * (-243.305) (-240.481) [-239.561] (-239.787) -- 0:00:46
146500 -- [-239.860] (-236.769) (-239.122) (-237.466) * [-237.934] (-237.462) (-237.796) (-238.909) -- 0:00:52
147000 -- (-238.106) [-236.981] (-241.272) (-241.877) * (-240.995) [-236.982] (-240.329) (-237.940) -- 0:00:52
147500 -- (-237.104) [-237.320] (-236.845) (-241.816) * (-239.340) (-239.494) [-238.566] (-237.798) -- 0:00:52
148000 -- (-237.664) [-236.694] (-240.950) (-238.343) * (-237.055) [-239.506] (-239.205) (-240.749) -- 0:00:51
148500 -- (-236.556) (-236.727) (-239.420) [-237.876] * [-237.236] (-240.614) (-237.167) (-241.600) -- 0:00:51
149000 -- [-237.734] (-237.286) (-240.185) (-238.083) * (-239.852) [-238.481] (-238.774) (-239.395) -- 0:00:51
149500 -- (-237.729) (-237.014) (-239.324) [-243.834] * [-238.074] (-241.029) (-236.453) (-236.922) -- 0:00:51
150000 -- [-236.690] (-237.598) (-238.437) (-241.117) * (-238.374) [-237.843] (-237.273) (-237.988) -- 0:00:51
Average standard deviation of split frequencies: 0.019925
150500 -- (-242.891) (-240.749) [-236.157] (-240.529) * (-238.579) (-238.166) [-236.091] (-237.027) -- 0:00:50
151000 -- [-242.234] (-238.630) (-239.667) (-239.612) * (-241.385) (-239.507) [-237.141] (-237.652) -- 0:00:50
151500 -- [-238.643] (-237.755) (-239.254) (-238.850) * [-240.099] (-236.701) (-238.976) (-237.930) -- 0:00:50
152000 -- (-237.290) [-237.214] (-240.616) (-243.136) * (-237.630) [-237.536] (-240.005) (-240.269) -- 0:00:50
152500 -- (-238.260) (-240.242) [-238.180] (-239.653) * (-237.738) (-237.626) [-238.648] (-239.433) -- 0:00:50
153000 -- (-237.740) (-238.280) (-238.383) [-236.865] * (-241.462) (-237.308) [-237.357] (-238.918) -- 0:00:49
153500 -- [-239.100] (-240.141) (-237.566) (-236.605) * (-237.024) (-240.515) (-237.653) [-237.174] -- 0:00:49
154000 -- [-238.061] (-237.181) (-238.017) (-237.333) * [-237.985] (-242.087) (-237.607) (-239.369) -- 0:00:49
154500 -- (-237.254) (-237.459) (-237.137) [-237.774] * [-239.833] (-240.782) (-235.999) (-239.133) -- 0:00:49
155000 -- (-236.702) (-238.642) (-236.546) [-236.857] * (-246.658) (-242.299) (-239.933) [-240.780] -- 0:00:49
Average standard deviation of split frequencies: 0.020145
155500 -- [-236.985] (-236.752) (-237.675) (-236.790) * [-236.374] (-238.092) (-236.361) (-238.893) -- 0:00:48
156000 -- (-242.665) (-237.367) [-240.340] (-238.148) * [-237.532] (-238.462) (-238.261) (-239.458) -- 0:00:48
156500 -- (-238.057) (-237.001) [-237.730] (-240.987) * (-237.638) [-238.557] (-237.565) (-237.889) -- 0:00:48
157000 -- (-242.104) [-239.381] (-237.567) (-237.969) * [-237.458] (-243.614) (-237.618) (-237.908) -- 0:00:48
157500 -- (-240.548) (-237.040) (-236.600) [-236.481] * (-242.164) [-240.817] (-236.865) (-239.013) -- 0:00:48
158000 -- [-239.767] (-238.272) (-240.067) (-241.876) * (-243.349) [-236.010] (-237.824) (-236.673) -- 0:00:47
158500 -- (-242.764) (-237.386) (-242.587) [-237.088] * (-239.358) (-236.983) [-239.016] (-239.848) -- 0:00:47
159000 -- (-240.433) (-236.788) [-240.960] (-237.212) * (-239.892) (-237.218) [-238.801] (-242.299) -- 0:00:47
159500 -- (-238.404) (-237.619) [-236.703] (-238.419) * [-236.138] (-236.951) (-236.457) (-243.260) -- 0:00:47
160000 -- [-240.294] (-240.781) (-237.234) (-244.833) * [-236.474] (-238.144) (-237.310) (-239.222) -- 0:00:47
Average standard deviation of split frequencies: 0.021401
160500 -- (-237.220) (-237.026) (-239.594) [-238.982] * (-237.545) [-236.491] (-239.527) (-239.856) -- 0:00:47
161000 -- (-238.158) (-237.472) (-236.402) [-236.521] * (-238.442) (-237.596) [-236.144] (-237.537) -- 0:00:46
161500 -- [-236.926] (-237.961) (-237.895) (-238.192) * (-239.027) (-239.648) (-238.757) [-238.807] -- 0:00:46
162000 -- (-239.305) [-237.787] (-237.996) (-237.504) * (-237.104) (-238.984) [-238.228] (-238.916) -- 0:00:46
162500 -- (-238.317) [-239.176] (-237.945) (-238.487) * (-238.365) (-238.101) [-239.602] (-237.169) -- 0:00:46
163000 -- (-236.231) (-238.245) (-242.260) [-237.788] * (-237.225) (-239.461) (-240.229) [-240.715] -- 0:00:46
163500 -- (-240.090) (-241.455) [-236.840] (-237.775) * (-239.803) (-237.030) [-236.941] (-241.930) -- 0:00:51
164000 -- (-239.704) (-240.510) [-237.149] (-239.846) * (-237.527) (-236.446) (-237.777) [-237.670] -- 0:00:50
164500 -- (-237.089) (-241.818) (-236.596) [-237.211] * (-237.723) (-239.105) [-236.390] (-238.848) -- 0:00:50
165000 -- (-240.576) (-242.094) (-236.604) [-236.548] * (-236.870) (-237.285) (-237.966) [-237.290] -- 0:00:50
Average standard deviation of split frequencies: 0.019729
165500 -- (-239.688) (-237.831) (-238.082) [-238.582] * [-237.482] (-240.093) (-238.088) (-240.383) -- 0:00:50
166000 -- (-236.327) [-238.507] (-238.920) (-236.566) * (-237.633) (-238.000) [-236.997] (-240.565) -- 0:00:50
166500 -- [-236.958] (-238.409) (-246.257) (-236.690) * (-236.999) (-242.309) [-238.042] (-239.274) -- 0:00:50
167000 -- (-242.816) [-240.909] (-239.337) (-237.078) * [-237.021] (-240.147) (-238.329) (-239.816) -- 0:00:49
167500 -- [-238.421] (-242.070) (-238.696) (-237.521) * (-237.066) (-238.183) (-240.133) [-237.679] -- 0:00:49
168000 -- (-237.793) [-236.422] (-239.402) (-237.697) * (-236.136) [-238.591] (-237.471) (-238.510) -- 0:00:49
168500 -- [-238.264] (-238.234) (-240.651) (-244.940) * (-238.410) [-237.276] (-236.363) (-237.127) -- 0:00:49
169000 -- (-239.157) (-237.381) [-236.214] (-237.699) * (-240.363) (-237.752) [-239.914] (-238.632) -- 0:00:49
169500 -- (-242.308) (-237.907) [-238.983] (-236.699) * (-240.134) (-236.625) (-237.485) [-237.370] -- 0:00:48
170000 -- [-236.986] (-238.281) (-236.595) (-239.208) * (-237.386) (-238.549) (-237.464) [-238.485] -- 0:00:48
Average standard deviation of split frequencies: 0.020992
170500 -- (-235.991) (-237.117) (-237.266) [-239.845] * (-238.180) (-240.725) (-237.009) [-238.475] -- 0:00:48
171000 -- [-236.417] (-240.166) (-237.938) (-237.159) * [-241.886] (-239.878) (-239.045) (-237.563) -- 0:00:48
171500 -- [-238.439] (-238.675) (-239.419) (-238.103) * [-239.466] (-238.137) (-238.704) (-236.723) -- 0:00:48
172000 -- (-241.641) [-240.669] (-240.626) (-238.163) * (-237.519) [-237.731] (-236.503) (-238.428) -- 0:00:48
172500 -- (-239.908) (-238.527) (-237.845) [-238.885] * [-239.421] (-237.769) (-238.906) (-236.318) -- 0:00:47
173000 -- (-238.573) [-238.217] (-237.931) (-239.415) * (-239.660) [-240.044] (-238.644) (-238.734) -- 0:00:47
173500 -- (-239.811) (-236.739) [-240.169] (-239.674) * (-238.484) (-238.222) (-237.434) [-236.609] -- 0:00:47
174000 -- (-236.700) [-236.979] (-239.976) (-236.990) * (-237.075) [-241.278] (-238.832) (-242.069) -- 0:00:47
174500 -- (-237.306) (-240.653) (-236.979) [-237.752] * [-237.638] (-242.692) (-237.346) (-236.557) -- 0:00:47
175000 -- (-238.020) [-239.842] (-239.800) (-237.415) * (-238.792) (-241.806) (-239.207) [-238.458] -- 0:00:47
Average standard deviation of split frequencies: 0.021568
175500 -- (-236.412) (-240.175) (-238.928) [-236.927] * [-238.788] (-240.407) (-238.076) (-240.011) -- 0:00:46
176000 -- (-240.446) [-236.376] (-237.180) (-236.208) * [-239.820] (-240.679) (-239.188) (-241.496) -- 0:00:46
176500 -- (-239.763) (-236.523) (-238.163) [-236.362] * (-239.350) [-237.492] (-239.921) (-237.933) -- 0:00:46
177000 -- (-243.017) (-240.244) [-240.038] (-236.960) * (-244.734) (-238.509) (-241.183) [-236.609] -- 0:00:46
177500 -- (-238.383) (-238.697) (-239.294) [-240.597] * (-240.055) [-237.667] (-238.993) (-241.691) -- 0:00:46
178000 -- [-239.492] (-238.086) (-240.613) (-240.770) * [-238.138] (-237.269) (-241.105) (-237.763) -- 0:00:46
178500 -- (-238.525) [-238.103] (-237.982) (-241.404) * (-240.155) (-239.284) [-238.173] (-238.384) -- 0:00:46
179000 -- (-236.791) [-237.643] (-239.886) (-239.451) * (-240.966) (-238.683) (-236.460) [-238.245] -- 0:00:45
179500 -- (-238.447) (-239.080) (-237.376) [-238.196] * [-241.074] (-237.291) (-236.866) (-239.186) -- 0:00:45
180000 -- [-238.714] (-238.034) (-239.991) (-236.293) * (-241.472) (-238.904) (-240.209) [-241.567] -- 0:00:45
Average standard deviation of split frequencies: 0.020737
180500 -- (-242.991) (-236.806) [-240.204] (-238.464) * [-236.558] (-237.520) (-242.536) (-236.868) -- 0:00:49
181000 -- (-237.186) (-237.088) [-237.074] (-249.155) * (-238.471) (-238.265) (-238.987) [-236.758] -- 0:00:49
181500 -- (-237.999) (-239.172) (-240.739) [-238.493] * (-238.646) (-237.116) [-238.023] (-237.681) -- 0:00:49
182000 -- [-237.079] (-239.978) (-238.747) (-238.325) * [-238.501] (-238.022) (-237.862) (-237.845) -- 0:00:49
182500 -- (-239.964) [-240.782] (-237.305) (-238.873) * (-236.766) (-237.837) [-238.113] (-236.351) -- 0:00:49
183000 -- (-237.831) (-237.979) (-240.713) [-237.257] * (-238.073) (-238.519) [-240.065] (-236.673) -- 0:00:49
183500 -- [-236.714] (-238.731) (-236.816) (-238.441) * [-237.876] (-236.767) (-241.074) (-236.935) -- 0:00:48
184000 -- [-240.161] (-239.547) (-240.594) (-242.227) * (-240.233) (-238.251) (-239.470) [-239.467] -- 0:00:48
184500 -- [-239.276] (-238.286) (-241.434) (-242.276) * [-236.252] (-237.259) (-243.662) (-238.014) -- 0:00:48
185000 -- (-238.291) (-238.879) [-241.118] (-239.410) * (-237.883) (-239.076) (-238.160) [-241.656] -- 0:00:48
Average standard deviation of split frequencies: 0.020275
185500 -- [-238.649] (-240.331) (-237.433) (-239.800) * [-237.306] (-240.513) (-243.185) (-236.688) -- 0:00:48
186000 -- (-241.057) (-238.556) (-238.152) [-241.762] * (-238.293) (-241.878) [-238.442] (-236.391) -- 0:00:48
186500 -- [-238.066] (-236.820) (-237.049) (-237.784) * (-237.349) (-240.367) [-237.375] (-237.251) -- 0:00:47
187000 -- (-237.691) (-237.450) [-240.042] (-236.649) * [-239.511] (-239.864) (-239.261) (-237.478) -- 0:00:47
187500 -- (-238.116) [-238.301] (-238.764) (-236.654) * [-237.459] (-237.452) (-239.964) (-236.403) -- 0:00:47
188000 -- [-238.267] (-236.420) (-243.185) (-237.665) * [-237.104] (-239.073) (-241.305) (-240.291) -- 0:00:47
188500 -- [-239.601] (-239.186) (-240.480) (-236.944) * (-240.187) (-239.067) (-241.892) [-238.146] -- 0:00:47
189000 -- (-237.097) [-236.330] (-238.201) (-239.851) * [-239.631] (-239.165) (-238.531) (-241.752) -- 0:00:47
189500 -- [-244.564] (-241.164) (-237.413) (-238.304) * (-237.503) (-237.189) [-236.694] (-239.333) -- 0:00:47
190000 -- (-241.825) (-238.682) [-238.799] (-238.439) * (-239.169) (-240.569) [-238.224] (-240.800) -- 0:00:46
Average standard deviation of split frequencies: 0.017437
190500 -- [-237.891] (-237.544) (-236.837) (-236.355) * (-238.654) [-237.043] (-237.998) (-243.396) -- 0:00:46
191000 -- (-237.291) (-240.315) (-237.932) [-236.317] * (-237.980) (-238.199) (-238.085) [-240.523] -- 0:00:46
191500 -- (-236.299) (-237.816) (-237.401) [-239.522] * (-241.798) (-241.940) [-238.258] (-237.056) -- 0:00:46
192000 -- (-237.479) [-238.471] (-243.312) (-236.724) * (-241.290) (-236.726) (-238.063) [-239.050] -- 0:00:46
192500 -- (-237.537) (-238.011) (-241.289) [-236.768] * (-236.279) [-240.189] (-240.231) (-239.222) -- 0:00:46
193000 -- (-237.315) (-238.359) [-240.598] (-237.495) * [-236.462] (-236.290) (-237.929) (-238.082) -- 0:00:45
193500 -- (-237.407) (-237.497) [-236.520] (-237.268) * (-238.977) (-237.917) (-244.840) [-239.225] -- 0:00:45
194000 -- (-237.594) [-238.101] (-240.525) (-237.074) * (-238.780) (-238.079) [-237.980] (-236.410) -- 0:00:45
194500 -- (-238.453) (-241.227) [-238.103] (-237.704) * (-237.151) [-238.743] (-243.092) (-236.732) -- 0:00:45
195000 -- [-238.416] (-238.787) (-237.182) (-239.877) * (-236.236) (-240.088) (-242.301) [-237.897] -- 0:00:45
Average standard deviation of split frequencies: 0.016330
195500 -- (-239.894) (-237.191) [-236.212] (-236.476) * [-239.009] (-236.934) (-238.451) (-237.089) -- 0:00:45
196000 -- (-236.854) (-239.852) (-239.574) [-237.106] * (-237.244) (-236.878) (-238.415) [-236.371] -- 0:00:45
196500 -- (-237.200) (-236.940) (-237.771) [-240.901] * (-240.173) (-237.950) [-238.405] (-238.077) -- 0:00:44
197000 -- [-239.827] (-240.923) (-238.800) (-237.534) * (-239.748) (-243.081) (-237.925) [-239.253] -- 0:00:44
197500 -- (-239.682) (-238.402) (-236.697) [-236.334] * (-240.086) (-237.970) (-238.315) [-240.501] -- 0:00:44
198000 -- (-236.679) (-236.126) (-238.047) [-236.612] * (-238.154) (-237.828) [-236.968] (-239.927) -- 0:00:48
198500 -- (-238.631) (-238.612) [-240.971] (-237.538) * [-239.495] (-238.930) (-239.390) (-239.654) -- 0:00:48
199000 -- (-236.378) [-239.522] (-237.014) (-237.758) * [-236.873] (-236.801) (-239.407) (-239.196) -- 0:00:48
199500 -- (-236.460) (-239.513) [-240.586] (-236.840) * (-236.535) [-237.522] (-237.204) (-239.510) -- 0:00:48
200000 -- (-237.850) (-239.018) [-240.932] (-237.230) * (-237.868) (-238.931) (-243.610) [-237.675] -- 0:00:48
Average standard deviation of split frequencies: 0.014342
200500 -- (-239.988) [-236.463] (-239.382) (-239.195) * (-238.256) (-238.158) (-238.297) [-237.313] -- 0:00:47
201000 -- (-237.280) (-237.162) (-238.658) [-237.372] * (-241.876) [-236.897] (-237.556) (-241.775) -- 0:00:47
201500 -- (-237.863) (-236.606) (-238.194) [-239.096] * (-240.208) (-236.457) (-239.072) [-238.205] -- 0:00:47
202000 -- (-239.919) (-237.469) (-237.648) [-239.901] * [-237.026] (-240.080) (-240.922) (-236.792) -- 0:00:47
202500 -- (-237.546) [-238.510] (-238.517) (-237.566) * (-238.227) (-238.599) (-240.758) [-236.687] -- 0:00:47
203000 -- (-238.497) [-240.833] (-238.745) (-237.896) * (-237.697) (-238.664) [-241.221] (-236.772) -- 0:00:47
203500 -- (-237.851) (-238.075) [-238.536] (-238.431) * (-236.365) (-238.336) (-240.176) [-236.908] -- 0:00:46
204000 -- (-239.580) (-237.289) (-238.330) [-236.925] * [-237.762] (-238.960) (-238.846) (-237.189) -- 0:00:46
204500 -- (-240.104) (-237.290) (-238.914) [-239.773] * (-237.763) (-241.139) (-239.753) [-237.374] -- 0:00:46
205000 -- (-236.523) (-240.082) (-241.367) [-236.695] * (-239.585) (-237.630) [-236.697] (-237.359) -- 0:00:46
Average standard deviation of split frequencies: 0.012929
205500 -- (-238.363) (-237.404) (-237.707) [-240.021] * (-236.956) (-243.351) [-237.742] (-238.062) -- 0:00:46
206000 -- (-238.878) (-237.029) (-238.675) [-241.862] * (-236.933) (-240.291) [-239.455] (-236.688) -- 0:00:46
206500 -- (-239.611) (-237.091) (-238.010) [-240.075] * (-237.889) (-237.260) [-242.306] (-237.050) -- 0:00:46
207000 -- (-238.553) (-236.040) (-236.811) [-238.787] * [-236.314] (-237.972) (-237.301) (-237.248) -- 0:00:45
207500 -- [-242.488] (-236.601) (-238.510) (-236.794) * (-238.190) [-237.973] (-237.269) (-237.686) -- 0:00:45
208000 -- (-240.890) (-236.819) [-237.442] (-238.060) * [-237.611] (-238.159) (-242.849) (-238.173) -- 0:00:45
208500 -- (-239.857) [-236.695] (-237.890) (-237.741) * (-236.696) (-239.447) (-236.954) [-238.156] -- 0:00:45
209000 -- (-239.383) (-238.212) (-236.649) [-242.141] * (-237.340) (-236.627) (-238.657) [-239.832] -- 0:00:45
209500 -- (-237.628) (-237.428) [-239.832] (-236.729) * (-237.715) [-235.940] (-237.973) (-238.812) -- 0:00:45
210000 -- (-240.401) (-238.969) [-237.983] (-236.876) * (-236.188) (-240.376) [-237.145] (-242.719) -- 0:00:45
Average standard deviation of split frequencies: 0.013662
210500 -- (-237.617) (-240.971) (-237.163) [-236.772] * [-238.034] (-241.367) (-237.341) (-238.253) -- 0:00:45
211000 -- (-241.033) (-240.740) [-240.844] (-239.495) * [-236.158] (-242.691) (-238.938) (-238.377) -- 0:00:44
211500 -- [-236.571] (-237.147) (-245.326) (-238.720) * [-238.054] (-241.823) (-238.562) (-240.210) -- 0:00:44
212000 -- (-239.906) [-237.969] (-237.063) (-239.057) * [-236.469] (-242.378) (-237.377) (-242.242) -- 0:00:44
212500 -- [-237.886] (-237.205) (-242.536) (-238.483) * (-236.967) [-238.534] (-238.015) (-246.746) -- 0:00:44
213000 -- (-238.177) (-237.823) (-239.517) [-237.429] * (-238.600) [-236.846] (-238.429) (-244.947) -- 0:00:44
213500 -- (-239.976) (-237.285) [-238.485] (-237.194) * (-238.198) [-237.577] (-239.060) (-239.193) -- 0:00:44
214000 -- (-238.847) [-238.306] (-243.381) (-237.076) * (-237.736) [-241.229] (-236.362) (-238.012) -- 0:00:44
214500 -- [-237.408] (-241.001) (-237.521) (-237.034) * [-237.640] (-239.391) (-240.723) (-238.228) -- 0:00:43
215000 -- (-238.680) [-238.641] (-237.399) (-238.816) * (-237.925) (-237.750) [-240.439] (-237.866) -- 0:00:47
Average standard deviation of split frequencies: 0.014671
215500 -- [-238.496] (-238.175) (-237.179) (-239.759) * (-236.947) (-237.502) [-238.307] (-236.919) -- 0:00:47
216000 -- (-236.281) (-236.291) (-238.467) [-237.141] * (-238.867) (-237.944) (-242.467) [-239.446] -- 0:00:47
216500 -- [-236.548] (-237.849) (-243.195) (-241.349) * (-241.057) [-238.217] (-237.507) (-239.456) -- 0:00:47
217000 -- (-236.512) (-237.629) [-237.992] (-237.717) * [-237.744] (-237.593) (-237.532) (-237.212) -- 0:00:46
217500 -- (-237.064) (-237.357) (-237.199) [-238.446] * (-238.077) [-237.266] (-238.461) (-238.596) -- 0:00:46
218000 -- (-236.358) (-238.726) [-238.065] (-237.764) * (-239.060) (-236.946) (-239.171) [-236.232] -- 0:00:46
218500 -- (-240.004) [-240.222] (-239.329) (-239.091) * (-237.095) (-237.883) (-238.444) [-236.706] -- 0:00:46
219000 -- [-236.723] (-242.499) (-238.498) (-240.850) * (-237.664) [-236.225] (-237.971) (-240.195) -- 0:00:46
219500 -- [-239.839] (-239.727) (-237.112) (-240.598) * [-236.699] (-236.456) (-239.670) (-238.633) -- 0:00:46
220000 -- (-237.687) (-236.963) [-236.812] (-238.351) * (-238.852) [-239.217] (-239.492) (-239.455) -- 0:00:46
Average standard deviation of split frequencies: 0.014326
220500 -- (-237.489) (-239.871) (-238.240) [-238.617] * (-240.815) (-239.945) (-237.943) [-239.504] -- 0:00:45
221000 -- (-237.034) (-236.967) (-239.410) [-236.672] * (-239.466) (-239.914) (-236.993) [-238.455] -- 0:00:45
221500 -- (-238.189) (-236.895) (-237.897) [-237.597] * (-237.467) (-243.254) [-238.011] (-238.658) -- 0:00:45
222000 -- (-238.856) (-236.502) [-239.019] (-237.399) * (-236.448) (-236.774) [-238.738] (-236.392) -- 0:00:45
222500 -- (-241.116) (-236.907) (-238.748) [-237.961] * (-239.758) [-236.774] (-239.798) (-237.013) -- 0:00:45
223000 -- (-236.431) (-246.152) (-237.602) [-238.232] * [-237.862] (-240.261) (-238.374) (-237.271) -- 0:00:45
223500 -- (-237.715) [-240.011] (-237.065) (-236.746) * [-236.459] (-241.225) (-240.399) (-238.556) -- 0:00:45
224000 -- (-236.137) [-239.369] (-240.125) (-236.120) * (-236.371) (-239.640) [-237.934] (-238.037) -- 0:00:45
224500 -- (-237.308) (-237.620) [-236.897] (-239.913) * [-239.917] (-240.190) (-237.274) (-237.949) -- 0:00:44
225000 -- (-239.920) [-236.457] (-237.806) (-238.098) * (-238.031) (-237.407) [-239.167] (-238.072) -- 0:00:44
Average standard deviation of split frequencies: 0.015514
225500 -- [-240.499] (-237.308) (-236.244) (-241.897) * (-241.395) (-237.532) (-236.188) [-236.160] -- 0:00:44
226000 -- (-245.869) (-238.534) [-236.055] (-238.885) * (-242.453) [-237.436] (-243.727) (-238.390) -- 0:00:44
226500 -- [-237.021] (-237.399) (-237.961) (-237.540) * (-237.514) [-237.160] (-237.157) (-238.857) -- 0:00:44
227000 -- [-240.419] (-240.998) (-238.733) (-241.146) * (-239.580) [-238.436] (-236.323) (-240.503) -- 0:00:44
227500 -- (-237.008) (-238.018) [-237.551] (-237.497) * (-245.447) (-243.359) (-237.750) [-236.938] -- 0:00:44
228000 -- (-238.621) (-243.152) [-238.248] (-243.985) * [-237.936] (-240.569) (-237.827) (-237.906) -- 0:00:44
228500 -- [-237.281] (-243.543) (-244.449) (-237.866) * (-237.224) [-239.669] (-239.316) (-239.793) -- 0:00:43
229000 -- (-239.861) (-238.906) (-237.299) [-238.201] * (-239.975) (-243.014) (-238.790) [-236.556] -- 0:00:43
229500 -- [-238.972] (-238.080) (-238.694) (-238.520) * (-237.971) (-239.057) [-237.143] (-236.454) -- 0:00:43
230000 -- [-239.237] (-237.985) (-237.832) (-237.957) * (-243.410) (-239.769) (-237.401) [-237.153] -- 0:00:43
Average standard deviation of split frequencies: 0.014817
230500 -- (-238.674) (-237.274) [-240.414] (-238.297) * (-238.335) (-237.265) (-240.189) [-237.965] -- 0:00:43
231000 -- (-237.560) [-238.857] (-243.914) (-237.077) * (-240.921) (-236.200) [-238.798] (-241.293) -- 0:00:43
231500 -- [-236.581] (-244.666) (-247.122) (-237.512) * [-238.963] (-239.166) (-236.629) (-238.936) -- 0:00:43
232000 -- [-237.833] (-241.479) (-237.575) (-238.256) * [-238.944] (-242.323) (-236.618) (-236.697) -- 0:00:43
232500 -- [-239.476] (-239.369) (-237.319) (-239.355) * (-236.822) (-236.912) [-238.000] (-237.358) -- 0:00:46
233000 -- (-236.082) (-241.482) [-237.969] (-236.221) * (-237.708) (-238.180) [-239.577] (-236.862) -- 0:00:46
233500 -- (-236.262) (-244.373) [-237.047] (-236.678) * (-237.442) [-236.471] (-237.512) (-236.817) -- 0:00:45
234000 -- (-238.708) [-239.361] (-239.917) (-238.165) * (-236.312) (-236.508) [-240.960] (-237.050) -- 0:00:45
234500 -- [-241.281] (-236.702) (-238.901) (-237.338) * (-241.988) (-238.449) (-244.864) [-238.479] -- 0:00:45
235000 -- [-239.863] (-236.834) (-240.302) (-237.711) * (-237.346) (-242.671) (-244.830) [-237.695] -- 0:00:45
Average standard deviation of split frequencies: 0.014731
235500 -- (-238.014) (-241.691) [-236.841] (-238.378) * (-240.854) [-237.676] (-238.517) (-238.902) -- 0:00:45
236000 -- [-236.666] (-237.199) (-237.422) (-236.389) * (-245.017) (-235.980) (-238.309) [-236.931] -- 0:00:45
236500 -- (-237.347) (-238.917) [-237.746] (-240.230) * [-242.346] (-238.671) (-238.660) (-237.762) -- 0:00:45
237000 -- [-237.078] (-241.539) (-236.639) (-236.859) * (-236.655) [-240.285] (-238.812) (-238.871) -- 0:00:45
237500 -- (-236.817) [-239.022] (-237.769) (-238.047) * (-239.691) [-238.592] (-242.349) (-238.225) -- 0:00:44
238000 -- [-236.149] (-236.921) (-237.274) (-238.103) * [-236.825] (-236.225) (-238.166) (-242.768) -- 0:00:44
238500 -- (-236.284) [-236.509] (-237.077) (-239.948) * (-237.027) (-238.134) [-236.970] (-242.105) -- 0:00:44
239000 -- (-236.617) (-243.913) [-237.133] (-237.258) * (-241.340) [-236.516] (-238.365) (-240.562) -- 0:00:44
239500 -- [-237.375] (-240.007) (-241.293) (-240.127) * (-238.405) (-237.643) [-238.474] (-238.102) -- 0:00:44
240000 -- [-237.483] (-238.673) (-238.037) (-237.680) * (-239.519) (-236.571) [-236.229] (-236.133) -- 0:00:44
Average standard deviation of split frequencies: 0.014691
240500 -- [-238.932] (-239.243) (-236.506) (-237.286) * [-237.791] (-236.887) (-239.092) (-240.284) -- 0:00:44
241000 -- (-238.604) (-237.626) [-238.923] (-242.743) * (-238.641) (-239.107) (-239.659) [-237.726] -- 0:00:44
241500 -- [-238.039] (-237.173) (-239.042) (-241.644) * (-237.969) (-237.572) [-236.599] (-236.414) -- 0:00:43
242000 -- (-237.455) [-239.411] (-238.165) (-239.035) * [-239.299] (-236.868) (-237.357) (-244.503) -- 0:00:43
242500 -- (-238.948) (-237.268) (-240.657) [-237.867] * (-238.763) (-239.896) [-236.460] (-238.555) -- 0:00:43
243000 -- (-242.795) (-239.766) [-236.925] (-240.338) * (-238.520) (-236.211) (-237.658) [-237.829] -- 0:00:43
243500 -- [-238.571] (-238.651) (-239.935) (-236.382) * (-238.736) (-237.265) (-236.896) [-240.940] -- 0:00:43
244000 -- (-237.325) (-238.397) (-237.723) [-238.301] * [-238.563] (-242.789) (-236.167) (-238.659) -- 0:00:43
244500 -- (-240.718) (-238.552) [-237.911] (-240.273) * (-239.858) [-241.690] (-238.102) (-236.987) -- 0:00:43
245000 -- [-239.235] (-237.305) (-239.961) (-237.787) * (-236.938) (-240.522) (-239.665) [-237.580] -- 0:00:43
Average standard deviation of split frequencies: 0.013752
245500 -- (-240.262) [-237.193] (-241.137) (-238.423) * [-236.996] (-240.418) (-237.804) (-236.807) -- 0:00:43
246000 -- (-238.133) [-238.546] (-240.739) (-237.091) * [-236.680] (-239.137) (-238.942) (-241.660) -- 0:00:42
246500 -- [-237.184] (-240.843) (-242.228) (-241.570) * (-236.040) [-236.924] (-236.932) (-239.291) -- 0:00:42
247000 -- (-240.206) (-239.071) (-237.090) [-237.465] * [-238.319] (-238.822) (-240.142) (-239.963) -- 0:00:42
247500 -- (-238.084) (-238.348) [-239.542] (-236.761) * (-239.733) (-243.996) [-242.208] (-238.829) -- 0:00:42
248000 -- (-237.802) [-237.720] (-239.140) (-238.462) * (-238.412) (-238.522) (-240.288) [-240.325] -- 0:00:42
248500 -- (-236.639) (-243.089) (-239.017) [-237.945] * [-239.169] (-239.606) (-243.951) (-238.571) -- 0:00:42
249000 -- [-239.980] (-236.288) (-239.761) (-237.530) * [-238.057] (-236.816) (-242.453) (-238.638) -- 0:00:42
249500 -- (-238.545) [-241.232] (-239.903) (-240.160) * [-239.319] (-239.166) (-237.698) (-237.306) -- 0:00:42
250000 -- (-238.340) (-238.475) [-238.461] (-238.294) * (-240.686) [-238.414] (-240.201) (-237.925) -- 0:00:42
Average standard deviation of split frequencies: 0.014492
250500 -- (-236.004) (-237.930) [-239.110] (-239.925) * (-241.826) (-243.631) (-237.847) [-238.863] -- 0:00:44
251000 -- (-237.302) [-238.476] (-239.757) (-237.225) * (-238.879) (-237.674) (-237.149) [-236.981] -- 0:00:44
251500 -- [-239.516] (-237.459) (-240.653) (-238.600) * (-237.197) (-240.681) [-238.066] (-237.808) -- 0:00:44
252000 -- [-239.681] (-236.937) (-239.970) (-239.510) * (-238.496) [-238.184] (-240.809) (-237.463) -- 0:00:44
252500 -- (-238.443) [-236.661] (-238.778) (-237.632) * (-237.009) (-238.093) (-238.920) [-238.367] -- 0:00:44
253000 -- (-237.090) (-237.516) (-238.800) [-238.637] * (-246.727) [-238.918] (-239.500) (-237.080) -- 0:00:44
253500 -- (-240.764) (-238.721) (-238.666) [-238.222] * [-238.127] (-238.996) (-237.671) (-236.981) -- 0:00:44
254000 -- (-241.186) [-239.828] (-236.951) (-241.434) * (-237.654) (-240.269) [-239.758] (-236.644) -- 0:00:44
254500 -- [-236.508] (-242.935) (-237.346) (-238.606) * (-238.189) (-238.154) [-237.492] (-236.272) -- 0:00:43
255000 -- (-237.610) (-242.714) [-237.439] (-240.107) * (-241.089) (-241.483) (-236.964) [-237.781] -- 0:00:43
Average standard deviation of split frequencies: 0.014731
255500 -- (-240.236) (-244.680) [-237.324] (-236.555) * (-241.987) (-241.203) (-239.142) [-236.987] -- 0:00:43
256000 -- [-239.098] (-246.030) (-237.031) (-238.329) * (-240.234) (-246.597) (-240.532) [-237.303] -- 0:00:43
256500 -- (-237.887) (-241.592) [-240.023] (-239.615) * (-238.080) (-242.628) [-238.489] (-237.122) -- 0:00:43
257000 -- (-239.212) (-239.584) [-237.063] (-239.019) * (-238.715) (-241.245) (-240.197) [-238.352] -- 0:00:43
257500 -- (-237.256) (-239.425) (-237.711) [-239.756] * (-237.370) (-236.932) (-239.885) [-237.434] -- 0:00:43
258000 -- (-240.197) (-237.049) [-239.549] (-238.347) * [-237.438] (-238.495) (-243.204) (-237.248) -- 0:00:43
258500 -- (-240.192) (-238.504) [-236.768] (-237.040) * (-237.742) [-238.055] (-238.077) (-238.016) -- 0:00:43
259000 -- (-238.829) (-238.043) [-236.921] (-236.007) * [-236.643] (-237.845) (-237.966) (-240.157) -- 0:00:42
259500 -- (-238.989) (-238.507) [-237.525] (-240.831) * (-236.471) (-237.534) (-243.452) [-236.965] -- 0:00:42
260000 -- [-237.245] (-237.382) (-239.269) (-237.899) * [-236.331] (-237.228) (-241.767) (-239.531) -- 0:00:42
Average standard deviation of split frequencies: 0.014149
260500 -- (-240.398) (-243.599) [-244.153] (-236.742) * [-237.810] (-236.434) (-238.923) (-237.404) -- 0:00:42
261000 -- (-246.189) [-237.678] (-245.006) (-239.637) * (-240.551) (-240.429) [-239.679] (-236.521) -- 0:00:42
261500 -- (-243.074) (-238.685) (-238.789) [-240.509] * (-236.212) [-238.356] (-241.007) (-240.420) -- 0:00:42
262000 -- (-237.091) (-238.242) (-242.799) [-239.903] * (-236.921) (-242.150) [-237.084] (-240.662) -- 0:00:42
262500 -- [-239.981] (-236.555) (-241.784) (-239.504) * (-240.713) [-238.804] (-240.261) (-238.926) -- 0:00:42
263000 -- (-236.932) (-236.955) [-238.426] (-240.903) * (-241.546) (-239.037) (-236.848) [-244.290] -- 0:00:42
263500 -- (-237.511) (-237.568) [-244.165] (-238.489) * [-241.947] (-240.331) (-240.210) (-242.833) -- 0:00:41
264000 -- (-239.369) [-239.581] (-241.579) (-238.688) * [-235.979] (-237.067) (-237.649) (-238.168) -- 0:00:41
264500 -- (-237.979) (-239.141) [-241.866] (-237.455) * (-236.001) (-237.000) (-240.189) [-239.176] -- 0:00:41
265000 -- (-236.512) (-237.739) (-241.207) [-236.260] * [-237.390] (-238.625) (-240.475) (-238.200) -- 0:00:41
Average standard deviation of split frequencies: 0.014282
265500 -- (-239.088) (-239.215) (-246.275) [-238.133] * (-241.009) (-238.306) [-237.615] (-237.659) -- 0:00:41
266000 -- (-238.872) (-238.502) (-242.022) [-239.562] * (-240.899) (-238.633) [-238.902] (-242.331) -- 0:00:41
266500 -- (-237.664) [-239.013] (-239.536) (-239.613) * [-238.074] (-242.389) (-238.181) (-238.219) -- 0:00:41
267000 -- [-237.166] (-236.780) (-238.523) (-238.761) * [-236.531] (-239.242) (-238.762) (-238.183) -- 0:00:41
267500 -- (-238.050) (-237.815) [-239.316] (-237.914) * (-239.228) [-237.175] (-239.900) (-243.784) -- 0:00:43
268000 -- [-239.089] (-236.856) (-241.961) (-239.764) * (-238.304) (-236.551) [-236.721] (-239.675) -- 0:00:43
268500 -- (-239.731) [-236.027] (-242.504) (-236.755) * (-238.142) (-237.841) (-237.440) [-237.569] -- 0:00:43
269000 -- (-240.179) (-236.733) (-236.886) [-236.965] * (-236.970) (-239.092) [-238.732] (-238.089) -- 0:00:43
269500 -- (-238.614) [-237.231] (-237.011) (-237.981) * (-236.942) (-237.938) (-242.820) [-237.588] -- 0:00:43
270000 -- [-237.741] (-240.917) (-237.959) (-239.007) * (-242.900) [-237.676] (-244.335) (-238.603) -- 0:00:43
Average standard deviation of split frequencies: 0.013643
270500 -- (-238.206) [-236.356] (-236.336) (-240.938) * (-241.004) (-237.276) (-237.609) [-238.043] -- 0:00:43
271000 -- (-238.241) (-238.956) (-239.716) [-236.637] * (-240.246) (-240.606) [-238.377] (-239.550) -- 0:00:43
271500 -- (-238.692) [-237.053] (-238.013) (-238.400) * [-239.050] (-238.540) (-239.050) (-236.183) -- 0:00:42
272000 -- (-238.847) (-238.374) (-238.487) [-236.355] * (-239.456) [-240.146] (-239.822) (-237.349) -- 0:00:42
272500 -- (-236.487) (-243.076) (-238.890) [-238.987] * (-241.186) [-241.004] (-241.063) (-240.048) -- 0:00:42
273000 -- (-237.855) [-239.267] (-236.907) (-239.602) * (-241.137) (-237.766) [-238.773] (-238.741) -- 0:00:42
273500 -- (-236.878) (-238.590) [-237.439] (-237.773) * [-236.879] (-239.977) (-236.843) (-238.101) -- 0:00:42
274000 -- (-240.389) [-237.412] (-239.409) (-242.994) * [-237.583] (-237.087) (-236.237) (-241.668) -- 0:00:42
274500 -- (-236.877) (-238.196) (-238.001) [-238.388] * [-238.882] (-237.847) (-240.713) (-237.688) -- 0:00:42
275000 -- (-236.348) [-240.201] (-237.953) (-239.047) * (-239.582) [-238.085] (-239.581) (-238.895) -- 0:00:42
Average standard deviation of split frequencies: 0.012945
275500 -- (-236.856) (-236.909) [-240.308] (-238.673) * (-242.105) (-239.527) [-237.748] (-238.572) -- 0:00:42
276000 -- (-238.142) (-237.049) [-236.940] (-237.288) * [-237.931] (-242.911) (-236.967) (-237.216) -- 0:00:41
276500 -- (-238.265) (-239.277) (-237.338) [-237.555] * (-237.376) [-238.557] (-237.262) (-236.947) -- 0:00:41
277000 -- [-237.460] (-237.913) (-237.996) (-240.341) * (-237.246) (-237.312) [-237.945] (-238.838) -- 0:00:41
277500 -- (-240.362) [-240.872] (-241.712) (-239.960) * (-237.025) [-237.199] (-238.074) (-238.715) -- 0:00:41
278000 -- (-244.312) (-237.728) (-240.519) [-238.663] * (-237.706) (-236.764) (-238.999) [-238.836] -- 0:00:41
278500 -- (-237.277) (-242.355) (-239.842) [-238.661] * (-237.677) (-238.194) [-237.689] (-236.972) -- 0:00:41
279000 -- (-238.920) [-238.577] (-237.474) (-238.133) * (-238.414) (-240.800) (-237.172) [-238.509] -- 0:00:41
279500 -- (-244.945) [-238.202] (-236.997) (-237.133) * (-237.932) (-241.250) (-236.891) [-239.660] -- 0:00:41
280000 -- (-237.885) (-237.522) (-248.210) [-238.606] * (-237.832) (-238.919) [-237.068] (-239.914) -- 0:00:41
Average standard deviation of split frequencies: 0.013647
280500 -- (-239.482) (-238.977) [-240.251] (-237.157) * (-237.990) (-236.611) (-237.094) [-236.398] -- 0:00:41
281000 -- (-239.170) (-240.021) (-239.887) [-237.317] * [-241.156] (-238.373) (-238.054) (-237.888) -- 0:00:40
281500 -- (-238.759) [-237.107] (-239.612) (-237.452) * [-236.988] (-241.834) (-238.600) (-239.210) -- 0:00:40
282000 -- [-238.882] (-237.766) (-240.868) (-240.160) * (-237.989) (-237.163) [-240.415] (-239.504) -- 0:00:40
282500 -- (-236.748) (-238.575) [-239.134] (-240.684) * [-236.672] (-236.489) (-238.925) (-240.268) -- 0:00:40
283000 -- (-236.408) (-238.208) [-239.301] (-238.786) * (-238.084) (-237.413) (-242.363) [-239.453] -- 0:00:40
283500 -- [-239.238] (-240.479) (-237.604) (-240.156) * (-241.007) (-240.308) (-237.232) [-238.601] -- 0:00:40
284000 -- [-236.750] (-240.552) (-238.083) (-238.167) * (-239.373) [-237.660] (-236.268) (-241.281) -- 0:00:40
284500 -- [-237.400] (-237.795) (-237.682) (-238.258) * (-237.113) [-236.530] (-236.864) (-241.631) -- 0:00:40
285000 -- (-238.507) (-242.745) [-240.001] (-236.835) * (-236.512) (-237.734) [-236.851] (-239.014) -- 0:00:42
Average standard deviation of split frequencies: 0.013380
285500 -- (-239.957) (-237.619) [-237.658] (-237.170) * [-238.212] (-236.150) (-236.776) (-238.364) -- 0:00:42
286000 -- (-241.283) (-236.876) (-236.067) [-239.057] * (-238.776) [-236.586] (-238.676) (-240.071) -- 0:00:42
286500 -- [-243.146] (-237.710) (-238.575) (-235.960) * (-239.556) (-236.644) (-238.629) [-239.705] -- 0:00:42
287000 -- (-237.485) (-239.942) (-237.473) [-237.607] * (-241.974) (-236.764) (-238.945) [-236.660] -- 0:00:42
287500 -- (-237.960) (-240.497) (-236.071) [-239.969] * [-238.246] (-237.012) (-242.171) (-238.578) -- 0:00:42
288000 -- (-240.637) (-237.166) (-236.999) [-238.763] * (-239.294) [-237.956] (-238.330) (-237.834) -- 0:00:42
288500 -- (-239.613) [-238.868] (-237.769) (-237.108) * (-237.800) (-238.533) (-241.527) [-239.150] -- 0:00:41
289000 -- [-238.881] (-237.165) (-237.719) (-238.762) * (-241.066) [-238.119] (-236.939) (-242.974) -- 0:00:41
289500 -- (-244.116) (-237.490) (-238.659) [-237.346] * (-241.536) [-237.983] (-238.351) (-242.165) -- 0:00:41
290000 -- (-240.551) (-238.234) [-240.248] (-236.418) * (-239.793) [-237.661] (-239.023) (-238.923) -- 0:00:41
Average standard deviation of split frequencies: 0.013605
290500 -- (-236.177) (-238.703) (-239.012) [-239.779] * (-237.841) (-238.705) (-237.728) [-237.003] -- 0:00:41
291000 -- (-236.925) [-236.699] (-249.545) (-238.375) * [-237.644] (-238.594) (-238.953) (-238.731) -- 0:00:41
291500 -- (-240.205) (-239.382) [-237.445] (-238.044) * (-241.951) [-239.519] (-239.716) (-238.891) -- 0:00:41
292000 -- (-238.270) (-238.396) (-237.595) [-236.954] * (-237.667) (-240.264) (-236.118) [-237.070] -- 0:00:41
292500 -- (-241.615) (-236.912) (-243.395) [-237.514] * [-236.247] (-239.258) (-238.022) (-236.945) -- 0:00:41
293000 -- (-238.714) (-237.524) (-237.567) [-236.494] * (-238.628) (-237.626) (-236.807) [-241.103] -- 0:00:41
293500 -- (-238.997) [-236.793] (-238.990) (-237.992) * (-236.410) (-237.167) [-236.336] (-241.806) -- 0:00:40
294000 -- (-239.242) (-236.593) (-240.811) [-238.842] * (-236.070) (-236.782) [-236.423] (-237.453) -- 0:00:40
294500 -- [-238.570] (-239.383) (-236.739) (-242.660) * (-236.382) (-237.312) [-237.486] (-237.199) -- 0:00:40
295000 -- [-238.524] (-240.305) (-238.848) (-238.791) * (-237.662) [-237.459] (-238.221) (-237.882) -- 0:00:40
Average standard deviation of split frequencies: 0.013272
295500 -- (-239.901) (-238.132) [-239.022] (-238.970) * (-238.874) [-236.753] (-238.300) (-237.743) -- 0:00:40
296000 -- [-245.280] (-238.869) (-238.045) (-237.399) * [-238.468] (-238.920) (-238.205) (-239.422) -- 0:00:40
296500 -- (-237.970) (-236.958) [-236.522] (-238.678) * (-240.796) [-237.232] (-238.383) (-236.825) -- 0:00:40
297000 -- (-237.733) [-238.138] (-239.838) (-238.290) * [-239.312] (-237.124) (-237.294) (-244.247) -- 0:00:40
297500 -- (-238.677) (-238.309) (-236.767) [-238.151] * (-238.961) (-236.548) [-238.096] (-241.458) -- 0:00:40
298000 -- [-238.908] (-238.134) (-236.772) (-236.571) * (-239.450) [-236.412] (-239.259) (-238.829) -- 0:00:40
298500 -- (-242.862) (-238.076) (-239.892) [-238.828] * [-239.318] (-240.368) (-239.056) (-239.061) -- 0:00:39
299000 -- (-237.012) [-237.646] (-237.543) (-237.571) * [-237.218] (-240.360) (-237.517) (-236.434) -- 0:00:39
299500 -- [-236.972] (-236.922) (-238.810) (-238.971) * [-240.306] (-237.886) (-238.439) (-240.022) -- 0:00:39
300000 -- (-236.921) [-236.381] (-241.519) (-238.119) * (-237.995) (-238.656) (-237.329) [-241.903] -- 0:00:39
Average standard deviation of split frequencies: 0.012717
300500 -- (-237.492) (-237.654) (-246.610) [-237.460] * [-238.296] (-238.340) (-241.398) (-239.352) -- 0:00:39
301000 -- (-237.337) (-238.899) (-240.342) [-237.573] * [-237.984] (-240.093) (-239.419) (-238.020) -- 0:00:39
301500 -- (-238.094) [-238.916] (-235.953) (-237.615) * [-239.630] (-238.433) (-237.636) (-247.246) -- 0:00:39
302000 -- [-237.195] (-241.053) (-236.872) (-239.562) * (-238.701) [-238.732] (-238.056) (-241.758) -- 0:00:41
302500 -- [-237.880] (-239.494) (-238.464) (-243.878) * (-237.891) (-243.049) (-238.830) [-236.381] -- 0:00:41
303000 -- (-238.876) [-238.088] (-240.138) (-240.029) * [-236.408] (-241.447) (-240.525) (-238.474) -- 0:00:41
303500 -- [-236.799] (-239.223) (-240.619) (-243.149) * [-238.223] (-239.399) (-238.654) (-238.375) -- 0:00:41
304000 -- (-238.484) [-242.454] (-236.778) (-237.770) * (-238.204) [-238.015] (-240.541) (-237.606) -- 0:00:41
304500 -- (-237.690) (-238.676) (-237.953) [-240.155] * (-240.545) (-238.976) (-237.069) [-236.286] -- 0:00:41
305000 -- (-239.773) (-238.483) [-239.623] (-238.225) * (-237.079) [-238.937] (-240.215) (-236.278) -- 0:00:41
Average standard deviation of split frequencies: 0.012068
305500 -- (-237.708) [-236.997] (-238.162) (-237.209) * (-237.275) (-236.895) (-240.426) [-240.633] -- 0:00:40
306000 -- (-238.475) (-236.466) [-240.847] (-237.598) * (-239.925) (-239.100) [-237.954] (-239.445) -- 0:00:40
306500 -- (-237.078) (-239.386) [-237.052] (-237.130) * [-236.470] (-237.198) (-239.137) (-236.692) -- 0:00:40
307000 -- (-236.496) (-239.310) [-237.557] (-238.429) * [-237.383] (-236.473) (-237.084) (-236.436) -- 0:00:40
307500 -- (-237.643) [-237.611] (-241.972) (-238.579) * (-238.648) (-238.845) (-240.902) [-238.243] -- 0:00:40
308000 -- (-236.750) (-240.597) (-240.924) [-238.169] * [-238.841] (-241.072) (-239.712) (-240.545) -- 0:00:40
308500 -- (-236.718) (-238.212) [-237.605] (-237.391) * (-238.514) (-245.919) (-241.140) [-240.382] -- 0:00:40
309000 -- (-237.594) (-236.794) (-239.209) [-238.376] * (-237.763) [-238.093] (-238.189) (-236.790) -- 0:00:40
309500 -- (-237.876) [-236.530] (-243.259) (-236.340) * [-236.700] (-237.128) (-237.900) (-236.922) -- 0:00:40
310000 -- (-237.736) [-238.479] (-237.844) (-236.634) * (-238.925) [-237.367] (-238.365) (-237.133) -- 0:00:40
Average standard deviation of split frequencies: 0.010979
310500 -- (-238.432) [-238.012] (-240.279) (-237.522) * (-236.044) (-238.813) [-237.747] (-238.346) -- 0:00:39
311000 -- [-243.037] (-236.870) (-239.875) (-241.563) * (-236.486) (-238.699) (-239.423) [-241.869] -- 0:00:39
311500 -- (-237.573) (-237.978) [-239.284] (-239.740) * (-237.609) (-241.541) [-237.235] (-240.275) -- 0:00:39
312000 -- (-237.028) [-238.660] (-237.416) (-239.189) * [-236.774] (-244.021) (-237.217) (-242.464) -- 0:00:39
312500 -- [-236.837] (-237.948) (-239.747) (-240.312) * (-237.559) (-241.080) [-238.490] (-237.557) -- 0:00:39
313000 -- (-238.790) [-237.912] (-237.516) (-237.548) * (-238.607) (-238.121) [-238.879] (-240.360) -- 0:00:39
313500 -- (-237.338) [-238.939] (-237.934) (-238.697) * (-238.006) (-236.054) [-236.997] (-239.938) -- 0:00:39
314000 -- (-238.473) (-244.848) [-242.444] (-236.946) * (-237.249) [-239.247] (-237.533) (-239.863) -- 0:00:39
314500 -- (-241.047) (-237.981) (-238.870) [-239.316] * (-238.172) [-242.495] (-241.782) (-239.864) -- 0:00:39
315000 -- (-239.294) (-236.858) (-236.510) [-237.132] * (-241.099) [-237.721] (-237.701) (-241.207) -- 0:00:39
Average standard deviation of split frequencies: 0.010706
315500 -- (-236.320) (-241.131) (-246.326) [-236.826] * (-236.916) (-238.317) [-237.473] (-241.425) -- 0:00:39
316000 -- (-238.323) [-237.130] (-237.455) (-238.262) * (-236.537) (-238.357) [-240.553] (-240.714) -- 0:00:38
316500 -- [-239.358] (-238.521) (-240.703) (-240.638) * (-239.174) (-238.946) [-239.322] (-237.746) -- 0:00:38
317000 -- (-238.681) (-237.489) [-238.597] (-236.795) * [-242.350] (-237.310) (-238.868) (-238.771) -- 0:00:38
317500 -- (-239.027) (-239.297) (-239.800) [-239.162] * [-242.420] (-237.133) (-238.188) (-240.124) -- 0:00:38
318000 -- (-242.106) (-238.684) [-237.619] (-237.811) * (-244.439) [-236.706] (-237.411) (-237.007) -- 0:00:38
318500 -- (-239.317) (-237.888) (-237.887) [-238.177] * [-237.229] (-237.695) (-236.158) (-237.152) -- 0:00:38
319000 -- [-239.430] (-237.525) (-238.078) (-236.306) * (-237.093) [-239.422] (-236.465) (-240.001) -- 0:00:38
319500 -- (-238.288) (-237.487) (-239.273) [-240.169] * (-238.653) (-240.496) (-237.333) [-238.642] -- 0:00:40
320000 -- [-237.792] (-237.202) (-237.507) (-238.829) * (-238.608) (-240.641) (-237.220) [-237.014] -- 0:00:40
Average standard deviation of split frequencies: 0.010982
320500 -- [-238.355] (-237.280) (-238.324) (-239.596) * (-239.507) (-239.215) (-237.154) [-237.465] -- 0:00:40
321000 -- [-237.840] (-238.473) (-238.658) (-238.933) * [-238.607] (-238.092) (-237.267) (-237.545) -- 0:00:40
321500 -- [-236.904] (-245.448) (-236.433) (-240.807) * (-243.320) (-239.447) [-239.235] (-237.904) -- 0:00:40
322000 -- [-238.804] (-237.169) (-236.898) (-237.279) * (-237.120) (-241.656) (-240.658) [-237.170] -- 0:00:40
322500 -- [-238.595] (-237.898) (-236.560) (-239.083) * (-238.769) (-244.079) [-238.948] (-239.212) -- 0:00:39
323000 -- (-238.228) (-239.105) [-237.003] (-239.066) * (-241.130) (-238.757) (-237.877) [-237.528] -- 0:00:39
323500 -- (-238.685) (-238.620) (-239.617) [-240.123] * (-239.516) [-238.295] (-237.690) (-237.822) -- 0:00:39
324000 -- (-237.892) [-239.366] (-238.474) (-236.918) * [-237.100] (-238.324) (-236.296) (-237.127) -- 0:00:39
324500 -- (-236.864) (-238.908) (-243.540) [-240.858] * (-237.119) [-236.407] (-238.627) (-237.083) -- 0:00:39
325000 -- (-237.879) [-237.553] (-241.420) (-240.304) * (-236.437) [-238.777] (-236.123) (-242.467) -- 0:00:39
Average standard deviation of split frequencies: 0.011387
325500 -- (-236.887) (-236.761) [-238.100] (-241.511) * (-239.290) [-241.527] (-240.483) (-242.948) -- 0:00:39
326000 -- (-238.168) (-240.638) [-240.287] (-238.561) * (-242.440) [-239.352] (-240.842) (-238.169) -- 0:00:39
326500 -- [-239.657] (-239.131) (-237.846) (-237.451) * (-240.938) [-236.039] (-240.489) (-241.631) -- 0:00:39
327000 -- (-240.123) (-246.681) [-239.005] (-238.603) * (-237.492) (-239.249) [-236.354] (-239.157) -- 0:00:39
327500 -- (-240.181) [-237.904] (-237.515) (-239.949) * (-237.968) (-239.067) [-238.415] (-238.534) -- 0:00:39
328000 -- (-240.880) [-239.141] (-239.180) (-236.364) * (-239.283) (-240.418) [-237.090] (-237.660) -- 0:00:38
328500 -- (-242.791) [-238.953] (-238.136) (-237.447) * (-238.482) (-238.246) [-236.995] (-236.046) -- 0:00:38
329000 -- (-240.910) (-239.946) [-239.685] (-240.060) * (-237.948) (-237.165) [-237.086] (-240.006) -- 0:00:38
329500 -- [-239.129] (-238.936) (-236.261) (-239.566) * (-236.566) [-236.741] (-239.829) (-237.393) -- 0:00:38
330000 -- (-239.529) (-238.329) (-237.851) [-240.143] * (-238.203) (-241.200) [-237.676] (-237.140) -- 0:00:38
Average standard deviation of split frequencies: 0.011850
330500 -- (-239.132) (-238.109) (-239.094) [-240.098] * [-238.071] (-238.287) (-239.266) (-237.745) -- 0:00:38
331000 -- [-239.772] (-240.363) (-243.976) (-237.381) * (-244.051) [-238.784] (-236.681) (-237.478) -- 0:00:38
331500 -- (-243.425) (-237.360) [-238.196] (-239.475) * (-242.828) (-241.939) [-238.409] (-238.077) -- 0:00:38
332000 -- (-238.892) (-237.910) [-236.787] (-236.898) * (-238.308) (-238.297) [-237.520] (-240.028) -- 0:00:38
332500 -- (-239.442) (-237.301) [-238.043] (-238.885) * [-237.877] (-236.978) (-237.423) (-239.821) -- 0:00:38
333000 -- (-237.938) [-239.076] (-237.256) (-241.562) * [-239.231] (-240.309) (-238.266) (-238.760) -- 0:00:38
333500 -- (-238.471) (-241.896) (-239.126) [-238.355] * (-238.859) (-239.266) [-238.480] (-237.391) -- 0:00:37
334000 -- (-238.582) (-239.340) (-239.173) [-237.844] * (-239.638) (-238.052) (-237.093) [-238.333] -- 0:00:37
334500 -- [-239.278] (-236.294) (-239.708) (-238.088) * [-238.987] (-239.180) (-236.736) (-238.028) -- 0:00:37
335000 -- (-237.715) [-238.384] (-236.999) (-236.768) * (-236.608) (-239.142) [-238.140] (-238.513) -- 0:00:37
Average standard deviation of split frequencies: 0.010961
335500 -- [-238.442] (-238.833) (-238.668) (-237.142) * (-237.139) (-239.183) [-237.527] (-238.335) -- 0:00:37
336000 -- (-238.214) (-239.120) [-236.021] (-237.416) * (-238.943) [-236.779] (-239.862) (-236.871) -- 0:00:37
336500 -- (-240.003) (-237.695) [-237.407] (-238.092) * (-238.367) (-238.947) [-238.174] (-241.451) -- 0:00:39
337000 -- (-237.908) (-238.733) [-242.492] (-237.769) * (-236.847) (-239.012) [-242.102] (-236.722) -- 0:00:39
337500 -- (-240.949) [-237.134] (-236.814) (-236.883) * (-237.476) (-236.250) (-242.171) [-236.553] -- 0:00:39
338000 -- (-238.641) [-237.089] (-237.936) (-238.795) * (-236.949) [-236.480] (-240.246) (-238.716) -- 0:00:39
338500 -- (-239.660) (-238.357) [-237.887] (-241.847) * (-238.866) [-238.033] (-239.889) (-238.367) -- 0:00:39
339000 -- (-240.464) (-237.968) [-238.199] (-239.228) * (-237.554) [-237.830] (-236.834) (-236.805) -- 0:00:38
339500 -- [-238.462] (-239.518) (-238.681) (-239.548) * (-240.738) [-236.534] (-236.243) (-238.201) -- 0:00:38
340000 -- [-236.732] (-239.238) (-239.606) (-237.641) * (-239.779) [-238.623] (-238.274) (-236.457) -- 0:00:38
Average standard deviation of split frequencies: 0.009773
340500 -- (-236.555) (-237.158) [-237.826] (-239.010) * (-238.173) (-241.536) (-238.838) [-236.932] -- 0:00:38
341000 -- (-238.334) [-238.169] (-245.170) (-238.531) * [-238.345] (-239.875) (-239.225) (-239.918) -- 0:00:38
341500 -- (-240.362) [-237.638] (-239.409) (-239.866) * [-240.473] (-240.894) (-237.988) (-236.437) -- 0:00:38
342000 -- (-237.105) (-244.469) [-238.169] (-242.495) * [-237.918] (-238.985) (-239.156) (-240.953) -- 0:00:38
342500 -- (-240.318) (-240.591) (-242.430) [-243.443] * (-238.938) (-238.068) (-242.991) [-239.411] -- 0:00:38
343000 -- (-238.315) [-238.871] (-240.891) (-238.867) * (-243.468) [-237.303] (-236.072) (-239.012) -- 0:00:38
343500 -- (-239.513) (-237.330) [-238.747] (-237.874) * (-238.939) (-237.782) [-238.373] (-238.601) -- 0:00:38
344000 -- (-240.667) [-239.342] (-237.830) (-240.864) * [-237.467] (-239.522) (-237.625) (-238.147) -- 0:00:38
344500 -- (-238.270) (-241.494) [-236.452] (-240.844) * [-236.704] (-238.024) (-239.110) (-240.793) -- 0:00:38
345000 -- (-237.961) (-241.241) (-240.960) [-238.644] * (-240.621) (-237.000) [-236.806] (-238.291) -- 0:00:37
Average standard deviation of split frequencies: 0.009617
345500 -- (-236.652) (-241.604) [-238.372] (-236.898) * (-237.947) (-236.761) [-237.077] (-237.544) -- 0:00:37
346000 -- (-240.337) (-241.650) (-237.150) [-237.537] * (-237.707) [-240.079] (-237.857) (-237.097) -- 0:00:37
346500 -- (-247.237) [-237.349] (-238.219) (-239.594) * [-236.432] (-237.973) (-237.553) (-238.468) -- 0:00:37
347000 -- [-237.577] (-237.165) (-243.461) (-237.908) * (-237.566) [-236.136] (-237.209) (-240.681) -- 0:00:37
347500 -- (-237.031) (-237.747) (-240.549) [-237.128] * (-237.759) (-238.347) [-238.800] (-240.953) -- 0:00:37
348000 -- [-237.849] (-239.037) (-241.739) (-238.484) * [-241.432] (-240.124) (-236.087) (-239.924) -- 0:00:37
348500 -- [-236.580] (-236.956) (-240.544) (-238.170) * (-238.032) (-238.532) [-240.192] (-237.285) -- 0:00:37
349000 -- (-241.218) [-237.007] (-239.029) (-239.485) * (-238.912) [-237.196] (-236.062) (-239.261) -- 0:00:37
349500 -- [-236.470] (-237.058) (-240.961) (-239.146) * (-237.636) (-237.909) [-239.778] (-240.491) -- 0:00:37
350000 -- [-236.250] (-237.287) (-237.098) (-236.954) * [-239.425] (-241.301) (-238.123) (-241.473) -- 0:00:37
Average standard deviation of split frequencies: 0.009885
350500 -- (-236.656) [-241.995] (-236.301) (-241.762) * (-237.378) (-238.382) [-239.120] (-237.818) -- 0:00:37
351000 -- (-240.038) (-239.232) (-240.152) [-239.969] * (-240.971) (-239.753) [-237.291] (-237.197) -- 0:00:36
351500 -- (-238.470) [-236.723] (-238.312) (-237.746) * (-240.907) (-239.255) (-237.416) [-237.255] -- 0:00:36
352000 -- (-240.739) (-236.993) [-237.738] (-238.188) * (-238.748) [-237.585] (-239.851) (-236.900) -- 0:00:36
352500 -- (-238.631) (-241.345) (-236.361) [-237.426] * (-241.033) (-239.248) [-238.722] (-241.298) -- 0:00:36
353000 -- (-238.740) [-242.484] (-236.836) (-237.458) * (-238.644) (-236.247) [-237.298] (-239.993) -- 0:00:36
353500 -- (-238.898) [-241.660] (-238.250) (-239.425) * [-238.492] (-237.871) (-237.563) (-241.277) -- 0:00:38
354000 -- (-246.510) (-243.281) [-237.503] (-237.137) * (-238.623) (-239.785) [-238.810] (-247.059) -- 0:00:38
354500 -- (-238.321) [-241.472] (-238.410) (-236.097) * (-241.674) (-239.753) (-240.086) [-236.883] -- 0:00:38
355000 -- (-238.600) (-237.814) [-240.524] (-237.001) * (-238.127) [-237.831] (-238.069) (-243.364) -- 0:00:38
Average standard deviation of split frequencies: 0.010180
355500 -- (-237.483) [-239.173] (-237.191) (-240.282) * [-239.222] (-238.101) (-238.573) (-241.284) -- 0:00:38
356000 -- [-236.623] (-239.398) (-238.671) (-239.781) * (-238.134) [-240.522] (-238.771) (-237.277) -- 0:00:37
356500 -- (-238.982) [-238.167] (-239.703) (-239.851) * (-238.280) (-238.175) [-241.052] (-240.912) -- 0:00:37
357000 -- (-238.325) [-239.919] (-236.682) (-237.623) * (-237.325) (-236.927) (-238.028) [-238.375] -- 0:00:37
357500 -- (-236.632) (-238.446) (-239.677) [-239.020] * [-237.826] (-237.758) (-239.050) (-238.498) -- 0:00:37
358000 -- (-236.994) [-237.266] (-243.823) (-237.099) * (-239.519) [-238.276] (-238.640) (-240.442) -- 0:00:37
358500 -- (-241.700) (-237.370) (-239.429) [-238.694] * [-237.084] (-238.336) (-237.553) (-238.537) -- 0:00:37
359000 -- (-240.848) [-236.424] (-238.320) (-236.885) * (-239.598) (-241.279) (-238.805) [-239.168] -- 0:00:37
359500 -- (-239.034) [-236.462] (-237.948) (-241.319) * (-238.332) [-239.482] (-237.737) (-240.585) -- 0:00:37
360000 -- (-237.823) (-237.954) [-237.867] (-238.771) * (-238.146) [-239.408] (-241.338) (-241.005) -- 0:00:37
Average standard deviation of split frequencies: 0.010108
360500 -- (-236.681) (-236.494) (-237.282) [-237.150] * (-237.833) (-237.153) [-242.614] (-239.857) -- 0:00:37
361000 -- (-237.973) (-237.195) (-239.931) [-239.494] * (-238.416) [-237.646] (-239.510) (-237.642) -- 0:00:37
361500 -- (-240.475) [-239.306] (-240.606) (-240.622) * (-240.630) (-239.320) [-239.414] (-238.424) -- 0:00:37
362000 -- (-238.596) (-238.216) [-242.345] (-237.750) * (-237.847) [-238.325] (-240.743) (-239.638) -- 0:00:37
362500 -- (-238.842) (-238.337) (-241.594) [-238.173] * (-238.654) [-238.034] (-242.389) (-237.512) -- 0:00:36
363000 -- [-239.733] (-242.445) (-238.903) (-237.504) * (-237.286) (-237.643) [-236.294] (-241.083) -- 0:00:36
363500 -- (-241.335) (-242.670) (-238.259) [-236.119] * (-240.975) (-241.944) (-236.433) [-238.459] -- 0:00:36
364000 -- [-238.898] (-240.298) (-237.698) (-241.088) * (-241.668) [-238.508] (-236.890) (-237.757) -- 0:00:36
364500 -- (-239.980) (-239.290) [-241.801] (-237.427) * (-239.592) [-238.485] (-239.530) (-238.873) -- 0:00:36
365000 -- (-241.768) (-240.145) [-237.034] (-239.983) * (-239.190) [-242.085] (-237.125) (-237.084) -- 0:00:36
Average standard deviation of split frequencies: 0.009875
365500 -- (-239.072) [-239.531] (-242.106) (-240.528) * (-241.806) [-237.181] (-236.948) (-239.929) -- 0:00:36
366000 -- (-238.783) (-237.478) [-238.323] (-238.761) * (-236.939) [-236.675] (-237.128) (-238.026) -- 0:00:36
366500 -- (-236.785) (-238.017) [-240.027] (-238.715) * (-237.794) (-237.171) [-236.404] (-237.607) -- 0:00:36
367000 -- [-237.397] (-239.426) (-243.396) (-241.646) * (-238.656) (-239.352) [-239.054] (-238.280) -- 0:00:36
367500 -- (-238.450) (-242.339) (-243.955) [-242.396] * (-236.908) [-238.150] (-236.731) (-238.515) -- 0:00:36
368000 -- [-239.738] (-243.566) (-236.431) (-238.952) * [-236.741] (-240.527) (-238.089) (-237.066) -- 0:00:36
368500 -- (-239.455) [-237.428] (-237.699) (-238.846) * (-238.546) [-238.224] (-242.403) (-238.355) -- 0:00:35
369000 -- (-240.794) [-238.908] (-237.689) (-240.001) * (-240.310) [-236.819] (-240.418) (-237.381) -- 0:00:35
369500 -- (-239.971) [-239.360] (-240.279) (-237.571) * [-238.553] (-236.622) (-238.355) (-237.035) -- 0:00:35
370000 -- (-237.004) (-237.127) (-240.714) [-237.323] * (-237.189) [-236.770] (-237.399) (-236.253) -- 0:00:35
Average standard deviation of split frequencies: 0.009411
370500 -- (-238.331) (-238.577) (-237.921) [-238.672] * (-241.491) (-237.783) [-237.905] (-239.888) -- 0:00:35
371000 -- [-236.805] (-240.015) (-237.157) (-238.411) * (-237.389) [-238.236] (-237.521) (-240.715) -- 0:00:37
371500 -- (-240.188) [-238.702] (-237.104) (-240.675) * (-237.615) (-242.304) (-237.427) [-236.761] -- 0:00:37
372000 -- (-238.814) (-239.884) (-236.243) [-240.479] * (-237.255) [-238.894] (-237.243) (-238.391) -- 0:00:37
372500 -- (-236.940) [-237.711] (-239.615) (-237.831) * (-236.848) (-238.693) (-236.923) [-237.065] -- 0:00:37
373000 -- (-239.779) (-236.565) (-239.725) [-237.126] * (-240.447) [-236.852] (-237.625) (-239.878) -- 0:00:36
373500 -- (-237.343) (-238.175) [-242.214] (-240.436) * [-237.573] (-236.388) (-236.204) (-236.908) -- 0:00:36
374000 -- (-239.944) (-238.048) (-239.518) [-236.556] * (-237.349) [-236.212] (-238.218) (-236.250) -- 0:00:36
374500 -- [-237.804] (-237.265) (-238.526) (-236.831) * (-239.467) (-239.729) (-239.859) [-239.120] -- 0:00:36
375000 -- [-237.924] (-237.310) (-238.684) (-238.556) * (-237.564) (-237.017) [-237.258] (-238.526) -- 0:00:36
Average standard deviation of split frequencies: 0.010448
375500 -- (-241.183) (-236.569) (-238.109) [-238.286] * [-237.155] (-237.579) (-236.784) (-239.776) -- 0:00:36
376000 -- (-237.417) (-236.751) (-241.256) [-238.022] * [-238.735] (-238.203) (-238.603) (-240.360) -- 0:00:36
376500 -- (-236.770) [-237.689] (-238.830) (-240.979) * (-237.510) (-238.576) [-239.354] (-236.023) -- 0:00:36
377000 -- (-236.080) (-239.871) [-239.113] (-242.822) * [-236.917] (-238.299) (-241.737) (-237.539) -- 0:00:36
377500 -- (-238.799) [-238.169] (-238.396) (-242.269) * [-237.698] (-238.301) (-240.008) (-237.200) -- 0:00:36
378000 -- [-240.898] (-241.176) (-237.896) (-238.117) * [-238.747] (-237.829) (-238.757) (-238.294) -- 0:00:36
378500 -- (-240.683) (-236.898) [-237.964] (-236.620) * (-240.470) (-237.824) (-238.815) [-238.692] -- 0:00:36
379000 -- (-237.987) (-236.274) [-237.948] (-238.856) * (-238.622) [-237.032] (-236.050) (-238.652) -- 0:00:36
379500 -- (-237.971) (-237.037) [-238.160] (-239.888) * [-237.214] (-237.333) (-236.410) (-237.730) -- 0:00:35
380000 -- (-237.702) [-241.688] (-240.510) (-238.845) * (-239.785) (-240.174) (-238.882) [-238.196] -- 0:00:35
Average standard deviation of split frequencies: 0.009907
380500 -- [-238.925] (-244.543) (-238.838) (-236.928) * (-238.333) (-238.991) [-237.237] (-238.875) -- 0:00:35
381000 -- [-237.831] (-241.456) (-239.582) (-236.941) * [-237.575] (-236.690) (-236.252) (-240.431) -- 0:00:35
381500 -- (-237.154) (-239.548) (-236.946) [-239.797] * [-238.121] (-241.113) (-238.905) (-238.255) -- 0:00:35
382000 -- (-237.931) [-238.235] (-239.223) (-241.229) * (-237.727) (-238.384) (-240.944) [-239.764] -- 0:00:35
382500 -- (-237.476) (-237.245) [-239.486] (-238.535) * (-241.538) (-237.089) [-239.412] (-238.275) -- 0:00:35
383000 -- (-239.302) [-236.907] (-236.692) (-237.255) * (-236.434) [-238.488] (-239.183) (-237.372) -- 0:00:35
383500 -- [-238.595] (-236.485) (-241.154) (-237.443) * [-236.699] (-237.105) (-238.168) (-236.517) -- 0:00:35
384000 -- (-244.860) [-239.390] (-239.663) (-240.888) * (-239.423) (-242.861) [-238.231] (-238.871) -- 0:00:35
384500 -- (-238.394) (-240.321) (-245.207) [-238.104] * (-237.443) (-245.068) (-236.472) [-236.849] -- 0:00:35
385000 -- (-240.152) [-237.691] (-241.208) (-237.410) * (-238.929) (-236.978) (-237.300) [-238.875] -- 0:00:35
Average standard deviation of split frequencies: 0.010762
385500 -- [-238.804] (-237.115) (-239.266) (-238.580) * [-242.251] (-236.678) (-241.435) (-239.894) -- 0:00:35
386000 -- (-245.320) (-242.063) (-240.932) [-240.289] * (-236.829) [-237.044] (-243.157) (-240.570) -- 0:00:34
386500 -- (-238.410) (-236.426) (-242.531) [-239.199] * (-239.643) [-236.825] (-238.143) (-238.009) -- 0:00:34
387000 -- (-238.917) [-237.942] (-239.208) (-236.829) * (-238.283) (-237.596) (-237.082) [-238.850] -- 0:00:34
387500 -- (-237.965) [-239.361] (-240.354) (-238.883) * [-239.143] (-240.380) (-237.925) (-238.873) -- 0:00:34
388000 -- (-237.714) (-240.236) [-239.217] (-239.203) * (-238.933) (-239.064) (-238.909) [-236.650] -- 0:00:34
388500 -- (-236.237) [-239.949] (-246.740) (-237.100) * [-236.315] (-240.683) (-242.274) (-244.209) -- 0:00:36
389000 -- (-237.172) (-237.866) [-237.711] (-236.806) * [-239.023] (-238.573) (-237.625) (-239.826) -- 0:00:36
389500 -- (-238.313) (-236.983) (-237.690) [-235.986] * (-239.306) [-237.170] (-239.048) (-239.116) -- 0:00:36
390000 -- (-237.602) (-237.681) (-237.241) [-239.360] * [-236.847] (-239.817) (-244.485) (-241.130) -- 0:00:35
Average standard deviation of split frequencies: 0.010434
390500 -- (-241.531) [-238.057] (-241.808) (-237.620) * (-243.079) (-238.280) [-237.304] (-239.571) -- 0:00:35
391000 -- (-238.663) [-238.715] (-240.193) (-239.746) * (-239.155) (-236.848) [-237.736] (-238.143) -- 0:00:35
391500 -- (-236.921) (-236.258) [-238.614] (-237.844) * (-240.608) [-237.593] (-240.034) (-240.155) -- 0:00:35
392000 -- (-236.508) (-243.217) [-237.757] (-237.736) * (-237.063) (-239.928) (-236.071) [-242.763] -- 0:00:35
392500 -- (-239.087) [-236.898] (-239.820) (-236.752) * [-236.775] (-236.899) (-236.569) (-237.206) -- 0:00:35
393000 -- (-238.077) (-237.829) (-240.083) [-236.711] * (-237.840) (-241.456) [-236.099] (-237.234) -- 0:00:35
393500 -- (-237.764) (-243.830) (-239.915) [-239.205] * (-237.591) (-240.450) (-237.328) [-238.233] -- 0:00:35
394000 -- [-236.966] (-238.425) (-240.331) (-238.096) * (-237.877) (-243.191) (-237.402) [-238.066] -- 0:00:35
394500 -- (-236.545) (-239.246) (-242.714) [-239.167] * (-237.458) (-243.008) [-237.533] (-239.625) -- 0:00:35
395000 -- (-238.996) [-240.283] (-239.293) (-239.544) * [-235.940] (-240.475) (-236.935) (-238.309) -- 0:00:35
Average standard deviation of split frequencies: 0.011134
395500 -- (-236.959) (-237.724) (-241.026) [-238.175] * (-237.770) (-238.455) [-238.392] (-242.939) -- 0:00:35
396000 -- (-237.028) (-239.737) [-240.862] (-237.898) * (-237.883) [-239.226] (-245.275) (-236.658) -- 0:00:35
396500 -- [-239.090] (-240.271) (-237.016) (-242.206) * [-237.366] (-238.043) (-238.928) (-237.498) -- 0:00:35
397000 -- [-238.021] (-240.346) (-239.520) (-237.949) * (-237.540) [-237.153] (-236.937) (-240.391) -- 0:00:34
397500 -- (-237.705) (-237.156) [-237.972] (-239.122) * (-236.705) (-240.515) [-237.542] (-238.883) -- 0:00:34
398000 -- [-238.802] (-238.983) (-238.762) (-238.556) * (-238.544) (-239.865) (-236.391) [-238.013] -- 0:00:34
398500 -- (-238.903) (-240.012) (-236.701) [-238.861] * (-240.683) (-237.808) [-239.108] (-238.831) -- 0:00:34
399000 -- (-238.840) [-237.460] (-237.969) (-236.789) * (-239.982) (-240.233) [-236.362] (-239.766) -- 0:00:34
399500 -- (-239.055) (-238.317) (-240.301) [-238.060] * (-239.443) [-239.168] (-238.289) (-239.455) -- 0:00:34
400000 -- (-236.023) (-238.894) [-238.216] (-242.374) * [-239.821] (-238.619) (-237.382) (-238.451) -- 0:00:34
Average standard deviation of split frequencies: 0.011073
400500 -- (-235.950) (-237.386) [-242.225] (-238.597) * [-237.965] (-241.123) (-237.105) (-236.946) -- 0:00:34
401000 -- (-238.284) (-242.249) (-239.205) [-237.677] * [-236.944] (-239.542) (-237.782) (-236.523) -- 0:00:34
401500 -- (-238.511) (-237.619) (-239.407) [-237.150] * (-237.386) [-237.814] (-237.395) (-242.451) -- 0:00:34
402000 -- [-239.211] (-237.316) (-239.079) (-238.960) * [-238.190] (-237.991) (-238.128) (-239.487) -- 0:00:34
402500 -- (-236.765) (-238.034) [-236.652] (-239.007) * (-238.417) (-242.124) (-239.536) [-239.453] -- 0:00:34
403000 -- (-236.932) [-237.317] (-242.648) (-237.106) * [-237.593] (-239.604) (-238.145) (-239.140) -- 0:00:34
403500 -- (-237.466) (-237.656) (-236.314) [-239.213] * (-236.451) [-239.713] (-239.972) (-237.746) -- 0:00:34
404000 -- (-238.623) [-237.934] (-238.198) (-238.747) * (-236.618) (-240.771) (-238.220) [-239.953] -- 0:00:33
404500 -- [-239.403] (-237.525) (-237.921) (-240.689) * (-236.773) [-238.358] (-237.283) (-238.896) -- 0:00:33
405000 -- (-237.763) [-237.564] (-237.288) (-239.211) * [-237.514] (-238.106) (-237.395) (-236.565) -- 0:00:33
Average standard deviation of split frequencies: 0.011201
405500 -- [-238.451] (-238.349) (-238.732) (-239.777) * (-239.265) (-242.571) (-244.334) [-238.092] -- 0:00:35
406000 -- [-238.368] (-238.579) (-236.532) (-236.750) * (-237.526) [-237.571] (-240.212) (-237.759) -- 0:00:35
406500 -- [-239.172] (-236.199) (-236.657) (-237.004) * (-237.941) [-237.672] (-239.318) (-236.673) -- 0:00:35
407000 -- (-237.406) (-241.497) (-237.784) [-237.989] * (-237.438) [-236.994] (-237.408) (-236.589) -- 0:00:34
407500 -- (-237.161) (-244.692) (-238.174) [-236.404] * [-238.254] (-238.172) (-239.083) (-238.494) -- 0:00:34
408000 -- (-239.293) [-244.413] (-238.641) (-238.014) * (-238.028) (-243.259) (-239.033) [-238.712] -- 0:00:34
408500 -- (-241.374) (-240.364) [-240.896] (-239.168) * (-237.590) (-238.997) [-238.906] (-239.913) -- 0:00:34
409000 -- (-238.684) (-237.098) (-239.906) [-239.702] * [-238.489] (-238.942) (-241.663) (-238.490) -- 0:00:34
409500 -- (-237.126) (-242.848) [-237.847] (-238.288) * (-239.674) [-236.755] (-236.383) (-237.164) -- 0:00:34
410000 -- (-239.043) (-242.482) (-236.606) [-237.242] * (-242.375) (-238.421) (-238.861) [-237.372] -- 0:00:34
Average standard deviation of split frequencies: 0.010804
410500 -- (-237.787) (-242.626) [-237.975] (-236.975) * [-237.279] (-243.568) (-238.867) (-239.363) -- 0:00:34
411000 -- (-238.747) (-241.157) [-236.807] (-238.946) * (-240.886) [-239.447] (-238.695) (-239.554) -- 0:00:34
411500 -- (-250.066) [-237.018] (-242.645) (-239.968) * [-239.169] (-236.518) (-240.799) (-237.893) -- 0:00:34
412000 -- (-238.572) (-236.743) [-237.894] (-237.033) * (-239.135) (-236.301) (-237.607) [-241.666] -- 0:00:34
412500 -- (-240.049) [-237.119] (-236.795) (-237.348) * (-237.309) (-236.732) (-240.491) [-239.049] -- 0:00:34
413000 -- (-237.271) [-238.896] (-242.264) (-237.888) * (-241.431) [-236.723] (-238.347) (-237.871) -- 0:00:34
413500 -- [-240.296] (-240.880) (-238.524) (-237.397) * (-236.905) [-236.364] (-239.594) (-239.386) -- 0:00:34
414000 -- (-237.085) [-247.073] (-238.506) (-239.561) * (-237.294) (-240.857) [-236.697] (-240.482) -- 0:00:33
414500 -- (-237.559) [-237.802] (-238.790) (-238.169) * (-244.958) [-240.497] (-236.613) (-241.027) -- 0:00:33
415000 -- (-237.740) [-239.451] (-242.608) (-238.074) * (-246.732) (-240.267) [-237.041] (-239.286) -- 0:00:33
Average standard deviation of split frequencies: 0.010269
415500 -- (-236.474) (-236.040) (-242.923) [-237.276] * (-238.048) [-240.808] (-238.641) (-239.758) -- 0:00:33
416000 -- (-237.801) (-236.945) (-238.752) [-239.004] * [-240.190] (-239.169) (-237.556) (-236.153) -- 0:00:33
416500 -- (-237.873) [-241.067] (-242.824) (-240.446) * (-238.409) [-237.831] (-238.749) (-236.700) -- 0:00:33
417000 -- (-237.662) [-238.291] (-239.258) (-240.630) * (-243.623) (-237.500) (-238.083) [-238.023] -- 0:00:33
417500 -- [-238.166] (-237.765) (-239.497) (-239.363) * (-238.229) (-238.381) (-240.336) [-237.563] -- 0:00:33
418000 -- (-237.832) [-238.876] (-236.574) (-237.704) * (-240.199) [-238.885] (-238.846) (-242.582) -- 0:00:33
418500 -- (-239.172) (-240.117) [-237.062] (-239.025) * (-237.699) (-237.816) (-239.276) [-239.960] -- 0:00:33
419000 -- (-237.065) (-241.193) (-236.659) [-237.088] * (-239.894) (-237.596) (-239.313) [-237.522] -- 0:00:33
419500 -- (-237.305) (-240.167) (-236.329) [-237.461] * (-238.184) (-238.512) [-238.458] (-237.293) -- 0:00:33
420000 -- [-238.208] (-242.087) (-245.194) (-238.131) * [-237.891] (-237.141) (-238.630) (-238.262) -- 0:00:33
Average standard deviation of split frequencies: 0.010296
420500 -- (-239.522) [-241.072] (-252.163) (-239.328) * (-237.922) [-238.480] (-241.629) (-242.332) -- 0:00:33
421000 -- (-236.565) [-238.586] (-236.403) (-238.501) * (-236.644) (-237.243) [-237.798] (-238.793) -- 0:00:33
421500 -- (-238.899) (-237.979) (-236.644) [-238.255] * [-237.478] (-238.262) (-237.089) (-243.342) -- 0:00:32
422000 -- (-240.025) (-237.249) [-238.368] (-237.122) * (-238.686) (-239.728) (-241.929) [-238.343] -- 0:00:32
422500 -- (-239.229) (-236.700) [-236.995] (-237.508) * [-239.374] (-241.803) (-240.687) (-238.246) -- 0:00:32
423000 -- (-237.773) [-240.757] (-239.787) (-238.009) * (-241.292) (-242.469) [-236.439] (-237.891) -- 0:00:34
423500 -- [-238.973] (-237.289) (-239.652) (-238.782) * (-240.813) [-236.140] (-237.093) (-237.369) -- 0:00:34
424000 -- (-237.278) (-236.825) (-236.805) [-237.876] * (-239.352) [-236.493] (-237.585) (-237.101) -- 0:00:33
424500 -- (-238.175) [-236.650] (-238.860) (-241.631) * [-236.917] (-236.294) (-238.999) (-236.776) -- 0:00:33
425000 -- [-239.767] (-236.288) (-237.050) (-241.867) * (-238.116) [-236.924] (-242.618) (-236.771) -- 0:00:33
Average standard deviation of split frequencies: 0.010415
425500 -- [-237.475] (-237.263) (-237.814) (-238.793) * (-237.750) (-237.231) [-237.810] (-238.769) -- 0:00:33
426000 -- (-237.184) (-237.597) (-242.246) [-236.328] * (-243.468) (-238.835) (-239.277) [-238.598] -- 0:00:33
426500 -- (-241.905) [-238.590] (-238.338) (-237.107) * (-236.768) (-239.401) (-238.341) [-239.572] -- 0:00:33
427000 -- (-242.241) (-237.155) (-239.359) [-237.856] * [-237.350] (-239.959) (-242.079) (-236.902) -- 0:00:33
427500 -- (-241.101) (-238.641) [-238.128] (-241.458) * (-238.320) [-237.290] (-237.757) (-238.027) -- 0:00:33
428000 -- [-240.784] (-241.517) (-236.725) (-237.049) * [-237.430] (-238.626) (-238.064) (-237.709) -- 0:00:33
428500 -- (-239.431) (-240.858) (-237.523) [-237.776] * (-239.596) (-240.522) (-238.553) [-238.558] -- 0:00:33
429000 -- (-237.174) [-236.740] (-237.567) (-238.355) * (-238.534) (-238.237) [-237.909] (-238.187) -- 0:00:33
429500 -- [-237.329] (-238.267) (-237.600) (-236.513) * (-239.895) (-240.382) [-237.538] (-236.795) -- 0:00:33
430000 -- [-238.590] (-239.823) (-238.308) (-237.617) * [-238.102] (-239.338) (-237.065) (-238.547) -- 0:00:33
Average standard deviation of split frequencies: 0.009594
430500 -- (-238.535) (-236.518) (-238.215) [-240.181] * [-236.787] (-236.356) (-238.963) (-239.268) -- 0:00:33
431000 -- [-236.349] (-237.228) (-237.898) (-239.589) * (-240.372) [-237.507] (-236.312) (-237.582) -- 0:00:33
431500 -- (-236.008) [-237.095] (-238.520) (-242.811) * (-240.451) (-238.108) [-236.819] (-240.440) -- 0:00:32
432000 -- (-238.003) [-238.805] (-237.673) (-241.047) * (-240.560) [-237.913] (-239.006) (-241.840) -- 0:00:32
432500 -- [-245.083] (-240.536) (-240.357) (-240.479) * (-238.058) [-237.907] (-240.149) (-238.030) -- 0:00:32
433000 -- (-238.565) (-238.240) (-240.362) [-238.246] * (-237.260) (-237.323) [-237.641] (-241.856) -- 0:00:32
433500 -- [-238.541] (-240.366) (-239.195) (-237.779) * (-238.437) (-240.787) [-237.318] (-237.969) -- 0:00:32
434000 -- (-236.971) (-239.120) (-239.776) [-240.857] * [-239.437] (-237.477) (-241.383) (-239.513) -- 0:00:32
434500 -- (-238.041) (-239.938) (-238.231) [-240.525] * (-238.882) (-238.769) [-239.971] (-241.486) -- 0:00:32
435000 -- (-238.223) (-240.717) (-236.925) [-239.405] * (-236.856) [-238.438] (-239.910) (-238.975) -- 0:00:32
Average standard deviation of split frequencies: 0.009349
435500 -- (-240.920) [-238.519] (-238.359) (-237.624) * (-242.684) (-239.223) (-237.097) [-237.492] -- 0:00:32
436000 -- (-237.210) (-241.898) (-237.883) [-239.035] * (-238.915) (-237.325) [-239.235] (-241.860) -- 0:00:32
436500 -- (-239.342) (-241.001) [-239.387] (-237.943) * (-238.069) (-239.895) [-237.625] (-238.537) -- 0:00:32
437000 -- (-237.428) (-239.942) [-239.818] (-239.526) * (-239.195) (-237.493) [-237.548] (-237.915) -- 0:00:32
437500 -- [-239.451] (-239.726) (-238.880) (-238.362) * (-240.020) [-238.567] (-237.982) (-237.440) -- 0:00:32
438000 -- (-238.191) (-239.793) (-237.243) [-240.492] * (-237.250) (-237.685) (-238.493) [-236.825] -- 0:00:32
438500 -- (-238.145) (-238.631) [-236.662] (-237.405) * (-236.915) [-238.432] (-245.572) (-237.449) -- 0:00:32
439000 -- [-236.310] (-237.019) (-237.260) (-237.445) * (-237.649) [-238.735] (-243.657) (-239.834) -- 0:00:31
439500 -- [-238.153] (-236.761) (-241.435) (-239.846) * [-237.147] (-239.032) (-241.388) (-236.894) -- 0:00:31
440000 -- [-239.784] (-236.185) (-239.726) (-236.844) * (-237.602) (-237.268) [-239.625] (-241.112) -- 0:00:31
Average standard deviation of split frequencies: 0.009293
440500 -- (-237.436) [-238.177] (-237.003) (-238.484) * (-240.307) (-237.114) (-237.856) [-239.588] -- 0:00:33
441000 -- (-237.858) (-236.244) (-237.955) [-238.841] * (-236.669) (-240.907) [-236.327] (-238.574) -- 0:00:32
441500 -- (-238.180) (-236.628) (-238.940) [-237.613] * (-237.257) (-239.556) [-236.067] (-236.954) -- 0:00:32
442000 -- [-237.655] (-236.157) (-237.397) (-236.868) * [-239.719] (-238.597) (-236.182) (-237.885) -- 0:00:32
442500 -- (-240.165) (-239.010) (-236.467) [-240.109] * (-237.942) (-237.605) (-236.730) [-236.952] -- 0:00:32
443000 -- (-240.429) [-239.604] (-236.863) (-240.719) * (-239.691) (-236.771) (-237.079) [-238.243] -- 0:00:32
443500 -- (-237.604) (-237.849) (-238.205) [-237.620] * (-239.159) (-240.374) [-236.615] (-239.623) -- 0:00:32
444000 -- (-237.023) (-238.393) [-236.264] (-236.635) * (-236.731) [-237.791] (-239.352) (-238.155) -- 0:00:32
444500 -- (-236.746) [-239.891] (-238.587) (-237.998) * [-237.175] (-237.129) (-237.354) (-237.210) -- 0:00:32
445000 -- (-242.252) [-239.019] (-236.700) (-241.685) * (-240.122) (-240.929) (-238.357) [-239.191] -- 0:00:32
Average standard deviation of split frequencies: 0.008767
445500 -- [-238.539] (-238.309) (-236.822) (-236.674) * (-238.236) (-240.826) [-238.154] (-237.454) -- 0:00:32
446000 -- (-238.278) [-242.401] (-236.961) (-241.752) * [-236.624] (-238.389) (-237.337) (-237.395) -- 0:00:32
446500 -- (-238.559) (-239.968) [-238.513] (-237.270) * (-239.373) [-237.347] (-238.574) (-239.868) -- 0:00:32
447000 -- (-239.935) (-237.770) [-238.420] (-239.994) * (-236.848) (-239.182) (-240.116) [-238.627] -- 0:00:32
447500 -- (-239.168) (-238.267) (-240.619) [-239.385] * (-239.999) (-238.388) [-236.239] (-237.717) -- 0:00:32
448000 -- (-236.482) (-238.831) (-236.713) [-238.931] * (-237.897) (-237.471) [-236.030] (-237.115) -- 0:00:32
448500 -- (-237.901) (-239.646) [-237.710] (-241.654) * (-236.899) (-237.634) [-237.047] (-237.665) -- 0:00:31
449000 -- (-238.303) (-237.881) (-239.370) [-237.943] * (-237.591) [-238.276] (-236.440) (-240.148) -- 0:00:31
449500 -- [-239.557] (-237.576) (-236.877) (-239.323) * (-239.991) (-237.054) [-236.992] (-240.486) -- 0:00:31
450000 -- (-240.316) (-237.610) [-239.897] (-239.839) * (-238.257) [-237.255] (-238.364) (-240.580) -- 0:00:31
Average standard deviation of split frequencies: 0.009087
450500 -- [-238.282] (-237.265) (-238.842) (-238.813) * (-237.060) (-238.946) (-236.294) [-238.588] -- 0:00:31
451000 -- (-238.451) (-237.351) (-237.231) [-237.375] * (-236.862) (-240.147) [-237.510] (-239.222) -- 0:00:31
451500 -- (-238.084) (-237.020) [-237.148] (-237.771) * (-238.785) (-236.971) [-239.230] (-241.456) -- 0:00:31
452000 -- (-237.869) (-236.969) [-236.906] (-240.216) * (-238.911) [-237.106] (-238.151) (-240.290) -- 0:00:31
452500 -- (-238.412) [-236.684] (-237.605) (-244.758) * (-237.021) [-238.877] (-237.839) (-239.818) -- 0:00:31
453000 -- (-242.516) [-236.821] (-241.009) (-243.314) * (-238.040) [-236.704] (-238.222) (-237.756) -- 0:00:31
453500 -- (-239.458) [-237.568] (-239.397) (-238.167) * (-239.266) (-245.100) (-236.715) [-237.365] -- 0:00:31
454000 -- (-239.611) [-236.482] (-238.060) (-240.856) * (-236.568) (-241.614) [-237.787] (-239.652) -- 0:00:31
454500 -- (-238.513) (-237.083) [-236.467] (-238.789) * (-240.499) [-236.845] (-236.989) (-240.144) -- 0:00:31
455000 -- (-237.026) (-238.417) (-239.319) [-239.389] * [-242.539] (-236.870) (-240.293) (-240.237) -- 0:00:31
Average standard deviation of split frequencies: 0.008658
455500 -- (-237.110) (-236.722) [-238.262] (-237.962) * [-238.512] (-236.898) (-237.507) (-239.290) -- 0:00:31
456000 -- [-238.268] (-237.546) (-242.196) (-237.501) * (-239.297) (-237.800) (-239.669) [-240.154] -- 0:00:31
456500 -- (-238.724) (-239.579) [-237.225] (-237.646) * (-236.954) (-237.026) (-237.793) [-239.373] -- 0:00:30
457000 -- (-239.445) (-237.617) [-238.290] (-242.045) * (-237.494) (-238.322) (-242.062) [-241.496] -- 0:00:30
457500 -- [-236.922] (-236.725) (-237.761) (-238.284) * (-236.929) [-239.086] (-245.518) (-240.824) -- 0:00:30
458000 -- (-238.263) (-236.280) [-237.944] (-238.770) * [-239.261] (-237.093) (-239.682) (-241.461) -- 0:00:31
458500 -- (-238.548) (-238.625) [-240.809] (-239.537) * (-239.717) (-236.461) (-236.578) [-237.958] -- 0:00:31
459000 -- (-238.446) [-238.137] (-237.961) (-245.237) * (-238.763) (-236.976) (-239.958) [-239.104] -- 0:00:31
459500 -- (-237.119) (-237.412) [-236.481] (-242.270) * (-237.139) (-241.860) (-242.751) [-237.413] -- 0:00:31
460000 -- [-239.146] (-240.003) (-236.963) (-239.713) * (-238.563) [-241.285] (-236.261) (-238.556) -- 0:00:31
Average standard deviation of split frequencies: 0.009146
460500 -- (-240.214) (-241.557) [-241.913] (-242.501) * (-237.489) (-240.492) (-236.154) [-239.061] -- 0:00:31
461000 -- (-237.531) [-240.347] (-239.456) (-237.316) * (-237.136) (-239.858) [-237.559] (-238.068) -- 0:00:31
461500 -- (-241.271) (-238.401) [-237.031] (-236.975) * (-239.514) (-239.851) [-237.373] (-240.545) -- 0:00:31
462000 -- (-242.338) (-236.775) (-241.023) [-238.500] * (-237.638) (-238.688) [-236.887] (-239.109) -- 0:00:31
462500 -- (-237.303) [-239.468] (-240.157) (-236.870) * [-238.029] (-239.219) (-238.824) (-240.589) -- 0:00:31
463000 -- (-238.352) (-239.846) (-236.381) [-237.095] * (-237.234) (-241.548) (-238.191) [-237.980] -- 0:00:31
463500 -- (-236.824) (-240.493) [-238.300] (-237.977) * (-242.200) (-239.806) [-237.522] (-236.979) -- 0:00:31
464000 -- (-236.300) (-238.747) (-238.411) [-238.600] * (-243.704) (-238.948) (-236.590) [-237.276] -- 0:00:31
464500 -- (-237.310) (-242.229) [-238.247] (-237.688) * (-236.583) (-238.773) (-239.849) [-236.462] -- 0:00:31
465000 -- (-238.392) (-236.745) [-237.908] (-239.221) * [-241.537] (-243.335) (-239.605) (-236.960) -- 0:00:31
Average standard deviation of split frequencies: 0.009041
465500 -- (-238.971) (-237.150) [-237.144] (-236.918) * (-238.704) [-238.829] (-238.947) (-237.922) -- 0:00:31
466000 -- (-240.100) (-239.412) (-238.221) [-236.344] * [-237.034] (-239.573) (-237.609) (-237.120) -- 0:00:30
466500 -- [-240.258] (-238.767) (-237.543) (-238.564) * (-236.547) (-238.620) (-242.797) [-236.750] -- 0:00:30
467000 -- [-239.850] (-244.150) (-237.879) (-237.767) * [-237.702] (-238.740) (-238.971) (-238.319) -- 0:00:30
467500 -- (-239.256) (-239.050) [-239.019] (-237.431) * (-237.536) (-241.435) [-236.699] (-240.497) -- 0:00:30
468000 -- (-238.994) (-239.972) [-240.042] (-238.267) * [-237.733] (-239.697) (-237.712) (-237.844) -- 0:00:30
468500 -- (-237.891) [-237.948] (-242.504) (-237.437) * (-236.632) (-239.085) (-244.437) [-237.551] -- 0:00:30
469000 -- (-238.429) [-238.018] (-239.554) (-239.965) * [-238.572] (-240.462) (-240.485) (-238.977) -- 0:00:30
469500 -- [-240.628] (-240.718) (-236.591) (-238.473) * (-239.053) (-237.080) (-241.239) [-237.834] -- 0:00:30
470000 -- (-236.461) (-238.249) (-238.255) [-236.852] * (-238.662) (-236.724) [-237.315] (-237.282) -- 0:00:30
Average standard deviation of split frequencies: 0.008639
470500 -- (-237.215) [-239.199] (-238.680) (-238.219) * [-239.736] (-237.209) (-241.999) (-237.237) -- 0:00:30
471000 -- (-238.229) (-239.905) [-237.913] (-237.472) * (-238.950) (-238.283) (-237.380) [-236.356] -- 0:00:30
471500 -- (-236.833) (-237.319) [-239.521] (-238.273) * [-236.920] (-239.616) (-236.234) (-236.628) -- 0:00:30
472000 -- [-239.992] (-237.876) (-240.260) (-236.477) * [-237.120] (-238.054) (-236.874) (-236.234) -- 0:00:30
472500 -- (-240.087) (-239.440) (-241.318) [-237.627] * (-236.053) (-240.802) (-238.108) [-236.972] -- 0:00:30
473000 -- (-237.711) (-237.316) (-237.161) [-243.694] * [-238.615] (-239.492) (-236.990) (-236.509) -- 0:00:30
473500 -- [-238.737] (-239.861) (-239.071) (-238.024) * (-236.572) [-237.149] (-237.170) (-237.377) -- 0:00:30
474000 -- (-238.898) [-237.509] (-239.275) (-236.814) * [-238.265] (-242.767) (-237.693) (-236.578) -- 0:00:29
474500 -- (-235.932) (-238.332) (-237.617) [-238.364] * [-238.424] (-238.931) (-236.582) (-241.557) -- 0:00:29
475000 -- [-237.080] (-237.970) (-237.725) (-238.142) * (-238.002) (-247.084) [-237.502] (-236.453) -- 0:00:30
Average standard deviation of split frequencies: 0.009099
475500 -- [-236.433] (-237.442) (-239.604) (-238.913) * [-240.299] (-238.005) (-240.137) (-236.047) -- 0:00:30
476000 -- (-239.892) [-240.452] (-240.338) (-239.950) * [-243.243] (-238.212) (-236.517) (-237.432) -- 0:00:30
476500 -- [-237.908] (-236.443) (-239.485) (-238.179) * [-240.165] (-237.632) (-241.789) (-236.305) -- 0:00:30
477000 -- (-236.607) [-238.561] (-241.699) (-236.215) * (-236.961) (-239.374) [-238.479] (-239.159) -- 0:00:30
477500 -- (-239.259) (-236.334) [-236.990] (-236.165) * (-237.530) (-238.990) (-237.684) [-240.808] -- 0:00:30
478000 -- (-241.465) (-236.341) [-238.065] (-237.651) * (-238.111) (-236.108) [-237.284] (-242.416) -- 0:00:30
478500 -- (-241.990) (-237.740) [-236.343] (-242.077) * (-239.679) (-239.285) [-236.722] (-240.291) -- 0:00:30
479000 -- (-237.643) (-243.352) (-237.084) [-243.048] * (-239.039) (-236.519) [-237.624] (-237.729) -- 0:00:30
479500 -- [-238.842] (-240.125) (-236.767) (-238.204) * [-243.862] (-237.984) (-237.516) (-238.437) -- 0:00:30
480000 -- (-239.522) [-236.209] (-237.254) (-236.195) * (-242.082) (-238.653) (-237.468) [-241.452] -- 0:00:30
Average standard deviation of split frequencies: 0.009378
480500 -- (-238.977) [-236.872] (-239.059) (-236.729) * (-241.775) (-237.168) [-241.169] (-238.074) -- 0:00:30
481000 -- [-236.536] (-236.668) (-242.819) (-236.918) * (-237.800) (-236.801) [-238.575] (-236.980) -- 0:00:30
481500 -- [-238.362] (-236.544) (-237.258) (-240.632) * [-237.565] (-237.016) (-238.307) (-240.109) -- 0:00:30
482000 -- (-237.527) (-238.080) [-237.326] (-241.431) * (-238.791) (-236.780) [-237.453] (-236.297) -- 0:00:30
482500 -- (-238.917) (-242.687) [-245.051] (-238.708) * (-237.115) [-236.547] (-240.823) (-240.141) -- 0:00:30
483000 -- (-240.596) (-240.007) (-238.810) [-239.443] * (-238.603) [-236.674] (-240.656) (-239.554) -- 0:00:29
483500 -- (-243.385) [-237.509] (-241.021) (-240.131) * [-238.225] (-244.643) (-238.989) (-240.006) -- 0:00:29
484000 -- (-237.909) [-241.380] (-238.608) (-239.793) * [-238.145] (-241.764) (-236.782) (-244.138) -- 0:00:29
484500 -- (-238.307) (-237.826) (-237.366) [-237.573] * (-238.858) (-238.032) [-239.617] (-238.716) -- 0:00:29
485000 -- [-237.412] (-240.450) (-237.651) (-237.422) * [-240.478] (-237.863) (-237.166) (-236.435) -- 0:00:29
Average standard deviation of split frequencies: 0.009312
485500 -- (-240.220) (-238.052) (-238.674) [-238.230] * [-241.575] (-237.902) (-238.700) (-236.866) -- 0:00:29
486000 -- (-238.627) (-236.621) [-239.321] (-241.698) * (-237.934) (-238.299) (-237.258) [-236.311] -- 0:00:29
486500 -- (-237.415) (-235.914) (-237.471) [-237.004] * (-238.737) (-238.104) (-237.359) [-242.719] -- 0:00:29
487000 -- [-237.538] (-237.267) (-236.667) (-240.112) * (-238.552) (-236.538) [-238.036] (-240.025) -- 0:00:29
487500 -- [-237.519] (-244.418) (-238.239) (-236.234) * [-238.679] (-238.562) (-236.918) (-239.442) -- 0:00:29
488000 -- (-241.000) (-241.174) [-240.840] (-242.267) * (-238.252) [-240.175] (-237.365) (-237.570) -- 0:00:29
488500 -- [-237.200] (-239.980) (-238.744) (-238.690) * [-237.184] (-239.060) (-238.156) (-237.811) -- 0:00:29
489000 -- (-243.034) [-237.226] (-240.268) (-238.773) * [-237.094] (-239.036) (-239.570) (-236.385) -- 0:00:29
489500 -- (-243.211) (-237.008) [-237.647] (-238.089) * (-238.984) (-237.589) (-238.504) [-237.031] -- 0:00:29
490000 -- (-239.374) (-237.921) (-240.902) [-236.252] * (-240.709) (-236.150) [-238.281] (-239.763) -- 0:00:29
Average standard deviation of split frequencies: 0.008407
490500 -- (-240.302) (-237.992) [-241.187] (-238.939) * (-240.274) (-240.851) [-237.444] (-239.868) -- 0:00:29
491000 -- (-240.216) (-236.819) [-240.197] (-237.824) * [-236.573] (-238.705) (-237.403) (-241.288) -- 0:00:29
491500 -- (-239.336) (-236.520) [-240.289] (-239.666) * (-236.747) [-238.452] (-237.039) (-236.631) -- 0:00:28
492000 -- (-237.632) [-239.499] (-241.162) (-238.546) * (-238.679) [-239.083] (-236.419) (-238.525) -- 0:00:29
492500 -- (-237.578) [-236.558] (-236.522) (-240.098) * (-238.166) [-237.094] (-237.411) (-241.974) -- 0:00:29
493000 -- (-238.820) (-237.338) [-238.856] (-239.806) * [-238.745] (-238.283) (-241.133) (-240.231) -- 0:00:29
493500 -- (-240.806) (-238.807) [-239.378] (-237.771) * (-238.083) (-237.354) [-239.161] (-240.086) -- 0:00:29
494000 -- (-244.186) [-239.938] (-237.543) (-241.202) * [-237.159] (-238.862) (-237.247) (-236.849) -- 0:00:29
494500 -- (-237.005) [-237.404] (-238.285) (-238.202) * (-237.314) (-238.025) [-237.320] (-239.193) -- 0:00:29
495000 -- (-236.436) (-238.279) (-240.815) [-236.263] * (-239.292) [-238.309] (-236.847) (-236.533) -- 0:00:29
Average standard deviation of split frequencies: 0.009267
495500 -- [-237.150] (-237.691) (-244.828) (-239.392) * (-240.684) (-238.416) [-238.426] (-236.028) -- 0:00:29
496000 -- (-239.058) [-238.131] (-236.680) (-239.621) * (-237.988) [-244.302] (-238.667) (-242.716) -- 0:00:29
496500 -- (-237.886) [-238.145] (-237.050) (-238.843) * (-241.292) [-237.377] (-237.759) (-237.324) -- 0:00:29
497000 -- (-238.864) (-241.283) [-237.986] (-246.260) * [-237.885] (-237.603) (-237.469) (-236.957) -- 0:00:29
497500 -- (-237.522) (-242.764) (-237.225) [-240.988] * [-237.780] (-238.435) (-238.917) (-240.349) -- 0:00:29
498000 -- (-236.662) (-237.896) [-236.710] (-240.796) * [-240.106] (-236.719) (-237.584) (-241.795) -- 0:00:29
498500 -- (-240.138) (-236.127) [-237.607] (-240.579) * (-237.474) (-238.536) [-235.879] (-242.031) -- 0:00:29
499000 -- (-236.854) (-236.938) [-239.896] (-239.736) * (-236.970) (-237.660) (-237.694) [-239.692] -- 0:00:29
499500 -- [-236.697] (-239.504) (-240.479) (-238.421) * [-241.477] (-240.223) (-237.081) (-244.798) -- 0:00:29
500000 -- [-238.031] (-237.740) (-237.823) (-238.047) * (-239.260) (-240.597) [-237.293] (-241.344) -- 0:00:29
Average standard deviation of split frequencies: 0.009592
500500 -- (-238.789) (-237.526) [-238.492] (-240.307) * [-239.117] (-237.639) (-239.001) (-237.213) -- 0:00:28
501000 -- (-236.541) (-236.971) [-237.720] (-240.934) * (-240.727) (-237.054) (-243.122) [-239.187] -- 0:00:28
501500 -- (-238.117) (-236.447) (-238.371) [-239.444] * (-237.414) (-238.900) [-238.645] (-237.003) -- 0:00:28
502000 -- (-237.562) [-239.038] (-236.687) (-238.075) * (-237.576) [-242.297] (-239.751) (-240.252) -- 0:00:28
502500 -- (-237.290) [-237.386] (-236.743) (-236.378) * (-238.106) (-237.794) (-240.425) [-236.396] -- 0:00:28
503000 -- [-237.382] (-238.337) (-238.581) (-237.406) * (-240.679) [-237.278] (-243.019) (-238.775) -- 0:00:28
503500 -- (-237.169) (-241.014) [-235.911] (-241.087) * (-242.045) [-237.258] (-242.239) (-237.279) -- 0:00:28
504000 -- (-236.968) (-239.177) (-238.411) [-237.164] * (-241.161) (-237.395) [-237.975] (-240.626) -- 0:00:28
504500 -- (-240.290) (-236.639) [-238.985] (-238.916) * (-237.694) [-239.421] (-237.239) (-237.237) -- 0:00:28
505000 -- (-236.360) (-236.533) (-236.993) [-244.180] * [-240.718] (-239.111) (-238.204) (-236.260) -- 0:00:28
Average standard deviation of split frequencies: 0.010248
505500 -- [-238.373] (-237.323) (-236.884) (-238.501) * (-237.579) (-238.989) (-239.460) [-236.912] -- 0:00:28
506000 -- [-236.908] (-237.737) (-239.318) (-238.305) * [-236.945] (-237.472) (-237.877) (-238.902) -- 0:00:28
506500 -- [-238.642] (-236.253) (-238.228) (-238.657) * (-239.292) [-236.447] (-236.045) (-236.323) -- 0:00:28
507000 -- [-239.027] (-237.238) (-238.340) (-239.491) * [-237.314] (-238.976) (-238.897) (-237.247) -- 0:00:28
507500 -- (-237.330) (-239.339) [-240.524] (-237.628) * (-240.376) (-236.338) [-238.068] (-238.706) -- 0:00:28
508000 -- (-240.546) (-240.623) (-246.262) [-237.561] * (-238.101) (-236.566) [-238.457] (-240.947) -- 0:00:28
508500 -- [-239.342] (-242.854) (-239.978) (-237.813) * (-236.972) (-238.268) [-238.445] (-237.625) -- 0:00:28
509000 -- (-238.987) (-243.123) [-237.049] (-240.234) * (-240.725) (-237.933) [-238.710] (-236.830) -- 0:00:28
509500 -- (-238.351) (-240.089) (-236.341) [-238.094] * [-238.826] (-238.302) (-240.339) (-236.787) -- 0:00:28
510000 -- (-239.657) (-238.377) [-243.988] (-240.424) * [-237.654] (-239.717) (-237.125) (-237.899) -- 0:00:28
Average standard deviation of split frequencies: 0.009866
510500 -- (-237.539) [-239.882] (-239.906) (-238.226) * (-239.803) [-238.345] (-237.886) (-240.801) -- 0:00:28
511000 -- (-240.982) [-236.738] (-237.295) (-245.515) * (-239.689) (-238.363) [-236.284] (-237.534) -- 0:00:28
511500 -- [-237.033] (-236.264) (-240.060) (-243.021) * (-238.851) [-240.246] (-238.411) (-236.643) -- 0:00:28
512000 -- [-237.099] (-237.788) (-238.265) (-237.308) * (-238.499) [-238.129] (-242.154) (-236.775) -- 0:00:28
512500 -- (-238.491) [-238.046] (-236.679) (-236.600) * [-238.458] (-237.617) (-240.177) (-236.818) -- 0:00:28
513000 -- (-236.531) [-239.813] (-240.633) (-239.122) * (-237.612) (-236.836) (-244.185) [-241.605] -- 0:00:28
513500 -- (-240.148) (-237.964) (-238.104) [-237.165] * (-238.781) (-240.943) (-239.842) [-240.519] -- 0:00:28
514000 -- [-239.114] (-238.671) (-239.384) (-239.731) * [-239.639] (-239.000) (-237.303) (-238.694) -- 0:00:28
514500 -- (-238.968) (-238.835) (-236.338) [-241.737] * (-241.897) [-236.777] (-236.495) (-236.470) -- 0:00:28
515000 -- (-239.927) (-237.297) (-236.997) [-238.288] * (-240.460) [-237.378] (-238.985) (-238.290) -- 0:00:28
Average standard deviation of split frequencies: 0.009935
515500 -- [-237.266] (-236.083) (-237.959) (-238.822) * [-243.528] (-239.182) (-237.172) (-241.349) -- 0:00:28
516000 -- (-237.015) (-238.836) (-236.599) [-236.655] * [-239.316] (-239.286) (-237.338) (-236.871) -- 0:00:28
516500 -- (-236.683) [-238.699] (-237.545) (-239.562) * [-238.363] (-243.431) (-239.824) (-236.483) -- 0:00:28
517000 -- (-238.069) [-238.904] (-237.813) (-240.082) * (-238.895) [-239.404] (-237.042) (-238.566) -- 0:00:28
517500 -- (-236.981) (-236.652) [-235.964] (-238.764) * (-240.547) (-238.336) [-239.415] (-239.207) -- 0:00:27
518000 -- (-236.297) (-238.174) [-237.386] (-239.555) * (-238.019) [-240.460] (-240.549) (-236.220) -- 0:00:27
518500 -- (-237.871) (-236.416) [-239.321] (-240.561) * [-239.876] (-240.301) (-241.007) (-238.262) -- 0:00:27
519000 -- [-238.104] (-238.522) (-238.779) (-237.794) * [-236.648] (-237.269) (-242.960) (-240.146) -- 0:00:27
519500 -- [-237.326] (-238.977) (-239.376) (-237.237) * (-237.555) (-236.549) [-240.432] (-237.805) -- 0:00:27
520000 -- (-236.360) (-238.360) [-236.958] (-238.869) * [-238.061] (-238.783) (-238.371) (-240.692) -- 0:00:27
Average standard deviation of split frequencies: 0.009733
520500 -- (-236.795) (-237.503) [-242.098] (-240.618) * [-236.865] (-238.716) (-243.227) (-237.082) -- 0:00:27
521000 -- (-237.445) (-238.464) (-240.884) [-236.905] * (-238.391) (-236.607) (-236.347) [-237.142] -- 0:00:27
521500 -- (-238.943) (-238.874) (-239.143) [-241.292] * (-238.066) [-237.909] (-244.052) (-236.401) -- 0:00:27
522000 -- (-237.266) [-236.337] (-237.668) (-238.202) * (-239.931) (-240.464) [-237.506] (-237.158) -- 0:00:27
522500 -- (-237.583) (-239.229) (-241.698) [-240.784] * (-240.419) (-238.403) (-237.243) [-236.032] -- 0:00:27
523000 -- (-236.631) (-241.111) (-239.419) [-238.765] * (-238.605) [-238.306] (-238.124) (-236.797) -- 0:00:27
523500 -- [-236.956] (-239.067) (-237.033) (-237.784) * (-237.187) (-239.252) (-239.659) [-236.805] -- 0:00:27
524000 -- (-239.389) (-239.025) (-237.755) [-236.887] * (-238.540) (-238.500) (-237.572) [-236.819] -- 0:00:27
524500 -- (-238.529) (-237.820) (-239.796) [-239.019] * (-237.422) (-237.148) (-240.022) [-237.546] -- 0:00:27
525000 -- (-239.707) (-239.023) [-239.546] (-238.854) * (-237.216) (-238.163) [-239.126] (-236.608) -- 0:00:27
Average standard deviation of split frequencies: 0.010138
525500 -- [-236.977] (-237.180) (-239.490) (-238.685) * [-236.690] (-241.515) (-239.305) (-239.573) -- 0:00:27
526000 -- (-237.572) (-239.071) [-240.051] (-238.373) * [-240.566] (-238.292) (-238.614) (-238.106) -- 0:00:27
526500 -- (-237.625) (-240.514) (-244.508) [-237.532] * (-239.122) [-240.429] (-239.536) (-247.363) -- 0:00:27
527000 -- [-238.450] (-237.699) (-237.015) (-239.678) * (-243.239) (-239.724) [-239.942] (-243.214) -- 0:00:27
527500 -- (-238.165) (-237.208) [-237.310] (-238.013) * (-238.486) [-239.456] (-239.051) (-242.459) -- 0:00:27
528000 -- (-240.010) [-238.577] (-239.722) (-239.763) * (-238.218) (-236.636) (-242.167) [-237.617] -- 0:00:27
528500 -- [-237.918] (-235.986) (-237.239) (-239.443) * (-238.177) [-236.842] (-240.092) (-237.483) -- 0:00:27
529000 -- (-236.660) [-239.038] (-237.936) (-239.465) * (-241.348) (-236.464) [-238.270] (-241.453) -- 0:00:27
529500 -- (-237.955) [-238.860] (-237.184) (-237.652) * (-240.459) [-238.347] (-242.948) (-236.781) -- 0:00:27
530000 -- (-236.602) (-236.639) [-239.681] (-236.890) * (-238.632) [-238.635] (-237.802) (-239.961) -- 0:00:27
Average standard deviation of split frequencies: 0.010382
530500 -- (-238.008) (-236.939) (-238.989) [-239.695] * [-237.422] (-239.599) (-238.041) (-241.515) -- 0:00:27
531000 -- (-238.588) (-240.838) [-236.782] (-236.233) * (-238.055) (-236.251) (-237.362) [-237.052] -- 0:00:27
531500 -- (-239.449) (-241.765) (-239.024) [-236.817] * (-238.276) [-237.107] (-238.094) (-239.017) -- 0:00:27
532000 -- (-240.460) [-240.028] (-236.636) (-239.406) * (-241.126) (-239.521) (-241.169) [-240.228] -- 0:00:27
532500 -- (-241.617) (-237.240) (-237.605) [-238.420] * (-236.477) [-237.589] (-241.245) (-244.340) -- 0:00:27
533000 -- (-239.635) (-237.619) [-236.575] (-237.369) * [-238.834] (-236.916) (-239.252) (-246.820) -- 0:00:27
533500 -- (-239.639) (-239.287) [-238.198] (-238.949) * (-240.872) (-239.268) [-236.704] (-237.787) -- 0:00:27
534000 -- (-239.046) [-240.160] (-236.331) (-240.022) * [-239.963] (-239.019) (-238.283) (-241.627) -- 0:00:27
534500 -- (-238.633) [-237.955] (-238.242) (-242.722) * (-241.029) (-237.273) [-241.874] (-239.891) -- 0:00:26
535000 -- [-239.250] (-238.385) (-237.455) (-236.469) * (-239.434) (-237.314) [-237.875] (-239.264) -- 0:00:26
Average standard deviation of split frequencies: 0.010399
535500 -- [-237.330] (-242.219) (-240.665) (-238.141) * (-238.821) [-236.800] (-240.918) (-237.996) -- 0:00:26
536000 -- [-238.171] (-236.508) (-239.189) (-240.034) * (-238.118) [-239.111] (-236.895) (-237.048) -- 0:00:26
536500 -- (-241.372) [-238.481] (-238.262) (-237.692) * (-238.090) (-244.810) [-237.263] (-239.433) -- 0:00:26
537000 -- (-237.249) [-237.584] (-239.332) (-238.136) * (-237.393) (-241.969) (-239.774) [-237.011] -- 0:00:26
537500 -- [-236.198] (-238.945) (-241.005) (-239.820) * [-239.738] (-238.727) (-239.437) (-238.130) -- 0:00:26
538000 -- (-236.488) (-238.067) (-238.690) [-240.191] * [-237.771] (-238.402) (-237.125) (-237.397) -- 0:00:26
538500 -- (-237.645) (-237.242) [-236.815] (-236.999) * (-238.548) [-236.672] (-238.463) (-236.299) -- 0:00:26
539000 -- (-237.392) (-236.811) (-240.021) [-237.599] * (-240.700) [-237.745] (-244.128) (-240.173) -- 0:00:26
539500 -- [-238.350] (-237.937) (-237.288) (-238.928) * (-245.200) (-238.299) (-241.407) [-237.742] -- 0:00:26
540000 -- (-237.113) (-236.969) (-237.767) [-236.483] * (-238.520) [-237.459] (-238.819) (-239.268) -- 0:00:26
Average standard deviation of split frequencies: 0.010360
540500 -- (-237.340) [-237.361] (-237.113) (-239.876) * (-237.462) (-237.304) (-237.191) [-240.555] -- 0:00:26
541000 -- (-240.464) (-239.250) [-237.248] (-237.725) * (-239.957) (-238.176) (-236.574) [-237.977] -- 0:00:26
541500 -- (-238.342) (-237.083) [-236.270] (-239.105) * [-237.015] (-238.626) (-241.219) (-239.531) -- 0:00:26
542000 -- (-241.578) (-236.712) [-239.528] (-241.154) * (-237.191) (-241.060) (-242.864) [-239.264] -- 0:00:26
542500 -- (-239.182) (-237.802) (-237.626) [-240.826] * (-240.123) [-238.798] (-237.566) (-236.823) -- 0:00:26
543000 -- (-238.817) [-237.151] (-236.819) (-238.579) * (-237.584) (-245.846) [-240.354] (-236.451) -- 0:00:26
543500 -- (-237.145) [-238.082] (-236.804) (-241.986) * (-239.019) [-237.800] (-240.003) (-237.466) -- 0:00:26
544000 -- (-238.950) (-237.137) [-236.406] (-243.402) * (-240.327) [-238.026] (-237.053) (-237.646) -- 0:00:26
544500 -- [-236.703] (-237.558) (-239.591) (-238.077) * (-239.734) (-239.369) (-237.443) [-236.949] -- 0:00:26
545000 -- (-237.248) [-237.968] (-239.291) (-237.075) * (-239.723) [-238.050] (-237.237) (-237.439) -- 0:00:26
Average standard deviation of split frequencies: 0.010361
545500 -- (-239.786) (-241.282) (-238.521) [-241.403] * (-239.817) (-236.527) (-239.139) [-240.608] -- 0:00:26
546000 -- (-236.654) (-238.812) (-242.311) [-238.037] * [-240.752] (-237.025) (-242.646) (-237.923) -- 0:00:26
546500 -- [-239.272] (-237.670) (-238.439) (-237.462) * [-237.799] (-238.045) (-238.706) (-240.071) -- 0:00:26
547000 -- (-236.185) [-236.648] (-237.249) (-236.951) * (-236.391) (-241.167) [-237.612] (-236.309) -- 0:00:26
547500 -- (-242.000) [-237.541] (-236.779) (-237.235) * (-241.976) (-240.429) (-242.011) [-236.323] -- 0:00:26
548000 -- (-236.941) (-237.389) [-237.182] (-239.378) * [-237.312] (-237.803) (-238.978) (-238.510) -- 0:00:26
548500 -- (-236.236) (-238.993) (-239.914) [-237.493] * (-240.536) (-237.535) (-236.477) [-239.166] -- 0:00:26
549000 -- (-237.558) (-241.705) (-237.530) [-237.110] * (-237.912) [-240.360] (-237.545) (-240.048) -- 0:00:26
549500 -- (-238.840) [-237.426] (-238.248) (-238.379) * [-236.962] (-236.555) (-236.577) (-237.394) -- 0:00:26
550000 -- (-237.951) [-237.844] (-237.432) (-236.242) * (-242.263) (-240.869) (-240.048) [-238.051] -- 0:00:26
Average standard deviation of split frequencies: 0.009684
550500 -- (-237.172) (-239.644) [-236.541] (-241.211) * (-246.105) (-239.444) [-238.548] (-241.287) -- 0:00:26
551000 -- (-237.758) [-239.381] (-238.622) (-237.494) * (-240.148) [-238.201] (-238.398) (-240.688) -- 0:00:26
551500 -- (-239.959) [-239.089] (-236.414) (-238.178) * (-242.123) (-238.417) [-240.206] (-236.524) -- 0:00:26
552000 -- [-236.900] (-238.647) (-236.400) (-238.570) * (-237.969) (-238.969) (-240.990) [-239.703] -- 0:00:25
552500 -- (-238.667) (-240.224) (-240.739) [-237.937] * (-237.176) (-236.587) [-236.807] (-240.811) -- 0:00:25
553000 -- (-241.571) [-239.049] (-238.989) (-237.909) * (-236.686) (-236.533) (-236.182) [-238.609] -- 0:00:25
553500 -- (-241.234) (-239.698) (-239.042) [-237.498] * (-236.599) [-237.875] (-239.543) (-239.930) -- 0:00:25
554000 -- [-237.466] (-238.230) (-239.960) (-237.250) * (-238.839) [-236.231] (-238.523) (-238.027) -- 0:00:25
554500 -- [-238.231] (-239.980) (-237.669) (-237.339) * (-238.097) (-243.997) [-239.767] (-238.997) -- 0:00:25
555000 -- (-237.766) (-240.084) [-241.342] (-239.064) * (-237.558) (-237.584) [-237.157] (-240.080) -- 0:00:25
Average standard deviation of split frequencies: 0.009270
555500 -- [-236.453] (-237.182) (-237.639) (-239.099) * (-238.065) (-236.860) (-237.118) [-239.481] -- 0:00:25
556000 -- (-239.757) (-239.675) [-240.920] (-238.421) * (-240.567) (-238.988) (-237.249) [-236.820] -- 0:00:25
556500 -- (-239.509) (-244.530) [-237.919] (-236.008) * (-238.470) (-238.129) (-238.484) [-239.975] -- 0:00:25
557000 -- (-239.810) [-237.664] (-238.481) (-236.218) * (-236.654) (-238.947) (-238.662) [-236.488] -- 0:00:25
557500 -- (-241.483) (-240.012) [-236.947] (-237.743) * (-240.593) (-239.089) [-237.918] (-237.466) -- 0:00:25
558000 -- (-237.497) (-240.096) [-237.238] (-236.261) * (-238.972) [-239.455] (-236.889) (-236.274) -- 0:00:25
558500 -- (-237.948) (-239.000) [-236.716] (-237.986) * [-237.866] (-237.024) (-237.947) (-236.269) -- 0:00:25
559000 -- (-242.814) (-238.619) [-237.524] (-239.237) * (-237.142) (-238.265) (-237.487) [-239.832] -- 0:00:25
559500 -- (-242.196) (-242.435) (-236.987) [-236.655] * [-238.312] (-242.881) (-237.552) (-239.750) -- 0:00:25
560000 -- (-239.340) (-239.515) (-243.396) [-237.070] * (-238.562) (-238.661) (-240.415) [-239.688] -- 0:00:25
Average standard deviation of split frequencies: 0.009809
560500 -- (-240.148) (-242.631) [-237.063] (-239.267) * (-239.696) [-240.200] (-237.181) (-240.548) -- 0:00:25
561000 -- (-240.019) (-237.171) [-237.473] (-241.294) * (-237.859) (-236.573) (-239.266) [-242.750] -- 0:00:25
561500 -- (-241.879) (-242.723) [-239.239] (-241.993) * (-239.340) [-238.986] (-241.659) (-239.357) -- 0:00:25
562000 -- [-239.192] (-237.921) (-237.295) (-240.356) * (-244.853) [-238.602] (-243.892) (-242.006) -- 0:00:25
562500 -- [-239.720] (-243.779) (-237.505) (-239.786) * (-242.536) [-238.025] (-243.353) (-240.618) -- 0:00:25
563000 -- (-239.887) (-241.669) (-239.440) [-240.231] * (-239.055) (-237.947) [-238.378] (-237.886) -- 0:00:25
563500 -- (-237.256) [-236.977] (-239.665) (-240.113) * (-236.154) (-236.310) [-236.677] (-241.252) -- 0:00:25
564000 -- (-237.443) (-237.316) (-238.245) [-239.952] * [-237.195] (-240.002) (-238.098) (-236.471) -- 0:00:25
564500 -- (-242.140) (-238.239) (-239.416) [-237.842] * (-239.198) (-237.275) (-238.243) [-239.844] -- 0:00:25
565000 -- (-239.283) [-236.567] (-239.186) (-237.055) * [-241.248] (-237.939) (-236.956) (-238.014) -- 0:00:25
Average standard deviation of split frequencies: 0.010411
565500 -- (-237.633) (-236.292) [-237.204] (-240.049) * (-242.117) (-240.480) (-239.496) [-239.594] -- 0:00:25
566000 -- (-237.471) (-236.712) [-240.214] (-236.515) * [-238.616] (-238.303) (-238.893) (-238.982) -- 0:00:25
566500 -- [-236.753] (-237.536) (-247.936) (-238.660) * (-238.812) [-239.837] (-237.057) (-239.564) -- 0:00:25
567000 -- (-237.912) [-239.943] (-240.099) (-237.333) * (-242.036) (-242.649) (-237.842) [-238.445] -- 0:00:25
567500 -- (-240.627) (-238.387) [-238.497] (-236.425) * (-243.626) (-237.567) [-238.783] (-237.833) -- 0:00:25
568000 -- (-246.812) (-238.855) (-237.007) [-238.397] * (-238.787) (-238.282) (-239.668) [-237.498] -- 0:00:25
568500 -- [-238.883] (-242.363) (-238.557) (-239.565) * (-241.204) (-236.091) (-237.820) [-237.824] -- 0:00:25
569000 -- [-237.328] (-240.083) (-236.064) (-242.526) * [-239.596] (-240.060) (-238.363) (-237.316) -- 0:00:24
569500 -- (-238.181) [-238.434] (-236.126) (-243.392) * (-237.934) (-239.960) (-236.904) [-238.699] -- 0:00:24
570000 -- [-237.207] (-237.595) (-236.100) (-236.484) * (-237.164) (-240.212) (-236.526) [-236.916] -- 0:00:24
Average standard deviation of split frequencies: 0.010574
570500 -- [-236.569] (-238.914) (-236.489) (-236.905) * (-239.478) (-242.813) (-236.786) [-237.194] -- 0:00:24
571000 -- (-238.070) (-238.792) (-237.999) [-236.456] * (-239.395) [-240.227] (-236.468) (-240.852) -- 0:00:24
571500 -- [-237.760] (-237.288) (-240.753) (-238.328) * (-239.659) (-237.549) (-239.204) [-241.996] -- 0:00:24
572000 -- (-239.687) [-237.028] (-239.644) (-237.235) * (-236.857) (-237.889) (-236.826) [-242.509] -- 0:00:24
572500 -- (-236.596) (-236.547) [-243.935] (-239.047) * (-236.873) [-235.955] (-239.502) (-238.082) -- 0:00:24
573000 -- [-236.561] (-237.091) (-239.560) (-238.040) * (-237.015) [-239.106] (-242.547) (-242.913) -- 0:00:24
573500 -- [-238.448] (-239.023) (-238.775) (-239.586) * (-238.623) (-239.061) [-237.052] (-236.525) -- 0:00:24
574000 -- (-241.274) (-239.339) (-239.532) [-242.440] * (-237.442) [-238.090] (-236.434) (-239.499) -- 0:00:24
574500 -- [-239.642] (-240.338) (-236.678) (-241.494) * [-239.937] (-236.075) (-239.363) (-237.360) -- 0:00:24
575000 -- (-237.485) (-237.434) [-236.559] (-238.389) * (-240.783) [-237.341] (-242.348) (-241.954) -- 0:00:24
Average standard deviation of split frequencies: 0.010203
575500 -- (-237.159) (-237.780) [-246.443] (-239.420) * (-240.327) (-237.824) (-236.368) [-236.415] -- 0:00:24
576000 -- (-236.219) (-236.598) (-238.810) [-238.776] * (-236.551) (-240.583) (-236.731) [-236.533] -- 0:00:25
576500 -- (-238.901) [-239.821] (-236.367) (-240.619) * (-237.899) (-240.492) (-237.568) [-238.671] -- 0:00:24
577000 -- (-237.373) (-239.648) (-240.158) [-240.079] * (-236.328) [-238.931] (-240.156) (-237.626) -- 0:00:24
577500 -- (-237.521) (-238.618) [-237.379] (-238.418) * (-237.802) (-238.990) (-236.726) [-237.273] -- 0:00:24
578000 -- (-240.472) (-240.246) (-244.144) [-237.023] * (-236.883) (-237.487) (-237.968) [-236.092] -- 0:00:24
578500 -- (-237.511) [-236.969] (-237.202) (-237.948) * (-239.476) (-239.914) [-238.674] (-237.258) -- 0:00:24
579000 -- (-237.842) (-236.916) [-237.343] (-237.828) * (-240.754) (-241.234) [-240.224] (-239.102) -- 0:00:24
579500 -- (-238.109) (-236.524) (-236.852) [-238.879] * [-237.353] (-238.309) (-240.937) (-240.143) -- 0:00:24
580000 -- (-236.324) (-237.244) (-239.957) [-238.906] * [-237.069] (-237.889) (-236.057) (-238.861) -- 0:00:24
Average standard deviation of split frequencies: 0.010283
580500 -- (-239.012) (-236.927) (-237.859) [-238.407] * (-237.967) (-236.668) [-239.878] (-238.597) -- 0:00:24
581000 -- [-239.312] (-238.849) (-236.098) (-237.025) * (-240.132) (-237.164) (-239.452) [-238.833] -- 0:00:24
581500 -- (-237.744) (-243.725) (-244.582) [-238.234] * [-239.394] (-236.292) (-242.826) (-237.795) -- 0:00:24
582000 -- (-237.983) (-238.134) [-238.022] (-236.880) * (-240.210) [-236.916] (-240.630) (-239.148) -- 0:00:24
582500 -- [-239.801] (-237.471) (-241.283) (-238.835) * (-239.951) (-240.190) [-241.569] (-238.176) -- 0:00:24
583000 -- (-244.532) (-239.718) (-237.706) [-238.750] * (-239.578) (-237.532) [-239.669] (-239.088) -- 0:00:24
583500 -- (-240.035) (-237.940) (-239.760) [-240.474] * (-240.957) [-238.334] (-236.673) (-241.480) -- 0:00:24
584000 -- [-236.767] (-239.847) (-238.654) (-237.285) * (-236.927) [-236.870] (-237.032) (-240.790) -- 0:00:24
584500 -- (-236.942) (-239.645) [-236.387] (-245.813) * [-236.989] (-236.540) (-238.798) (-237.904) -- 0:00:24
585000 -- (-238.897) (-239.953) (-239.295) [-240.419] * (-238.568) (-237.072) (-237.602) [-237.735] -- 0:00:24
Average standard deviation of split frequencies: 0.010136
585500 -- (-238.980) [-236.642] (-238.657) (-237.985) * [-242.172] (-238.777) (-238.046) (-237.176) -- 0:00:24
586000 -- (-237.900) [-238.207] (-245.537) (-237.093) * (-244.648) [-238.765] (-237.795) (-238.964) -- 0:00:24
586500 -- [-237.584] (-238.888) (-247.005) (-241.043) * (-238.383) [-239.653] (-239.721) (-239.578) -- 0:00:23
587000 -- [-241.904] (-240.155) (-245.240) (-239.905) * (-238.873) [-236.177] (-238.227) (-237.311) -- 0:00:23
587500 -- (-237.620) (-242.086) [-240.390] (-236.366) * (-237.845) (-240.000) (-238.724) [-237.186] -- 0:00:23
588000 -- [-237.336] (-241.881) (-241.026) (-237.231) * (-238.364) [-236.488] (-239.122) (-237.098) -- 0:00:23
588500 -- (-238.281) (-237.723) [-237.346] (-238.638) * (-238.050) (-236.898) (-238.963) [-236.745] -- 0:00:23
589000 -- [-237.105] (-239.157) (-238.785) (-237.879) * (-236.601) (-239.729) [-237.184] (-237.857) -- 0:00:23
589500 -- (-237.998) (-236.372) [-236.745] (-238.198) * (-236.356) [-237.617] (-240.943) (-238.402) -- 0:00:23
590000 -- (-237.255) [-240.615] (-240.767) (-238.981) * (-237.952) (-238.084) [-237.387] (-238.332) -- 0:00:23
Average standard deviation of split frequencies: 0.010322
590500 -- [-239.266] (-241.808) (-240.592) (-236.997) * (-244.372) (-241.000) [-236.356] (-238.320) -- 0:00:23
591000 -- (-239.284) [-238.938] (-237.174) (-236.926) * (-238.670) (-240.856) (-236.347) [-238.285] -- 0:00:23
591500 -- (-237.574) (-241.358) [-237.932] (-239.051) * (-236.258) (-238.992) (-238.446) [-236.730] -- 0:00:23
592000 -- (-236.592) (-240.688) [-238.031] (-239.497) * (-237.867) [-237.355] (-239.326) (-238.251) -- 0:00:23
592500 -- (-238.102) [-236.375] (-236.567) (-238.964) * (-237.107) [-237.756] (-242.949) (-237.168) -- 0:00:24
593000 -- (-236.423) [-236.733] (-240.347) (-237.031) * [-237.859] (-237.713) (-240.896) (-237.719) -- 0:00:24
593500 -- (-239.971) (-238.218) (-238.579) [-237.059] * [-236.891] (-238.668) (-240.043) (-245.634) -- 0:00:23
594000 -- (-239.148) (-236.748) (-237.808) [-238.138] * (-237.198) (-239.409) [-238.605] (-236.836) -- 0:00:23
594500 -- (-239.110) (-239.132) (-238.606) [-238.195] * [-238.271] (-239.897) (-239.051) (-239.197) -- 0:00:23
595000 -- (-236.262) (-240.138) (-237.032) [-238.636] * [-238.204] (-242.192) (-243.549) (-237.436) -- 0:00:23
Average standard deviation of split frequencies: 0.010134
595500 -- (-236.542) (-242.222) [-237.575] (-238.924) * (-237.920) (-238.229) [-237.732] (-237.822) -- 0:00:23
596000 -- (-239.095) (-236.131) (-240.328) [-241.741] * [-237.656] (-236.666) (-240.709) (-238.365) -- 0:00:23
596500 -- (-236.471) [-237.172] (-239.321) (-240.141) * (-236.802) (-236.563) (-238.487) [-239.823] -- 0:00:23
597000 -- (-236.431) [-238.688] (-237.909) (-239.527) * (-237.580) (-236.838) [-239.604] (-240.758) -- 0:00:23
597500 -- (-239.578) (-240.923) [-237.239] (-238.286) * (-238.358) (-236.951) [-237.521] (-241.044) -- 0:00:23
598000 -- (-237.699) (-240.446) (-237.412) [-236.799] * (-237.699) (-236.926) (-237.700) [-239.187] -- 0:00:23
598500 -- (-237.577) (-241.176) (-236.191) [-237.630] * (-238.020) (-236.856) (-243.748) [-237.932] -- 0:00:23
599000 -- (-237.822) (-238.499) (-238.407) [-240.944] * (-237.370) (-238.463) [-242.124] (-240.638) -- 0:00:23
599500 -- (-242.523) [-239.126] (-237.319) (-238.371) * [-236.868] (-239.115) (-245.029) (-242.264) -- 0:00:23
600000 -- [-238.357] (-238.089) (-241.901) (-236.741) * (-237.556) [-236.960] (-240.150) (-236.743) -- 0:00:23
Average standard deviation of split frequencies: 0.010104
600500 -- [-238.521] (-237.147) (-239.611) (-243.722) * [-240.866] (-238.644) (-240.432) (-238.530) -- 0:00:23
601000 -- [-241.625] (-237.152) (-237.878) (-241.699) * (-237.537) (-239.517) [-237.559] (-239.776) -- 0:00:23
601500 -- (-239.736) [-239.002] (-239.140) (-239.261) * (-237.310) (-240.622) (-238.152) [-236.895] -- 0:00:23
602000 -- [-240.407] (-239.281) (-238.453) (-239.188) * (-239.798) (-238.055) [-237.969] (-239.496) -- 0:00:23
602500 -- [-241.730] (-238.149) (-239.232) (-240.318) * [-237.887] (-238.519) (-240.902) (-237.666) -- 0:00:23
603000 -- (-240.439) [-236.344] (-238.083) (-240.518) * (-237.147) (-238.368) (-239.908) [-239.748] -- 0:00:23
603500 -- (-242.876) (-240.186) [-236.812] (-237.258) * [-236.355] (-236.528) (-236.809) (-244.555) -- 0:00:22
604000 -- (-238.800) (-238.726) [-237.003] (-237.589) * (-239.215) (-241.925) [-240.473] (-241.529) -- 0:00:22
604500 -- [-238.755] (-238.336) (-239.167) (-236.551) * [-238.329] (-237.340) (-239.455) (-241.869) -- 0:00:22
605000 -- (-239.664) (-237.747) (-237.337) [-238.148] * (-237.885) [-238.504] (-240.453) (-241.519) -- 0:00:22
Average standard deviation of split frequencies: 0.009905
605500 -- (-238.993) [-237.291] (-238.717) (-237.983) * (-238.346) (-238.574) [-237.254] (-240.193) -- 0:00:22
606000 -- (-237.573) (-238.851) (-237.810) [-237.619] * (-237.616) [-239.057] (-237.011) (-240.029) -- 0:00:22
606500 -- (-237.546) [-237.444] (-238.467) (-239.564) * (-238.864) (-237.481) [-237.715] (-237.681) -- 0:00:22
607000 -- (-242.581) (-237.617) (-238.185) [-237.460] * (-237.394) (-236.379) [-237.884] (-239.271) -- 0:00:22
607500 -- [-237.070] (-239.310) (-237.317) (-236.708) * (-236.731) (-238.192) [-236.567] (-240.573) -- 0:00:22
608000 -- (-238.485) (-239.139) [-238.633] (-240.474) * (-239.063) (-238.795) (-238.202) [-237.344] -- 0:00:22
608500 -- (-238.419) (-236.745) (-238.139) [-240.635] * [-237.608] (-242.351) (-239.318) (-237.950) -- 0:00:22
609000 -- (-238.858) [-236.349] (-239.797) (-240.624) * (-241.312) (-240.505) [-236.447] (-239.712) -- 0:00:22
609500 -- [-238.321] (-236.339) (-238.858) (-240.267) * [-240.095] (-241.316) (-239.307) (-238.028) -- 0:00:23
610000 -- [-236.656] (-237.325) (-237.835) (-240.604) * (-240.645) (-240.486) (-238.812) [-236.432] -- 0:00:23
Average standard deviation of split frequencies: 0.009572
610500 -- (-240.505) (-238.710) [-235.970] (-238.557) * (-244.181) (-239.302) (-240.090) [-238.052] -- 0:00:22
611000 -- [-238.698] (-238.372) (-236.472) (-236.979) * [-241.628] (-237.908) (-238.241) (-237.807) -- 0:00:22
611500 -- (-239.050) (-242.193) (-237.749) [-237.213] * (-242.429) [-237.593] (-237.704) (-242.789) -- 0:00:22
612000 -- (-237.572) (-240.886) [-237.581] (-236.806) * (-237.580) [-237.459] (-240.298) (-237.420) -- 0:00:22
612500 -- (-237.811) (-237.999) [-237.178] (-236.729) * [-237.665] (-237.000) (-242.460) (-241.411) -- 0:00:22
613000 -- [-237.276] (-237.443) (-237.979) (-240.539) * (-239.119) (-237.646) (-236.258) [-237.638] -- 0:00:22
613500 -- [-237.372] (-236.555) (-236.393) (-240.324) * [-240.322] (-236.116) (-236.658) (-239.606) -- 0:00:22
614000 -- [-239.978] (-241.610) (-236.571) (-238.487) * (-238.932) (-241.913) (-241.112) [-237.118] -- 0:00:22
614500 -- (-241.658) [-239.206] (-241.935) (-239.285) * (-237.050) (-238.836) [-242.073] (-237.141) -- 0:00:22
615000 -- (-238.223) (-237.572) [-239.820] (-237.801) * (-242.006) (-240.349) [-236.977] (-238.469) -- 0:00:22
Average standard deviation of split frequencies: 0.009375
615500 -- (-238.269) [-239.832] (-237.803) (-238.988) * (-242.651) (-237.286) (-240.193) [-241.689] -- 0:00:22
616000 -- [-236.666] (-238.694) (-236.554) (-237.438) * (-238.676) (-240.418) (-240.486) [-238.132] -- 0:00:22
616500 -- (-238.161) (-239.929) (-237.529) [-236.040] * [-237.478] (-236.831) (-238.707) (-237.948) -- 0:00:22
617000 -- (-237.636) (-243.206) [-239.325] (-237.462) * [-236.730] (-240.371) (-237.875) (-241.246) -- 0:00:22
617500 -- (-236.889) (-245.270) [-237.673] (-242.346) * (-239.685) (-249.163) (-238.597) [-236.934] -- 0:00:22
618000 -- (-238.669) (-238.874) [-239.648] (-240.368) * [-237.236] (-241.215) (-237.249) (-237.258) -- 0:00:22
618500 -- (-236.720) (-239.844) [-241.217] (-240.960) * (-244.055) [-239.854] (-238.207) (-239.144) -- 0:00:22
619000 -- (-238.428) [-241.110] (-237.195) (-240.706) * (-240.522) [-236.665] (-238.890) (-243.128) -- 0:00:22
619500 -- [-237.271] (-239.437) (-236.941) (-240.524) * [-236.502] (-239.849) (-238.406) (-237.086) -- 0:00:22
620000 -- [-240.009] (-237.191) (-236.721) (-238.658) * (-236.801) [-236.586] (-238.124) (-236.593) -- 0:00:22
Average standard deviation of split frequencies: 0.009921
620500 -- (-236.353) (-240.402) (-237.376) [-236.584] * (-236.699) (-237.829) (-236.656) [-239.291] -- 0:00:22
621000 -- [-240.268] (-248.515) (-238.172) (-236.794) * [-238.549] (-237.419) (-236.560) (-237.562) -- 0:00:21
621500 -- (-242.248) (-242.480) [-236.657] (-235.896) * [-239.133] (-238.257) (-236.779) (-240.846) -- 0:00:21
622000 -- (-240.650) (-238.542) [-237.554] (-237.437) * (-240.889) (-238.679) (-237.808) [-238.343] -- 0:00:21
622500 -- (-240.789) (-238.336) (-237.849) [-237.408] * (-237.618) [-237.594] (-237.493) (-240.061) -- 0:00:21
623000 -- [-236.953] (-237.362) (-237.406) (-245.192) * (-241.254) (-237.989) [-242.416] (-239.147) -- 0:00:21
623500 -- (-237.370) (-238.026) [-237.911] (-239.352) * (-236.821) [-241.579] (-237.299) (-237.740) -- 0:00:21
624000 -- (-238.335) (-239.467) (-240.930) [-241.391] * [-240.309] (-240.269) (-240.253) (-238.495) -- 0:00:21
624500 -- (-238.593) (-239.103) (-236.884) [-237.655] * [-239.135] (-239.739) (-238.995) (-238.396) -- 0:00:21
625000 -- (-245.864) (-240.486) (-239.118) [-237.017] * [-239.044] (-238.046) (-238.154) (-237.460) -- 0:00:21
Average standard deviation of split frequencies: 0.009648
625500 -- [-238.708] (-239.099) (-236.996) (-241.728) * [-237.888] (-237.019) (-238.873) (-237.823) -- 0:00:21
626000 -- (-239.976) (-237.390) [-237.476] (-237.540) * (-238.276) [-239.517] (-237.880) (-236.243) -- 0:00:21
626500 -- (-239.377) [-237.243] (-244.490) (-237.738) * (-243.451) [-238.000] (-237.896) (-239.144) -- 0:00:22
627000 -- (-237.141) (-237.883) (-241.518) [-236.606] * (-242.224) (-238.690) [-237.622] (-238.304) -- 0:00:22
627500 -- (-241.541) (-237.830) (-242.284) [-236.912] * [-237.233] (-238.885) (-237.152) (-239.026) -- 0:00:21
628000 -- (-237.031) (-237.834) (-237.864) [-238.211] * [-239.995] (-237.059) (-237.560) (-236.119) -- 0:00:21
628500 -- (-237.001) [-240.850] (-237.643) (-239.322) * (-238.516) (-237.704) [-237.007] (-236.480) -- 0:00:21
629000 -- (-237.772) [-241.588] (-241.288) (-238.803) * [-237.569] (-238.165) (-241.519) (-237.748) -- 0:00:21
629500 -- (-237.508) [-239.593] (-238.646) (-240.835) * [-236.331] (-237.542) (-240.049) (-237.530) -- 0:00:21
630000 -- [-238.066] (-241.179) (-237.423) (-239.418) * (-237.323) [-237.606] (-236.241) (-236.691) -- 0:00:21
Average standard deviation of split frequencies: 0.008689
630500 -- (-239.921) (-237.678) [-241.297] (-240.197) * [-237.402] (-236.817) (-237.312) (-239.202) -- 0:00:21
631000 -- (-237.891) (-239.434) [-237.719] (-239.884) * [-238.213] (-237.820) (-236.789) (-238.523) -- 0:00:21
631500 -- [-238.576] (-242.365) (-236.521) (-237.251) * [-239.941] (-239.530) (-239.800) (-238.730) -- 0:00:21
632000 -- (-237.388) [-239.309] (-240.454) (-237.165) * [-237.416] (-238.358) (-238.235) (-241.500) -- 0:00:21
632500 -- [-238.596] (-236.888) (-238.257) (-237.031) * [-237.056] (-243.127) (-238.513) (-239.015) -- 0:00:21
633000 -- (-237.290) (-237.992) (-237.716) [-239.642] * [-237.679] (-246.242) (-238.009) (-237.476) -- 0:00:21
633500 -- (-238.620) (-237.779) (-240.302) [-239.749] * (-238.062) (-237.956) [-236.649] (-238.052) -- 0:00:21
634000 -- (-237.618) (-238.199) (-239.471) [-244.548] * [-247.564] (-237.189) (-237.301) (-238.988) -- 0:00:21
634500 -- (-244.839) (-239.105) (-238.182) [-238.027] * [-239.431] (-238.003) (-236.830) (-236.909) -- 0:00:21
635000 -- [-237.486] (-240.657) (-237.017) (-240.063) * (-238.143) (-238.018) [-237.483] (-236.995) -- 0:00:21
Average standard deviation of split frequencies: 0.008987
635500 -- [-237.295] (-237.220) (-237.542) (-239.380) * [-237.248] (-236.906) (-239.459) (-237.641) -- 0:00:21
636000 -- (-243.453) [-238.008] (-236.468) (-237.501) * (-239.318) (-237.889) (-237.497) [-238.809] -- 0:00:21
636500 -- (-243.129) (-240.080) [-237.398] (-238.249) * (-237.014) (-236.761) [-239.422] (-239.654) -- 0:00:21
637000 -- (-245.469) [-238.145] (-237.263) (-240.237) * (-237.872) (-237.678) (-240.359) [-236.550] -- 0:00:21
637500 -- (-240.943) (-239.427) (-238.562) [-243.990] * (-238.491) [-238.083] (-236.373) (-235.988) -- 0:00:21
638000 -- (-237.995) [-237.705] (-236.129) (-240.349) * (-237.802) (-238.785) (-238.635) [-239.828] -- 0:00:20
638500 -- (-239.387) (-238.087) [-236.821] (-241.310) * (-237.009) [-239.755] (-239.226) (-240.132) -- 0:00:20
639000 -- [-241.264] (-239.097) (-237.518) (-238.136) * (-240.922) (-237.068) [-240.682] (-238.339) -- 0:00:20
639500 -- (-241.110) (-238.769) [-238.102] (-236.886) * (-241.101) (-238.497) [-237.381] (-236.653) -- 0:00:20
640000 -- (-236.645) [-236.827] (-237.452) (-237.250) * (-241.783) (-239.890) (-236.936) [-237.131] -- 0:00:20
Average standard deviation of split frequencies: 0.008879
640500 -- [-237.431] (-237.407) (-237.615) (-238.562) * (-238.077) [-240.595] (-238.182) (-239.031) -- 0:00:20
641000 -- (-238.580) (-237.472) (-238.373) [-241.784] * (-238.680) [-237.018] (-241.473) (-239.326) -- 0:00:20
641500 -- (-239.339) (-238.896) (-238.076) [-239.455] * (-243.372) [-238.244] (-236.964) (-238.038) -- 0:00:20
642000 -- [-236.568] (-236.461) (-238.649) (-238.677) * (-238.196) (-236.990) [-236.724] (-237.781) -- 0:00:20
642500 -- [-239.122] (-240.403) (-236.694) (-240.140) * [-242.245] (-237.231) (-238.332) (-240.462) -- 0:00:20
643000 -- (-240.225) [-239.137] (-237.876) (-238.783) * [-241.345] (-237.308) (-238.509) (-239.815) -- 0:00:20
643500 -- [-239.449] (-236.910) (-239.173) (-238.369) * (-239.829) (-236.272) [-236.258] (-241.406) -- 0:00:20
644000 -- (-237.879) (-238.222) [-239.541] (-237.230) * [-237.828] (-237.900) (-236.767) (-241.268) -- 0:00:21
644500 -- (-237.129) (-237.512) [-236.341] (-238.848) * (-235.838) (-240.718) [-236.660] (-237.832) -- 0:00:20
645000 -- (-239.056) [-237.686] (-237.679) (-236.840) * [-236.610] (-243.124) (-242.883) (-239.562) -- 0:00:20
Average standard deviation of split frequencies: 0.008757
645500 -- (-236.524) [-239.146] (-237.187) (-243.745) * (-236.524) (-239.902) [-240.475] (-238.561) -- 0:00:20
646000 -- (-239.867) (-238.736) [-240.232] (-237.818) * (-239.503) (-236.953) [-240.694] (-236.961) -- 0:00:20
646500 -- (-239.954) (-239.318) [-236.897] (-237.770) * [-239.159] (-236.751) (-245.145) (-238.760) -- 0:00:20
647000 -- [-237.390] (-239.155) (-236.784) (-238.453) * (-238.077) (-238.475) (-240.572) [-238.353] -- 0:00:20
647500 -- (-238.656) (-240.099) (-237.939) [-239.048] * (-237.332) (-239.002) [-237.722] (-239.165) -- 0:00:20
648000 -- (-236.366) (-236.504) [-237.879] (-240.433) * [-238.487] (-241.344) (-241.281) (-239.054) -- 0:00:20
648500 -- (-238.971) (-236.656) (-236.062) [-241.683] * [-238.734] (-237.090) (-241.330) (-239.180) -- 0:00:20
649000 -- (-237.904) [-240.468] (-237.259) (-237.173) * (-237.909) (-237.363) (-239.323) [-240.121] -- 0:00:20
649500 -- [-238.346] (-237.929) (-240.692) (-238.193) * (-237.746) (-237.594) (-243.014) [-237.386] -- 0:00:20
650000 -- (-238.293) [-236.405] (-236.930) (-238.663) * [-236.367] (-240.298) (-247.672) (-237.821) -- 0:00:20
Average standard deviation of split frequencies: 0.008196
650500 -- (-236.987) [-236.249] (-238.217) (-239.895) * (-236.176) [-238.741] (-239.453) (-242.268) -- 0:00:20
651000 -- (-240.794) (-237.840) [-237.627] (-240.868) * (-236.645) [-236.848] (-240.894) (-236.163) -- 0:00:20
651500 -- (-237.188) (-238.963) (-237.330) [-237.309] * (-237.310) [-239.518] (-239.652) (-237.467) -- 0:00:20
652000 -- [-239.873] (-240.205) (-242.680) (-238.081) * (-237.880) [-239.899] (-237.788) (-240.951) -- 0:00:20
652500 -- [-241.511] (-239.600) (-240.568) (-237.681) * (-237.909) (-238.860) [-238.802] (-238.544) -- 0:00:20
653000 -- (-240.120) (-237.875) [-237.986] (-239.528) * [-239.333] (-238.960) (-237.450) (-239.759) -- 0:00:20
653500 -- (-237.103) (-239.105) [-237.470] (-236.133) * (-237.975) [-239.842] (-237.681) (-237.702) -- 0:00:20
654000 -- [-238.948] (-240.392) (-240.746) (-237.564) * (-237.991) (-241.885) (-239.787) [-238.300] -- 0:00:20
654500 -- [-237.485] (-238.045) (-239.055) (-236.814) * [-239.377] (-238.820) (-237.410) (-236.136) -- 0:00:20
655000 -- (-238.195) (-245.723) (-241.749) [-237.414] * (-240.701) (-237.550) [-240.281] (-237.692) -- 0:00:20
Average standard deviation of split frequencies: 0.007680
655500 -- (-238.980) [-239.193] (-237.112) (-236.681) * (-237.517) (-236.810) [-240.313] (-238.474) -- 0:00:19
656000 -- (-236.803) [-240.429] (-238.181) (-240.777) * (-239.179) (-238.071) (-238.123) [-237.927] -- 0:00:19
656500 -- [-236.350] (-238.967) (-236.614) (-239.795) * (-236.498) (-237.775) (-236.609) [-239.330] -- 0:00:19
657000 -- [-236.875] (-237.583) (-239.372) (-243.547) * (-237.152) (-237.353) [-239.041] (-239.014) -- 0:00:19
657500 -- (-236.884) (-238.234) (-239.225) [-237.154] * (-238.386) (-241.020) (-238.178) [-237.338] -- 0:00:19
658000 -- (-238.983) (-239.556) (-237.425) [-238.447] * [-238.455] (-243.870) (-238.165) (-246.616) -- 0:00:19
658500 -- (-240.052) (-238.161) (-237.270) [-238.036] * (-240.230) (-238.115) [-238.537] (-237.951) -- 0:00:19
659000 -- (-237.046) (-238.749) [-236.798] (-237.446) * (-239.384) (-238.890) (-239.215) [-237.251] -- 0:00:19
659500 -- (-240.957) (-240.480) [-236.349] (-239.662) * [-239.662] (-237.840) (-238.189) (-237.341) -- 0:00:19
660000 -- [-242.063] (-240.960) (-238.082) (-237.887) * (-238.352) (-240.940) [-239.535] (-239.155) -- 0:00:19
Average standard deviation of split frequencies: 0.007516
660500 -- [-236.822] (-240.276) (-248.196) (-240.778) * (-241.436) [-240.965] (-236.526) (-236.612) -- 0:00:19
661000 -- (-239.651) [-242.014] (-237.237) (-238.121) * (-237.336) (-240.430) [-237.010] (-239.822) -- 0:00:19
661500 -- (-236.741) (-239.287) [-238.148] (-237.412) * (-238.465) (-240.745) [-237.966] (-237.089) -- 0:00:19
662000 -- (-237.221) [-239.030] (-237.124) (-238.001) * (-238.656) (-236.035) [-235.972] (-238.163) -- 0:00:19
662500 -- (-237.661) [-244.353] (-240.661) (-236.671) * (-240.477) (-238.066) [-237.249] (-239.332) -- 0:00:19
663000 -- (-244.464) (-240.607) (-240.460) [-239.287] * [-238.409] (-238.491) (-241.514) (-240.302) -- 0:00:19
663500 -- [-243.710] (-237.374) (-237.095) (-236.759) * (-237.769) (-237.061) [-239.698] (-240.937) -- 0:00:19
664000 -- [-238.315] (-240.422) (-237.644) (-237.792) * [-243.102] (-237.548) (-239.347) (-241.104) -- 0:00:19
664500 -- (-235.893) [-239.513] (-239.390) (-237.411) * (-239.775) [-238.503] (-238.462) (-239.050) -- 0:00:19
665000 -- [-237.054] (-239.517) (-238.984) (-236.757) * [-239.600] (-236.348) (-239.408) (-241.446) -- 0:00:19
Average standard deviation of split frequencies: 0.007565
665500 -- [-237.370] (-238.342) (-242.458) (-240.505) * [-241.257] (-240.322) (-237.498) (-237.425) -- 0:00:19
666000 -- (-238.064) [-236.517] (-236.060) (-236.921) * [-237.387] (-237.937) (-239.069) (-238.142) -- 0:00:19
666500 -- (-239.651) (-236.553) [-236.456] (-241.507) * (-237.143) (-239.581) (-239.345) [-236.190] -- 0:00:19
667000 -- (-238.588) (-238.098) (-236.874) [-239.722] * (-238.168) (-241.443) [-240.512] (-237.070) -- 0:00:19
667500 -- (-243.475) (-238.471) [-236.894] (-237.679) * (-239.945) (-239.832) (-238.008) [-237.619] -- 0:00:19
668000 -- (-240.357) (-237.193) [-236.432] (-236.443) * (-236.389) [-239.620] (-237.051) (-239.920) -- 0:00:19
668500 -- [-236.792] (-240.645) (-240.904) (-236.697) * [-238.134] (-239.054) (-239.734) (-238.901) -- 0:00:19
669000 -- (-238.237) (-240.709) [-240.235] (-236.923) * (-238.229) (-240.135) [-237.444] (-238.785) -- 0:00:19
669500 -- (-239.641) [-236.870] (-240.202) (-238.376) * (-236.652) (-238.626) (-240.579) [-238.899] -- 0:00:19
670000 -- (-237.829) [-239.465] (-240.631) (-238.808) * (-240.071) [-238.343] (-239.866) (-237.780) -- 0:00:19
Average standard deviation of split frequencies: 0.008013
670500 -- (-236.367) [-239.157] (-237.341) (-239.117) * (-239.430) [-238.512] (-236.890) (-238.359) -- 0:00:19
671000 -- [-241.227] (-237.170) (-238.388) (-237.824) * (-240.676) (-238.228) (-236.870) [-236.980] -- 0:00:19
671500 -- [-239.799] (-240.387) (-239.000) (-236.780) * (-236.494) (-237.960) (-239.074) [-237.342] -- 0:00:19
672000 -- (-238.565) (-239.069) [-238.071] (-236.142) * (-236.597) (-236.288) [-237.868] (-239.037) -- 0:00:19
672500 -- (-236.981) (-238.968) [-240.537] (-236.629) * (-238.029) (-240.651) (-237.560) [-239.389] -- 0:00:18
673000 -- (-237.431) [-240.475] (-239.114) (-239.074) * (-238.753) (-237.883) (-238.885) [-237.664] -- 0:00:18
673500 -- (-237.017) (-238.779) [-240.247] (-242.686) * (-237.459) [-237.481] (-241.740) (-240.996) -- 0:00:18
674000 -- [-238.703] (-237.734) (-236.795) (-241.181) * (-237.786) (-238.649) [-237.100] (-239.328) -- 0:00:18
674500 -- (-236.898) (-237.420) [-236.899] (-239.211) * (-238.887) (-238.868) [-236.839] (-238.428) -- 0:00:18
675000 -- (-237.661) (-238.957) [-237.199] (-239.004) * (-237.741) (-236.472) (-240.422) [-237.395] -- 0:00:18
Average standard deviation of split frequencies: 0.008508
675500 -- (-236.829) (-242.120) (-239.925) [-238.400] * (-239.802) (-237.163) [-238.783] (-241.029) -- 0:00:18
676000 -- (-236.263) (-237.740) (-236.633) [-238.569] * [-236.836] (-238.046) (-236.887) (-238.384) -- 0:00:18
676500 -- (-240.764) (-242.794) [-236.271] (-238.741) * (-237.448) (-237.099) (-237.927) [-236.897] -- 0:00:18
677000 -- [-238.953] (-241.673) (-239.026) (-241.908) * (-236.986) (-239.120) [-238.066] (-240.719) -- 0:00:18
677500 -- (-238.295) (-238.591) [-240.631] (-239.531) * (-240.531) [-238.441] (-239.951) (-244.743) -- 0:00:18
678000 -- (-237.363) (-239.082) (-238.664) [-237.248] * (-241.247) [-239.998] (-237.541) (-240.346) -- 0:00:18
678500 -- (-240.013) (-240.721) (-239.281) [-240.703] * (-238.675) [-240.871] (-237.374) (-236.897) -- 0:00:18
679000 -- (-236.300) (-238.297) (-236.989) [-237.965] * (-240.882) (-238.399) (-237.142) [-239.695] -- 0:00:18
679500 -- (-242.413) (-237.490) (-237.642) [-236.965] * (-240.902) (-236.560) [-239.824] (-238.841) -- 0:00:18
680000 -- (-237.850) (-238.262) (-238.021) [-237.611] * (-239.325) [-236.919] (-239.652) (-238.457) -- 0:00:18
Average standard deviation of split frequencies: 0.008588
680500 -- (-243.520) (-237.166) [-237.981] (-236.553) * (-242.352) (-241.353) (-238.273) [-237.986] -- 0:00:18
681000 -- (-240.696) (-236.425) (-240.199) [-236.317] * (-239.275) (-236.492) (-239.688) [-239.082] -- 0:00:18
681500 -- [-238.353] (-238.131) (-237.577) (-236.960) * [-237.946] (-241.444) (-236.820) (-240.823) -- 0:00:18
682000 -- (-242.060) [-238.653] (-237.282) (-238.035) * (-240.596) (-237.314) [-237.314] (-238.281) -- 0:00:18
682500 -- [-236.552] (-237.140) (-239.752) (-237.289) * [-238.173] (-236.749) (-245.445) (-244.032) -- 0:00:18
683000 -- [-237.898] (-235.869) (-237.224) (-240.147) * (-240.988) [-237.328] (-248.132) (-239.840) -- 0:00:18
683500 -- (-238.992) (-240.468) (-238.205) [-236.949] * (-239.170) [-238.229] (-237.948) (-240.155) -- 0:00:18
684000 -- [-237.471] (-237.684) (-237.532) (-238.508) * (-239.859) [-239.771] (-241.702) (-238.871) -- 0:00:18
684500 -- (-237.521) [-239.278] (-236.552) (-237.252) * (-243.217) [-237.977] (-236.213) (-239.005) -- 0:00:18
685000 -- (-241.166) (-239.130) (-238.946) [-237.185] * (-238.766) [-237.688] (-236.723) (-236.123) -- 0:00:18
Average standard deviation of split frequencies: 0.008475
685500 -- (-237.047) (-239.400) [-236.692] (-238.654) * (-237.581) (-238.804) (-236.578) [-236.605] -- 0:00:18
686000 -- (-237.149) (-237.891) (-239.834) [-238.028] * (-240.478) (-239.035) [-238.882] (-236.125) -- 0:00:18
686500 -- (-238.804) (-238.912) (-238.258) [-237.375] * [-237.832] (-241.285) (-238.556) (-237.871) -- 0:00:18
687000 -- (-238.058) (-237.895) (-240.354) [-242.363] * (-238.207) [-236.117] (-236.968) (-241.025) -- 0:00:18
687500 -- [-237.378] (-236.755) (-237.836) (-239.761) * [-237.255] (-237.789) (-236.633) (-241.037) -- 0:00:18
688000 -- (-237.477) (-236.988) [-236.809] (-240.016) * [-237.266] (-237.191) (-239.352) (-236.562) -- 0:00:18
688500 -- [-238.219] (-241.777) (-237.423) (-243.657) * (-237.910) (-238.645) (-240.736) [-239.174] -- 0:00:18
689000 -- [-237.729] (-240.700) (-236.724) (-237.548) * (-238.276) (-243.086) (-239.274) [-238.527] -- 0:00:18
689500 -- [-237.339] (-239.526) (-241.330) (-236.586) * (-237.206) [-237.169] (-239.530) (-238.289) -- 0:00:18
690000 -- (-238.531) [-238.379] (-240.711) (-239.235) * [-238.071] (-240.173) (-242.968) (-243.964) -- 0:00:17
Average standard deviation of split frequencies: 0.008099
690500 -- (-242.369) (-238.660) [-237.307] (-240.536) * [-238.654] (-236.851) (-238.287) (-237.982) -- 0:00:17
691000 -- [-238.848] (-239.624) (-237.488) (-240.858) * (-239.097) [-236.686] (-238.110) (-239.237) -- 0:00:17
691500 -- [-240.017] (-236.650) (-237.684) (-245.102) * (-246.116) (-236.855) [-237.510] (-237.289) -- 0:00:17
692000 -- (-236.722) [-237.110] (-238.388) (-239.416) * (-237.444) [-237.139] (-237.754) (-240.526) -- 0:00:17
692500 -- (-237.436) (-237.791) [-238.335] (-239.180) * (-237.164) (-239.892) (-238.811) [-236.645] -- 0:00:17
693000 -- (-247.171) (-237.568) (-237.706) [-238.579] * (-238.966) (-237.600) [-237.658] (-239.566) -- 0:00:17
693500 -- (-243.733) (-236.058) (-238.624) [-237.701] * [-236.704] (-238.070) (-236.680) (-240.963) -- 0:00:17
694000 -- (-239.709) (-237.177) (-238.010) [-239.591] * (-237.738) [-237.194] (-236.156) (-236.459) -- 0:00:17
694500 -- [-239.000] (-242.518) (-237.761) (-239.856) * (-236.470) (-239.058) (-239.349) [-236.795] -- 0:00:17
695000 -- (-239.048) [-238.498] (-236.904) (-238.099) * (-237.152) (-241.104) [-239.846] (-238.620) -- 0:00:17
Average standard deviation of split frequencies: 0.008763
695500 -- (-237.874) (-240.845) [-238.416] (-237.507) * (-236.946) (-236.545) (-240.809) [-237.634] -- 0:00:17
696000 -- (-237.826) (-238.058) (-236.652) [-236.712] * (-236.184) (-241.845) [-237.451] (-240.768) -- 0:00:17
696500 -- [-237.548] (-236.627) (-238.664) (-238.167) * (-239.980) (-237.928) [-239.685] (-237.737) -- 0:00:17
697000 -- [-239.573] (-238.886) (-238.085) (-239.660) * (-242.527) (-239.465) [-237.580] (-236.747) -- 0:00:17
697500 -- (-240.311) [-240.358] (-237.755) (-238.878) * (-236.849) (-238.287) [-236.704] (-238.542) -- 0:00:17
698000 -- (-237.910) [-238.035] (-237.652) (-238.658) * (-239.722) (-237.421) [-237.636] (-239.119) -- 0:00:17
698500 -- (-236.827) (-237.479) (-237.199) [-239.065] * (-237.794) (-238.999) [-237.173] (-238.119) -- 0:00:17
699000 -- [-239.492] (-237.029) (-239.228) (-237.179) * [-239.422] (-240.375) (-239.078) (-239.973) -- 0:00:17
699500 -- (-236.573) (-238.668) (-238.823) [-236.980] * [-242.872] (-238.578) (-239.738) (-238.429) -- 0:00:17
700000 -- (-237.900) (-238.418) [-238.946] (-237.882) * (-239.407) [-239.170] (-242.479) (-238.083) -- 0:00:17
Average standard deviation of split frequencies: 0.009041
700500 -- (-237.766) [-239.115] (-239.645) (-238.018) * [-241.262] (-236.814) (-236.622) (-241.274) -- 0:00:17
701000 -- (-237.559) [-236.960] (-236.646) (-239.031) * (-242.728) (-236.562) (-238.531) [-238.438] -- 0:00:17
701500 -- (-240.929) (-236.264) (-237.724) [-237.042] * [-237.009] (-238.224) (-237.862) (-240.756) -- 0:00:17
702000 -- (-243.193) (-236.706) (-236.421) [-239.311] * [-237.344] (-238.712) (-237.237) (-238.954) -- 0:00:17
702500 -- (-239.284) (-238.281) (-239.790) [-239.072] * (-237.414) [-237.085] (-237.347) (-236.610) -- 0:00:17
703000 -- [-239.856] (-240.389) (-240.299) (-239.652) * (-238.166) (-238.301) (-241.903) [-237.015] -- 0:00:17
703500 -- (-240.026) (-238.159) [-239.033] (-237.932) * (-238.867) (-239.929) [-239.134] (-240.972) -- 0:00:17
704000 -- (-241.941) [-238.119] (-239.976) (-236.993) * (-240.760) (-238.752) [-242.519] (-237.458) -- 0:00:17
704500 -- (-238.534) (-237.137) (-240.557) [-237.638] * (-241.487) (-238.703) [-237.378] (-236.379) -- 0:00:17
705000 -- (-238.630) [-241.212] (-244.118) (-237.674) * (-237.135) (-242.558) (-237.579) [-238.412] -- 0:00:17
Average standard deviation of split frequencies: 0.008805
705500 -- [-236.983] (-240.659) (-240.187) (-238.289) * (-239.077) [-238.036] (-239.899) (-238.674) -- 0:00:17
706000 -- (-238.366) [-237.235] (-241.065) (-237.471) * [-240.013] (-237.830) (-240.778) (-239.103) -- 0:00:17
706500 -- (-238.206) [-240.008] (-242.710) (-236.843) * (-237.928) (-237.681) (-240.890) [-239.266] -- 0:00:17
707000 -- [-237.753] (-239.280) (-238.740) (-237.953) * (-239.008) [-236.797] (-236.303) (-236.364) -- 0:00:16
707500 -- [-236.565] (-240.172) (-238.489) (-236.669) * [-236.491] (-239.747) (-242.132) (-236.787) -- 0:00:16
708000 -- [-238.042] (-239.430) (-237.129) (-237.986) * (-236.201) (-242.140) (-237.198) [-236.724] -- 0:00:16
708500 -- [-237.991] (-239.773) (-238.821) (-237.614) * (-240.506) (-237.984) (-237.770) [-237.339] -- 0:00:16
709000 -- (-240.765) (-237.046) [-237.190] (-238.184) * (-236.884) (-241.641) (-237.879) [-241.655] -- 0:00:16
709500 -- (-240.851) (-238.328) [-239.624] (-239.428) * [-236.835] (-238.866) (-239.498) (-241.814) -- 0:00:16
710000 -- (-237.536) [-240.287] (-242.486) (-237.410) * [-241.417] (-240.678) (-240.107) (-239.778) -- 0:00:16
Average standard deviation of split frequencies: 0.008623
710500 -- (-237.579) [-237.956] (-239.753) (-239.303) * (-239.330) (-236.559) (-236.793) [-238.305] -- 0:00:16
711000 -- (-238.765) (-237.437) (-236.803) [-236.916] * (-240.936) [-239.547] (-239.984) (-236.490) -- 0:00:16
711500 -- (-236.248) (-238.197) (-240.987) [-237.310] * [-237.330] (-238.316) (-236.585) (-236.964) -- 0:00:16
712000 -- (-238.390) (-238.093) [-236.813] (-239.100) * (-236.636) [-237.199] (-236.748) (-240.599) -- 0:00:16
712500 -- (-237.217) (-241.705) (-237.371) [-236.257] * (-240.895) (-240.727) [-237.348] (-239.522) -- 0:00:16
713000 -- [-239.274] (-238.138) (-237.911) (-237.017) * (-238.094) (-238.481) (-239.888) [-236.386] -- 0:00:16
713500 -- (-241.652) (-237.582) [-240.897] (-237.668) * [-238.940] (-239.544) (-237.223) (-236.368) -- 0:00:16
714000 -- (-240.501) (-237.480) (-239.215) [-237.002] * (-237.957) (-237.570) (-239.474) [-237.630] -- 0:00:16
714500 -- (-238.927) [-237.135] (-236.377) (-238.352) * (-239.943) (-240.268) [-236.584] (-238.212) -- 0:00:16
715000 -- [-240.180] (-238.050) (-237.668) (-237.611) * (-238.881) (-239.640) (-240.172) [-238.710] -- 0:00:16
Average standard deviation of split frequencies: 0.008559
715500 -- (-238.291) [-237.848] (-240.726) (-239.187) * (-238.497) (-239.594) [-239.456] (-239.878) -- 0:00:16
716000 -- (-237.768) [-239.324] (-248.538) (-237.348) * (-238.280) (-241.209) (-238.966) [-243.059] -- 0:00:16
716500 -- (-240.002) (-244.919) (-240.705) [-240.548] * [-236.793] (-239.988) (-237.700) (-240.070) -- 0:00:16
717000 -- (-238.929) (-242.850) (-238.163) [-237.684] * (-238.683) (-240.765) (-237.261) [-238.115] -- 0:00:16
717500 -- [-239.253] (-242.609) (-240.624) (-238.023) * (-238.137) (-238.702) [-237.029] (-236.707) -- 0:00:16
718000 -- (-237.487) (-237.520) [-238.021] (-236.656) * (-241.111) (-237.296) [-242.183] (-237.229) -- 0:00:16
718500 -- (-238.315) [-236.644] (-238.494) (-238.697) * (-238.280) (-240.965) [-241.240] (-236.593) -- 0:00:16
719000 -- (-237.223) [-239.331] (-243.043) (-237.674) * (-238.811) [-237.853] (-242.111) (-237.736) -- 0:00:16
719500 -- [-236.638] (-239.629) (-239.232) (-237.275) * (-238.570) [-238.180] (-237.377) (-237.583) -- 0:00:16
720000 -- (-242.793) (-239.414) (-238.142) [-240.883] * (-237.366) [-238.099] (-239.285) (-238.831) -- 0:00:16
Average standard deviation of split frequencies: 0.008544
720500 -- [-236.981] (-237.571) (-250.073) (-236.232) * (-236.955) (-244.807) [-239.078] (-240.690) -- 0:00:16
721000 -- (-238.184) [-239.206] (-240.368) (-239.351) * (-240.343) (-237.294) [-236.688] (-236.763) -- 0:00:16
721500 -- [-237.321] (-237.435) (-242.972) (-238.266) * (-238.679) (-236.366) [-240.074] (-239.615) -- 0:00:16
722000 -- (-239.156) [-238.674] (-239.675) (-238.418) * [-237.395] (-238.636) (-240.118) (-238.451) -- 0:00:16
722500 -- (-237.134) [-238.092] (-238.612) (-237.639) * [-237.095] (-239.995) (-240.265) (-239.948) -- 0:00:16
723000 -- [-237.857] (-238.173) (-238.446) (-236.351) * (-237.609) [-239.892] (-239.897) (-239.007) -- 0:00:16
723500 -- (-238.894) [-237.492] (-238.124) (-236.649) * (-239.088) (-239.192) (-237.702) [-239.013] -- 0:00:16
724000 -- (-241.033) [-238.002] (-237.410) (-239.803) * [-240.379] (-245.566) (-239.859) (-243.906) -- 0:00:16
724500 -- (-239.440) (-238.448) [-237.441] (-238.509) * (-237.235) (-238.577) [-238.438] (-246.564) -- 0:00:15
725000 -- [-240.772] (-241.878) (-239.851) (-237.595) * (-236.394) (-239.510) [-238.714] (-236.828) -- 0:00:15
Average standard deviation of split frequencies: 0.008899
725500 -- [-236.485] (-238.418) (-236.351) (-240.135) * (-239.135) [-237.088] (-237.253) (-236.738) -- 0:00:15
726000 -- (-238.467) [-236.886] (-241.153) (-237.059) * (-239.594) [-238.059] (-240.870) (-242.414) -- 0:00:15
726500 -- (-237.927) (-238.693) (-245.171) [-238.180] * (-239.913) [-237.712] (-239.118) (-238.973) -- 0:00:15
727000 -- [-237.740] (-236.593) (-241.889) (-239.731) * (-238.926) (-236.175) [-238.357] (-241.067) -- 0:00:15
727500 -- (-243.736) (-238.063) (-237.815) [-237.386] * (-238.288) (-238.298) (-243.046) [-238.598] -- 0:00:15
728000 -- (-241.300) (-236.903) (-240.156) [-237.212] * (-240.387) (-237.214) (-237.262) [-249.464] -- 0:00:15
728500 -- (-242.829) (-238.947) [-238.207] (-237.170) * (-236.682) [-237.039] (-237.925) (-244.120) -- 0:00:15
729000 -- (-239.468) (-239.597) (-237.238) [-237.318] * (-238.687) (-237.196) (-238.549) [-243.337] -- 0:00:15
729500 -- (-239.667) (-237.460) (-237.681) [-237.924] * [-238.137] (-238.551) (-240.819) (-239.175) -- 0:00:15
730000 -- (-240.213) (-241.982) (-238.153) [-238.682] * (-240.917) (-236.334) [-238.366] (-241.540) -- 0:00:15
Average standard deviation of split frequencies: 0.008065
730500 -- (-239.826) (-236.683) [-240.086] (-244.113) * (-237.647) (-240.644) (-239.092) [-237.693] -- 0:00:15
731000 -- (-240.352) [-236.096] (-238.917) (-236.864) * (-239.208) (-238.586) [-239.104] (-237.265) -- 0:00:15
731500 -- [-240.890] (-236.778) (-239.761) (-239.155) * [-238.354] (-240.105) (-239.662) (-239.085) -- 0:00:15
732000 -- (-238.447) [-237.976] (-239.488) (-237.634) * [-241.690] (-242.414) (-238.943) (-244.709) -- 0:00:15
732500 -- (-238.105) [-238.313] (-239.056) (-239.912) * [-243.389] (-237.885) (-238.561) (-241.896) -- 0:00:15
733000 -- (-242.100) (-239.028) [-238.226] (-236.428) * (-236.719) (-236.987) [-239.109] (-238.727) -- 0:00:15
733500 -- (-240.271) (-240.140) (-238.002) [-237.030] * (-237.575) (-236.909) (-242.077) [-236.829] -- 0:00:15
734000 -- (-240.108) (-238.539) [-238.326] (-238.177) * (-237.680) [-236.437] (-236.100) (-237.703) -- 0:00:15
734500 -- (-239.986) [-238.459] (-239.415) (-236.843) * (-238.475) (-238.964) [-236.557] (-242.483) -- 0:00:15
735000 -- (-240.643) [-237.903] (-237.106) (-237.511) * (-243.633) [-237.413] (-241.692) (-239.779) -- 0:00:15
Average standard deviation of split frequencies: 0.008126
735500 -- (-243.910) (-238.616) (-238.220) [-237.078] * (-237.346) (-242.067) [-238.477] (-238.592) -- 0:00:15
736000 -- (-238.712) [-238.448] (-238.281) (-237.689) * (-237.783) (-241.187) (-237.164) [-238.128] -- 0:00:15
736500 -- (-241.161) (-238.271) (-237.332) [-237.272] * (-240.775) (-239.730) [-236.713] (-237.914) -- 0:00:15
737000 -- (-236.966) [-236.498] (-237.739) (-237.462) * [-238.393] (-236.583) (-237.386) (-237.377) -- 0:00:15
737500 -- (-237.718) (-236.419) (-238.613) [-236.730] * (-238.718) (-242.687) [-237.900] (-237.878) -- 0:00:15
738000 -- [-238.235] (-236.736) (-243.333) (-236.941) * (-237.544) (-236.377) (-242.552) [-237.107] -- 0:00:15
738500 -- (-236.687) (-236.451) (-236.908) [-237.846] * (-239.543) [-239.371] (-237.573) (-238.149) -- 0:00:15
739000 -- (-239.222) [-236.903] (-239.043) (-236.743) * [-238.288] (-242.375) (-237.433) (-237.786) -- 0:00:15
739500 -- (-240.616) [-237.787] (-237.670) (-238.665) * (-237.690) (-237.663) (-236.345) [-236.960] -- 0:00:15
740000 -- [-237.800] (-238.854) (-237.840) (-237.621) * [-239.806] (-239.516) (-237.697) (-239.245) -- 0:00:15
Average standard deviation of split frequencies: 0.008194
740500 -- (-238.945) [-240.916] (-243.097) (-237.416) * [-240.701] (-236.834) (-239.577) (-239.511) -- 0:00:15
741000 -- (-238.354) (-242.909) (-239.269) [-239.588] * [-237.193] (-238.951) (-236.701) (-239.114) -- 0:00:15
741500 -- [-237.421] (-239.688) (-240.733) (-239.859) * (-240.666) (-236.877) [-237.018] (-239.450) -- 0:00:14
742000 -- [-238.079] (-238.930) (-238.352) (-240.748) * (-240.998) (-238.408) (-236.488) [-238.941] -- 0:00:14
742500 -- [-238.524] (-241.928) (-236.764) (-242.959) * [-237.541] (-238.316) (-241.332) (-238.596) -- 0:00:14
743000 -- [-237.590] (-237.161) (-237.274) (-238.321) * [-238.117] (-240.162) (-240.136) (-238.045) -- 0:00:14
743500 -- (-238.360) (-237.202) (-238.151) [-237.181] * (-237.404) [-237.606] (-239.706) (-238.126) -- 0:00:14
744000 -- (-237.034) (-237.900) (-237.045) [-237.644] * [-238.064] (-239.265) (-237.278) (-238.357) -- 0:00:14
744500 -- (-237.714) [-236.832] (-238.696) (-236.475) * (-239.654) (-238.793) [-237.141] (-236.599) -- 0:00:14
745000 -- (-240.335) [-239.857] (-237.093) (-240.645) * (-237.869) (-238.640) [-238.028] (-239.521) -- 0:00:14
Average standard deviation of split frequencies: 0.008689
745500 -- (-237.665) [-241.940] (-237.640) (-240.501) * [-241.187] (-237.792) (-239.245) (-240.633) -- 0:00:14
746000 -- (-237.657) (-242.448) (-236.422) [-237.433] * (-238.574) [-240.905] (-237.968) (-236.280) -- 0:00:14
746500 -- (-236.142) (-237.824) [-236.797] (-238.045) * (-236.777) (-238.897) [-238.227] (-237.926) -- 0:00:14
747000 -- [-237.779] (-242.282) (-238.538) (-238.758) * (-238.652) [-237.696] (-236.579) (-239.921) -- 0:00:14
747500 -- (-238.888) (-241.333) [-237.776] (-243.364) * (-236.296) (-238.109) (-238.431) [-236.899] -- 0:00:14
748000 -- (-237.618) [-236.940] (-239.212) (-239.589) * (-239.107) (-238.225) [-237.189] (-239.538) -- 0:00:14
748500 -- (-238.313) (-237.605) (-238.836) [-238.270] * [-237.936] (-238.796) (-237.263) (-238.145) -- 0:00:14
749000 -- (-239.134) [-238.340] (-237.779) (-238.804) * (-239.217) [-237.520] (-238.084) (-237.603) -- 0:00:14
749500 -- (-237.766) (-240.731) [-239.094] (-237.556) * [-238.474] (-239.068) (-238.817) (-240.595) -- 0:00:14
750000 -- (-239.732) [-237.992] (-242.865) (-239.467) * [-237.572] (-238.098) (-237.489) (-238.015) -- 0:00:14
Average standard deviation of split frequencies: 0.008674
750500 -- (-241.456) (-237.285) [-238.581] (-237.130) * [-237.201] (-238.936) (-239.826) (-238.020) -- 0:00:14
751000 -- [-240.666] (-237.248) (-240.132) (-238.451) * (-244.218) (-238.805) [-240.061] (-236.625) -- 0:00:14
751500 -- (-239.579) [-237.258] (-239.512) (-236.548) * [-239.032] (-240.911) (-239.933) (-236.214) -- 0:00:14
752000 -- (-240.455) (-236.457) (-239.664) [-242.389] * (-241.949) (-236.578) (-239.312) [-237.941] -- 0:00:14
752500 -- (-240.907) (-238.180) [-237.349] (-237.451) * (-239.362) (-237.575) (-238.646) [-236.645] -- 0:00:14
753000 -- (-239.681) [-236.989] (-236.997) (-238.710) * [-238.267] (-237.351) (-241.892) (-241.048) -- 0:00:14
753500 -- (-238.751) (-236.550) (-236.673) [-241.917] * (-242.342) [-238.592] (-236.505) (-239.318) -- 0:00:14
754000 -- (-242.244) (-236.511) [-236.969] (-240.082) * (-239.473) [-240.444] (-238.534) (-240.276) -- 0:00:14
754500 -- (-236.451) (-238.629) [-237.538] (-238.825) * (-241.053) [-237.084] (-236.850) (-243.580) -- 0:00:14
755000 -- (-241.726) (-237.822) (-238.373) [-238.854] * (-242.848) [-237.844] (-241.485) (-238.248) -- 0:00:14
Average standard deviation of split frequencies: 0.008418
755500 -- [-237.384] (-242.471) (-238.015) (-237.446) * (-236.420) (-241.387) (-242.209) [-237.799] -- 0:00:14
756000 -- (-237.760) [-247.128] (-236.169) (-236.181) * (-236.385) (-238.260) [-239.357] (-240.941) -- 0:00:14
756500 -- [-236.695] (-243.745) (-242.087) (-236.114) * [-237.843] (-241.906) (-242.212) (-239.047) -- 0:00:14
757000 -- (-236.767) (-237.623) [-239.682] (-236.335) * [-239.478] (-239.363) (-237.282) (-242.299) -- 0:00:14
757500 -- [-236.912] (-238.003) (-236.802) (-237.452) * (-242.983) [-237.546] (-237.763) (-240.660) -- 0:00:14
758000 -- (-238.884) (-237.863) [-236.829] (-237.253) * [-236.430] (-236.884) (-239.426) (-242.174) -- 0:00:14
758500 -- [-241.055] (-236.864) (-238.382) (-239.988) * [-236.464] (-237.192) (-238.493) (-237.521) -- 0:00:14
759000 -- (-241.416) (-236.796) [-236.798] (-238.662) * (-235.981) (-236.603) (-238.861) [-237.223] -- 0:00:13
759500 -- (-238.857) (-240.195) [-236.627] (-238.429) * (-237.336) (-241.002) (-237.280) [-238.284] -- 0:00:13
760000 -- [-240.356] (-238.860) (-237.054) (-237.767) * (-236.528) (-237.186) (-239.921) [-237.473] -- 0:00:13
Average standard deviation of split frequencies: 0.008560
760500 -- (-238.766) (-237.229) [-239.739] (-237.681) * (-237.213) (-237.680) (-239.733) [-238.480] -- 0:00:13
761000 -- (-238.299) (-237.883) [-236.775] (-239.415) * (-236.247) (-236.456) [-238.153] (-237.325) -- 0:00:13
761500 -- (-236.533) [-236.515] (-244.360) (-243.492) * (-237.287) [-240.595] (-238.673) (-244.435) -- 0:00:13
762000 -- (-237.444) (-238.792) [-237.734] (-241.711) * (-238.206) (-241.354) (-237.221) [-238.816] -- 0:00:13
762500 -- (-237.988) [-236.847] (-236.760) (-238.044) * [-236.803] (-236.543) (-237.025) (-237.184) -- 0:00:13
763000 -- (-240.406) (-238.841) [-238.076] (-239.063) * (-238.555) (-237.299) (-236.972) [-236.873] -- 0:00:13
763500 -- (-237.679) (-237.895) [-237.199] (-237.469) * (-238.252) (-242.446) (-240.624) [-236.885] -- 0:00:13
764000 -- [-236.527] (-240.804) (-237.908) (-239.281) * (-238.451) [-243.446] (-238.057) (-238.085) -- 0:00:13
764500 -- [-235.973] (-242.166) (-243.326) (-237.078) * (-236.202) [-239.816] (-239.298) (-238.616) -- 0:00:13
765000 -- (-238.666) (-240.842) [-239.260] (-236.645) * [-236.887] (-238.663) (-240.909) (-237.045) -- 0:00:13
Average standard deviation of split frequencies: 0.008580
765500 -- [-237.869] (-243.056) (-237.820) (-237.457) * (-236.075) [-242.074] (-238.613) (-237.895) -- 0:00:13
766000 -- (-237.167) (-242.722) (-237.772) [-236.984] * (-236.403) [-236.864] (-241.057) (-236.552) -- 0:00:13
766500 -- (-239.837) [-240.260] (-240.160) (-238.272) * (-237.268) (-237.260) (-237.775) [-236.851] -- 0:00:13
767000 -- [-237.165] (-241.280) (-239.904) (-236.960) * (-238.688) [-236.472] (-241.819) (-236.700) -- 0:00:13
767500 -- (-237.681) (-238.897) (-238.899) [-237.544] * (-237.311) [-236.570] (-240.656) (-239.237) -- 0:00:13
768000 -- [-237.449] (-239.628) (-241.506) (-241.877) * (-237.224) (-237.764) [-237.898] (-239.554) -- 0:00:13
768500 -- (-239.165) (-240.567) [-240.179] (-240.427) * [-238.322] (-236.995) (-237.125) (-240.064) -- 0:00:13
769000 -- (-237.994) [-238.463] (-240.074) (-237.904) * [-238.934] (-236.901) (-239.270) (-241.444) -- 0:00:13
769500 -- (-239.767) (-237.362) (-237.020) [-237.371] * (-238.307) (-238.320) [-237.505] (-237.742) -- 0:00:13
770000 -- (-237.300) (-240.063) [-237.699] (-240.736) * (-241.417) [-238.541] (-238.726) (-240.005) -- 0:00:13
Average standard deviation of split frequencies: 0.008411
770500 -- (-238.552) [-242.223] (-236.783) (-237.436) * [-246.132] (-240.006) (-239.071) (-238.105) -- 0:00:13
771000 -- (-237.608) [-239.110] (-236.585) (-239.027) * (-238.393) (-237.694) (-239.523) [-236.367] -- 0:00:13
771500 -- [-238.395] (-238.050) (-237.751) (-237.070) * (-237.599) (-244.614) (-244.479) [-237.494] -- 0:00:13
772000 -- (-236.595) (-237.870) [-237.275] (-236.801) * [-237.456] (-238.025) (-239.514) (-240.937) -- 0:00:13
772500 -- (-237.651) [-237.731] (-239.767) (-240.094) * (-237.834) (-237.725) (-238.898) [-239.312] -- 0:00:13
773000 -- [-237.052] (-236.923) (-239.045) (-239.240) * (-239.252) (-237.069) [-237.646] (-243.580) -- 0:00:13
773500 -- [-240.033] (-238.412) (-239.028) (-239.258) * (-238.183) [-239.102] (-238.701) (-242.359) -- 0:00:13
774000 -- (-238.281) (-245.273) [-236.394] (-239.022) * [-239.274] (-240.151) (-237.553) (-241.289) -- 0:00:13
774500 -- (-238.220) (-239.350) (-237.580) [-237.064] * [-238.920] (-236.376) (-239.122) (-240.312) -- 0:00:13
775000 -- (-237.233) [-237.028] (-237.183) (-239.323) * (-237.414) [-239.440] (-238.259) (-237.123) -- 0:00:13
Average standard deviation of split frequencies: 0.008201
775500 -- [-243.374] (-242.336) (-241.023) (-239.971) * [-239.488] (-238.953) (-237.140) (-239.522) -- 0:00:13
776000 -- (-239.651) [-242.220] (-238.471) (-236.897) * [-241.299] (-237.887) (-237.249) (-242.694) -- 0:00:12
776500 -- (-238.610) (-237.528) [-239.445] (-237.322) * (-240.496) (-241.996) [-239.068] (-237.809) -- 0:00:12
777000 -- (-239.028) [-237.942] (-238.838) (-236.566) * (-243.471) (-239.585) (-237.483) [-239.473] -- 0:00:12
777500 -- (-241.245) (-238.143) (-238.084) [-236.855] * [-240.303] (-238.013) (-242.005) (-238.126) -- 0:00:12
778000 -- (-245.426) (-239.693) [-238.301] (-237.547) * (-238.916) [-238.664] (-237.992) (-236.825) -- 0:00:12
778500 -- (-241.907) [-238.008] (-237.762) (-236.725) * (-237.609) (-238.396) (-237.255) [-238.225] -- 0:00:12
779000 -- (-241.313) (-240.025) [-237.155] (-239.181) * (-242.434) (-239.269) (-238.902) [-238.011] -- 0:00:12
779500 -- (-239.157) (-239.077) [-237.382] (-236.865) * (-242.001) [-238.003] (-242.456) (-239.649) -- 0:00:12
780000 -- (-239.833) (-244.280) [-236.089] (-239.765) * (-240.171) [-239.176] (-238.518) (-239.170) -- 0:00:12
Average standard deviation of split frequencies: 0.007926
780500 -- (-236.223) (-240.718) (-236.394) [-237.270] * (-239.242) (-237.279) [-238.820] (-238.580) -- 0:00:12
781000 -- (-238.766) (-243.385) [-238.148] (-238.861) * (-238.373) (-241.606) (-239.238) [-236.491] -- 0:00:12
781500 -- (-240.011) [-240.047] (-237.009) (-240.481) * [-243.381] (-238.474) (-238.582) (-238.264) -- 0:00:12
782000 -- (-237.534) (-238.644) [-237.671] (-238.230) * (-244.202) (-241.669) (-236.615) [-241.159] -- 0:00:12
782500 -- (-237.703) (-240.248) [-240.965] (-238.209) * (-241.167) (-242.459) [-236.607] (-238.975) -- 0:00:12
783000 -- [-236.834] (-241.422) (-239.221) (-240.557) * [-237.100] (-238.143) (-239.292) (-236.969) -- 0:00:12
783500 -- (-237.898) (-239.800) [-236.461] (-238.135) * (-240.089) (-239.672) (-237.911) [-237.271] -- 0:00:12
784000 -- (-237.184) (-236.773) [-237.968] (-238.654) * (-238.516) [-240.863] (-237.599) (-239.686) -- 0:00:12
784500 -- (-237.773) [-236.913] (-238.069) (-239.009) * [-237.621] (-239.130) (-240.127) (-237.099) -- 0:00:12
785000 -- (-238.085) (-236.358) (-240.678) [-238.192] * (-238.498) (-237.485) [-236.980] (-237.683) -- 0:00:12
Average standard deviation of split frequencies: 0.007797
785500 -- [-238.882] (-237.625) (-237.575) (-239.940) * (-238.327) [-236.612] (-238.192) (-237.681) -- 0:00:12
786000 -- (-237.328) [-236.748] (-241.128) (-239.684) * [-236.851] (-241.945) (-236.951) (-238.483) -- 0:00:12
786500 -- [-239.605] (-236.115) (-239.888) (-239.682) * (-236.359) (-238.639) [-238.031] (-237.344) -- 0:00:12
787000 -- (-238.936) [-239.145] (-238.368) (-238.785) * (-239.814) (-239.397) [-237.385] (-236.876) -- 0:00:12
787500 -- (-240.252) [-235.933] (-237.183) (-238.997) * [-236.359] (-237.941) (-241.304) (-237.241) -- 0:00:12
788000 -- (-236.692) (-236.866) (-237.298) [-237.068] * [-237.138] (-239.990) (-243.198) (-238.173) -- 0:00:12
788500 -- (-239.239) (-237.954) (-236.371) [-237.049] * (-239.310) (-238.076) [-237.988] (-238.763) -- 0:00:12
789000 -- [-237.791] (-237.150) (-237.946) (-237.655) * (-237.679) (-238.109) (-237.940) [-238.603] -- 0:00:12
789500 -- [-237.604] (-241.024) (-238.295) (-236.550) * [-237.913] (-239.471) (-238.089) (-239.873) -- 0:00:12
790000 -- (-238.272) (-239.931) (-242.227) [-245.401] * (-243.613) [-237.811] (-238.193) (-239.736) -- 0:00:12
Average standard deviation of split frequencies: 0.007974
790500 -- (-239.428) (-238.162) (-239.729) [-241.302] * (-240.491) (-236.306) (-240.176) [-241.019] -- 0:00:12
791000 -- [-237.097] (-237.135) (-238.059) (-242.992) * (-237.933) [-237.025] (-239.567) (-242.858) -- 0:00:12
791500 -- [-237.841] (-238.286) (-238.864) (-239.662) * (-237.858) (-237.226) [-238.628] (-242.578) -- 0:00:12
792000 -- (-238.019) (-239.499) (-240.034) [-246.361] * (-236.858) [-239.743] (-239.054) (-241.301) -- 0:00:12
792500 -- [-237.353] (-236.557) (-238.616) (-241.249) * (-236.732) (-241.360) [-237.803] (-236.907) -- 0:00:12
793000 -- (-240.372) [-237.941] (-239.415) (-240.500) * (-239.703) (-239.971) (-237.398) [-237.624] -- 0:00:12
793500 -- (-242.152) (-238.219) (-239.041) [-238.599] * (-237.300) (-239.251) (-237.003) [-242.095] -- 0:00:11
794000 -- (-237.845) (-237.507) (-238.623) [-241.261] * (-240.826) (-242.385) [-240.819] (-237.720) -- 0:00:11
794500 -- (-238.168) (-237.663) (-236.458) [-236.054] * (-238.044) (-242.624) (-237.237) [-240.477] -- 0:00:11
795000 -- (-239.994) (-237.798) (-239.835) [-237.646] * [-238.591] (-236.383) (-238.847) (-238.403) -- 0:00:11
Average standard deviation of split frequencies: 0.007810
795500 -- (-238.384) [-236.999] (-236.484) (-236.459) * [-240.640] (-236.729) (-238.330) (-239.714) -- 0:00:11
796000 -- (-237.685) [-238.281] (-238.152) (-244.159) * (-237.215) (-238.948) [-237.740] (-237.008) -- 0:00:11
796500 -- (-242.455) [-236.576] (-238.086) (-242.770) * [-236.303] (-238.990) (-236.833) (-240.357) -- 0:00:11
797000 -- (-237.336) (-237.413) (-241.610) [-244.775] * (-236.660) [-238.370] (-239.304) (-237.548) -- 0:00:11
797500 -- [-238.353] (-242.496) (-240.469) (-237.607) * (-236.584) (-239.945) (-238.009) [-236.649] -- 0:00:11
798000 -- (-239.033) (-237.418) (-237.376) [-241.471] * (-235.895) [-236.730] (-237.422) (-238.636) -- 0:00:11
798500 -- (-241.258) (-236.604) (-239.977) [-241.138] * [-238.089] (-239.768) (-237.518) (-236.092) -- 0:00:11
799000 -- (-237.278) (-237.801) [-236.641] (-238.564) * (-239.355) (-240.680) (-236.557) [-241.596] -- 0:00:11
799500 -- [-237.808] (-238.701) (-241.707) (-239.367) * (-241.250) (-241.277) [-236.542] (-236.627) -- 0:00:11
800000 -- (-244.538) (-237.055) [-238.916] (-236.545) * (-244.972) (-238.162) [-236.405] (-238.098) -- 0:00:11
Average standard deviation of split frequencies: 0.008022
800500 -- (-240.605) (-237.536) (-241.973) [-237.031] * [-239.784] (-238.726) (-240.390) (-239.908) -- 0:00:11
801000 -- (-240.368) (-239.764) (-241.171) [-238.770] * (-236.832) [-237.011] (-241.078) (-237.916) -- 0:00:11
801500 -- (-236.543) [-239.485] (-239.362) (-239.717) * (-239.196) (-236.994) (-242.525) [-238.827] -- 0:00:11
802000 -- (-236.804) (-242.634) (-237.609) [-245.256] * [-238.248] (-241.276) (-238.790) (-239.488) -- 0:00:11
802500 -- (-237.614) (-238.590) (-242.280) [-243.166] * (-244.854) (-237.714) [-237.466] (-240.846) -- 0:00:11
803000 -- (-237.053) (-243.170) (-237.036) [-237.711] * (-240.198) [-236.985] (-238.671) (-239.663) -- 0:00:11
803500 -- (-239.837) [-237.509] (-236.576) (-237.838) * (-236.130) (-237.238) (-239.964) [-240.751] -- 0:00:11
804000 -- (-237.562) [-236.541] (-236.569) (-237.130) * (-240.619) (-237.763) [-237.825] (-244.311) -- 0:00:11
804500 -- (-237.465) (-236.682) (-241.066) [-241.133] * (-239.069) (-237.583) (-239.854) [-238.153] -- 0:00:11
805000 -- (-237.943) [-237.281] (-236.867) (-240.904) * (-237.285) (-236.523) (-238.654) [-239.093] -- 0:00:11
Average standard deviation of split frequencies: 0.008261
805500 -- (-237.186) (-237.739) (-237.026) [-239.269] * [-238.136] (-239.541) (-241.366) (-236.790) -- 0:00:11
806000 -- (-240.367) (-238.287) (-236.869) [-236.919] * (-238.089) [-237.449] (-238.081) (-237.983) -- 0:00:11
806500 -- (-237.210) [-238.447] (-236.878) (-237.025) * (-239.305) [-237.219] (-238.054) (-237.166) -- 0:00:11
807000 -- (-237.007) (-238.729) (-237.530) [-236.244] * (-238.705) (-239.620) [-236.299] (-236.090) -- 0:00:11
807500 -- (-238.306) [-242.910] (-238.263) (-237.225) * (-243.282) (-238.602) [-238.130] (-237.507) -- 0:00:11
808000 -- (-240.681) [-238.518] (-238.035) (-239.972) * [-237.881] (-237.657) (-237.286) (-238.348) -- 0:00:11
808500 -- (-238.933) [-240.413] (-240.059) (-237.841) * (-238.546) [-239.763] (-239.222) (-241.140) -- 0:00:11
809000 -- [-241.415] (-237.175) (-237.023) (-238.838) * (-236.163) (-240.014) (-243.689) [-241.970] -- 0:00:11
809500 -- [-238.781] (-238.464) (-236.410) (-239.144) * (-240.462) [-237.981] (-239.057) (-238.286) -- 0:00:11
810000 -- (-237.251) (-238.848) (-239.936) [-238.178] * (-236.663) (-240.029) [-237.210] (-238.585) -- 0:00:11
Average standard deviation of split frequencies: 0.007959
810500 -- (-236.360) (-241.259) (-238.815) [-237.973] * (-242.010) (-238.071) (-236.728) [-238.223] -- 0:00:10
811000 -- (-237.794) [-239.249] (-238.089) (-237.327) * (-241.096) [-236.774] (-240.514) (-238.050) -- 0:00:10
811500 -- (-239.379) [-237.629] (-239.776) (-239.795) * (-237.327) (-238.939) (-238.842) [-236.305] -- 0:00:10
812000 -- (-237.877) (-240.660) [-238.455] (-237.362) * (-238.242) (-238.455) (-238.185) [-236.412] -- 0:00:10
812500 -- (-237.955) (-237.148) (-239.864) [-236.218] * [-237.249] (-239.349) (-237.061) (-236.121) -- 0:00:10
813000 -- (-239.452) (-236.666) [-240.848] (-236.730) * (-236.137) (-239.871) (-240.537) [-236.223] -- 0:00:10
813500 -- (-238.895) (-236.929) (-239.235) [-237.528] * (-240.236) [-237.612] (-236.198) (-239.485) -- 0:00:10
814000 -- (-240.091) [-239.667] (-238.029) (-239.499) * (-242.453) (-237.948) (-236.025) [-238.891] -- 0:00:10
814500 -- (-239.774) (-250.929) (-238.595) [-237.553] * (-239.825) (-237.052) (-239.494) [-238.666] -- 0:00:10
815000 -- (-239.332) [-239.250] (-237.490) (-241.164) * [-239.101] (-238.180) (-240.568) (-242.713) -- 0:00:10
Average standard deviation of split frequencies: 0.008124
815500 -- (-239.386) (-236.522) [-236.356] (-239.347) * (-239.604) (-240.331) (-240.409) [-239.094] -- 0:00:10
816000 -- (-242.962) [-237.193] (-236.168) (-239.732) * [-236.647] (-236.118) (-239.240) (-237.485) -- 0:00:10
816500 -- (-237.282) (-237.580) (-237.769) [-238.221] * (-238.623) (-238.975) [-236.700] (-237.111) -- 0:00:10
817000 -- (-237.369) [-238.432] (-236.611) (-238.005) * (-237.990) (-238.276) (-238.641) [-237.488] -- 0:00:10
817500 -- (-238.966) (-239.262) [-236.864] (-237.089) * (-240.793) (-243.104) [-239.969] (-241.077) -- 0:00:10
818000 -- (-240.736) (-240.023) (-239.952) [-238.725] * (-238.528) (-237.969) (-239.569) [-240.441] -- 0:00:10
818500 -- (-237.298) (-241.208) [-238.362] (-238.237) * (-237.644) (-240.375) (-238.128) [-237.333] -- 0:00:10
819000 -- (-236.890) [-238.864] (-240.121) (-236.060) * (-245.098) (-237.691) [-237.626] (-236.808) -- 0:00:10
819500 -- [-238.913] (-237.575) (-236.969) (-237.426) * (-239.473) (-239.727) (-237.983) [-237.406] -- 0:00:10
820000 -- (-242.579) (-238.017) (-237.635) [-239.212] * (-238.275) (-240.112) (-237.985) [-239.383] -- 0:00:10
Average standard deviation of split frequencies: 0.007826
820500 -- (-238.358) (-238.300) [-238.358] (-241.074) * (-238.788) (-238.652) [-236.604] (-236.897) -- 0:00:10
821000 -- (-242.013) [-237.949] (-241.681) (-240.140) * (-242.213) (-239.527) [-236.406] (-240.259) -- 0:00:10
821500 -- (-241.787) (-239.844) [-237.321] (-236.946) * [-242.460] (-236.522) (-237.477) (-240.841) -- 0:00:10
822000 -- (-245.130) (-239.046) [-237.411] (-238.905) * (-239.874) [-237.692] (-237.024) (-239.864) -- 0:00:10
822500 -- [-235.979] (-241.570) (-237.222) (-239.136) * (-236.452) (-236.089) (-241.961) [-243.237] -- 0:00:10
823000 -- (-237.005) (-237.945) [-239.733] (-237.789) * (-242.280) (-237.819) (-236.621) [-237.556] -- 0:00:10
823500 -- (-242.722) [-243.250] (-236.737) (-237.753) * (-239.296) [-241.129] (-237.367) (-236.558) -- 0:00:10
824000 -- (-240.950) (-238.308) (-238.914) [-237.876] * [-237.920] (-238.289) (-246.508) (-239.494) -- 0:00:10
824500 -- (-240.617) (-237.861) (-242.238) [-237.385] * (-238.299) (-241.099) [-237.567] (-236.846) -- 0:00:10
825000 -- (-245.544) (-236.537) (-240.679) [-240.077] * [-236.837] (-240.385) (-239.766) (-239.645) -- 0:00:10
Average standard deviation of split frequencies: 0.007776
825500 -- [-236.009] (-237.990) (-241.809) (-240.459) * (-236.935) [-238.911] (-241.639) (-247.846) -- 0:00:10
826000 -- (-236.207) [-240.547] (-243.255) (-238.212) * [-236.930] (-241.599) (-238.901) (-238.483) -- 0:00:10
826500 -- [-239.418] (-237.089) (-244.773) (-237.183) * [-241.115] (-238.289) (-241.639) (-237.869) -- 0:00:10
827000 -- (-239.296) (-245.313) (-243.827) [-237.330] * (-239.140) [-236.595] (-237.793) (-236.366) -- 0:00:10
827500 -- [-239.210] (-237.409) (-240.591) (-239.869) * [-242.562] (-236.366) (-240.458) (-239.668) -- 0:00:10
828000 -- (-237.625) (-238.052) [-239.258] (-239.618) * (-238.232) (-238.057) (-236.474) [-238.761] -- 0:00:09
828500 -- (-236.855) [-239.798] (-237.365) (-242.271) * (-236.331) (-239.212) [-237.380] (-238.120) -- 0:00:09
829000 -- [-237.670] (-238.436) (-240.408) (-240.436) * (-238.613) [-238.575] (-238.087) (-239.585) -- 0:00:09
829500 -- [-237.644] (-239.543) (-237.972) (-239.808) * (-237.066) (-236.433) [-239.914] (-236.673) -- 0:00:09
830000 -- (-239.586) [-236.540] (-236.572) (-238.111) * [-237.494] (-239.827) (-236.623) (-237.504) -- 0:00:09
Average standard deviation of split frequencies: 0.007519
830500 -- [-238.620] (-238.062) (-239.134) (-245.103) * (-237.335) (-241.586) [-240.810] (-241.230) -- 0:00:09
831000 -- (-235.961) (-238.118) [-238.204] (-240.081) * (-237.926) (-236.075) [-236.399] (-237.620) -- 0:00:09
831500 -- [-237.982] (-238.687) (-237.710) (-238.105) * [-237.730] (-242.062) (-237.786) (-237.125) -- 0:00:09
832000 -- (-238.148) (-239.444) [-238.252] (-236.963) * (-242.029) [-236.540] (-238.133) (-238.905) -- 0:00:09
832500 -- (-242.214) (-237.039) (-239.205) [-237.411] * (-238.840) [-240.085] (-237.953) (-237.296) -- 0:00:09
833000 -- (-243.593) (-239.380) [-241.110] (-238.675) * (-236.741) (-236.233) [-237.982] (-240.045) -- 0:00:09
833500 -- (-240.750) [-236.530] (-236.472) (-240.982) * (-238.473) [-237.922] (-238.260) (-238.438) -- 0:00:09
834000 -- (-244.960) (-245.425) (-236.565) [-237.070] * [-239.029] (-239.450) (-239.053) (-237.440) -- 0:00:09
834500 -- [-239.006] (-240.838) (-237.605) (-237.854) * [-238.862] (-238.646) (-237.184) (-237.939) -- 0:00:09
835000 -- [-238.872] (-241.998) (-239.245) (-239.492) * (-240.896) [-238.973] (-239.104) (-237.841) -- 0:00:09
Average standard deviation of split frequencies: 0.007436
835500 -- (-241.137) (-239.346) [-238.175] (-237.228) * (-239.971) [-239.532] (-242.212) (-238.727) -- 0:00:09
836000 -- [-239.645] (-238.121) (-241.327) (-237.840) * [-237.274] (-240.186) (-237.093) (-241.717) -- 0:00:09
836500 -- [-238.231] (-237.193) (-242.621) (-238.689) * (-241.071) [-237.448] (-242.025) (-239.707) -- 0:00:09
837000 -- (-240.615) [-238.101] (-242.773) (-237.320) * [-237.918] (-238.029) (-238.235) (-237.353) -- 0:00:09
837500 -- (-238.535) (-238.973) (-244.724) [-238.619] * (-237.198) (-238.985) (-237.807) [-241.253] -- 0:00:09
838000 -- [-236.096] (-241.697) (-238.182) (-238.309) * (-244.916) (-236.733) (-236.367) [-238.135] -- 0:00:09
838500 -- [-239.310] (-237.396) (-236.590) (-239.213) * (-243.018) [-239.160] (-236.540) (-237.968) -- 0:00:09
839000 -- (-237.380) [-237.733] (-237.627) (-242.038) * [-241.414] (-235.904) (-238.247) (-237.005) -- 0:00:09
839500 -- (-237.306) (-240.758) [-240.771] (-237.786) * (-236.247) (-237.894) (-240.978) [-236.729] -- 0:00:09
840000 -- (-236.188) (-239.403) (-238.732) [-240.667] * (-238.350) [-236.933] (-239.132) (-238.171) -- 0:00:09
Average standard deviation of split frequencies: 0.007220
840500 -- (-238.317) (-240.760) (-239.010) [-238.367] * (-238.463) (-238.732) (-239.396) [-239.838] -- 0:00:09
841000 -- (-239.421) (-236.611) [-237.666] (-241.235) * [-239.272] (-237.830) (-239.565) (-236.160) -- 0:00:09
841500 -- (-240.125) (-239.751) [-239.390] (-237.608) * [-239.004] (-239.808) (-239.180) (-238.047) -- 0:00:09
842000 -- [-237.107] (-239.858) (-238.422) (-238.128) * (-239.828) (-237.233) (-239.276) [-240.472] -- 0:00:09
842500 -- (-240.003) (-239.182) [-240.998] (-242.019) * (-239.364) (-238.536) (-242.608) [-238.442] -- 0:00:09
843000 -- (-240.196) [-237.675] (-239.054) (-237.466) * [-237.977] (-239.882) (-238.457) (-238.554) -- 0:00:09
843500 -- [-236.951] (-237.246) (-239.253) (-237.585) * (-236.389) (-237.800) [-237.839] (-236.649) -- 0:00:09
844000 -- (-238.149) (-237.711) (-237.638) [-240.080] * (-238.052) (-238.709) [-236.424] (-240.249) -- 0:00:09
844500 -- (-240.008) (-236.975) [-240.183] (-239.153) * (-239.736) [-236.912] (-238.545) (-237.923) -- 0:00:09
845000 -- (-236.572) (-238.741) (-242.199) [-238.679] * (-237.787) (-238.563) (-242.846) [-236.777] -- 0:00:08
Average standard deviation of split frequencies: 0.007592
845500 -- (-237.355) (-238.364) (-238.714) [-237.214] * (-241.324) (-238.710) [-241.312] (-240.448) -- 0:00:08
846000 -- (-239.656) [-238.379] (-240.289) (-236.274) * (-238.537) (-237.378) (-242.906) [-238.482] -- 0:00:08
846500 -- (-237.523) [-237.617] (-237.274) (-238.424) * [-237.830] (-237.062) (-240.432) (-238.277) -- 0:00:08
847000 -- (-237.704) (-237.394) [-239.305] (-237.220) * (-236.761) [-238.298] (-236.887) (-240.373) -- 0:00:08
847500 -- [-236.517] (-236.617) (-242.165) (-238.475) * (-238.775) (-241.710) (-239.782) [-241.368] -- 0:00:08
848000 -- (-242.671) (-236.948) (-239.948) [-239.204] * (-237.237) [-237.081] (-237.081) (-237.519) -- 0:00:08
848500 -- [-239.190] (-239.076) (-238.725) (-241.098) * (-238.382) (-238.854) (-239.238) [-239.040] -- 0:00:08
849000 -- (-244.890) (-239.107) (-237.672) [-237.407] * (-238.500) (-241.620) (-238.310) [-243.480] -- 0:00:08
849500 -- [-236.601] (-236.522) (-237.134) (-237.118) * (-236.979) (-240.694) (-239.706) [-238.436] -- 0:00:08
850000 -- (-238.670) (-238.397) (-236.358) [-237.292] * [-237.777] (-241.938) (-240.592) (-239.261) -- 0:00:08
Average standard deviation of split frequencies: 0.007550
850500 -- (-239.685) (-239.401) (-238.783) [-237.638] * [-237.612] (-240.929) (-243.759) (-238.620) -- 0:00:08
851000 -- [-238.496] (-238.914) (-237.452) (-238.736) * [-238.116] (-240.168) (-243.526) (-239.377) -- 0:00:08
851500 -- (-238.686) (-236.694) (-240.207) [-238.008] * (-240.995) [-239.696] (-237.665) (-240.454) -- 0:00:08
852000 -- (-237.999) (-241.642) (-237.883) [-243.044] * (-244.002) [-237.143] (-236.973) (-240.825) -- 0:00:08
852500 -- (-236.917) [-239.258] (-247.118) (-241.130) * (-240.669) [-236.258] (-238.239) (-238.437) -- 0:00:08
853000 -- (-238.183) (-239.765) [-239.307] (-238.417) * [-236.574] (-236.859) (-237.762) (-237.689) -- 0:00:08
853500 -- (-237.348) (-237.932) (-236.880) [-237.653] * [-238.004] (-236.740) (-237.609) (-236.233) -- 0:00:08
854000 -- (-236.519) (-236.785) [-236.372] (-236.700) * (-237.872) [-236.676] (-240.097) (-236.822) -- 0:00:08
854500 -- [-236.828] (-237.559) (-237.745) (-238.715) * (-238.080) [-237.513] (-240.036) (-236.355) -- 0:00:08
855000 -- (-238.115) (-237.079) (-242.333) [-238.274] * (-238.588) [-236.501] (-239.939) (-236.689) -- 0:00:08
Average standard deviation of split frequencies: 0.007503
855500 -- [-237.660] (-240.462) (-237.440) (-237.304) * (-237.327) [-237.378] (-239.307) (-241.019) -- 0:00:08
856000 -- (-239.523) (-240.581) (-237.415) [-237.693] * (-240.708) [-236.722] (-237.808) (-236.528) -- 0:00:08
856500 -- [-240.212] (-238.895) (-247.233) (-240.170) * (-238.786) (-238.051) [-237.227] (-239.733) -- 0:00:08
857000 -- (-241.648) [-237.550] (-237.309) (-239.435) * (-237.229) (-239.484) [-241.658] (-237.608) -- 0:00:08
857500 -- (-240.986) [-238.898] (-239.669) (-237.852) * (-237.044) [-237.501] (-236.679) (-237.505) -- 0:00:08
858000 -- (-239.315) (-238.487) [-237.516] (-239.163) * (-235.964) (-239.463) [-239.412] (-241.140) -- 0:00:08
858500 -- (-238.374) (-239.211) [-236.992] (-241.317) * [-240.111] (-244.983) (-237.123) (-237.337) -- 0:00:08
859000 -- (-236.110) (-239.931) (-237.827) [-238.931] * (-237.039) (-242.939) (-246.886) [-236.618] -- 0:00:08
859500 -- (-236.933) (-238.238) [-240.242] (-238.922) * (-238.801) (-237.112) (-238.293) [-236.223] -- 0:00:08
860000 -- [-237.382] (-241.661) (-239.746) (-237.138) * (-241.200) [-237.237] (-238.193) (-238.177) -- 0:00:08
Average standard deviation of split frequencies: 0.007463
860500 -- (-237.290) (-239.940) [-237.200] (-239.280) * (-238.208) (-238.935) (-239.837) [-237.814] -- 0:00:08
861000 -- (-239.894) (-240.580) [-238.655] (-238.035) * (-238.565) (-239.063) (-242.344) [-236.423] -- 0:00:08
861500 -- [-238.816] (-241.315) (-236.774) (-237.782) * [-237.535] (-241.995) (-241.047) (-238.452) -- 0:00:08
862000 -- (-237.616) [-237.067] (-238.264) (-238.506) * [-236.574] (-237.821) (-237.792) (-238.777) -- 0:00:08
862500 -- [-238.953] (-239.746) (-238.499) (-237.441) * [-237.441] (-238.480) (-238.440) (-237.324) -- 0:00:07
863000 -- [-240.262] (-236.541) (-237.483) (-241.569) * [-237.281] (-239.110) (-237.327) (-238.169) -- 0:00:07
863500 -- (-237.924) (-238.262) [-237.827] (-242.023) * (-240.147) (-238.340) [-237.353] (-238.275) -- 0:00:07
864000 -- (-237.063) (-239.267) [-239.108] (-238.803) * (-237.296) [-236.959] (-241.607) (-241.706) -- 0:00:07
864500 -- (-238.025) [-238.300] (-238.642) (-236.893) * [-238.295] (-237.782) (-238.130) (-236.851) -- 0:00:07
865000 -- (-237.668) (-241.987) (-238.062) [-241.003] * (-240.671) (-238.183) (-237.161) [-238.510] -- 0:00:07
Average standard deviation of split frequencies: 0.007349
865500 -- (-238.986) (-237.325) [-236.580] (-236.680) * (-240.992) (-242.582) [-242.411] (-238.215) -- 0:00:07
866000 -- (-236.908) [-238.145] (-236.511) (-237.645) * (-240.316) (-240.995) [-237.256] (-241.489) -- 0:00:07
866500 -- (-237.067) (-238.624) (-239.648) [-238.685] * [-238.356] (-240.699) (-236.586) (-240.888) -- 0:00:07
867000 -- (-236.850) (-242.519) (-237.948) [-238.415] * (-238.123) [-239.749] (-240.191) (-237.755) -- 0:00:07
867500 -- (-236.560) (-238.250) [-237.067] (-238.685) * (-237.410) (-238.367) (-239.283) [-238.784] -- 0:00:07
868000 -- (-236.944) (-241.000) [-238.168] (-241.052) * (-237.472) (-238.383) (-239.863) [-236.292] -- 0:00:07
868500 -- (-240.993) (-243.232) [-237.522] (-237.437) * (-239.979) (-237.081) (-241.678) [-238.004] -- 0:00:07
869000 -- [-237.993] (-237.205) (-242.504) (-238.553) * (-238.327) (-236.321) (-243.387) [-237.690] -- 0:00:07
869500 -- [-237.696] (-238.359) (-240.812) (-237.204) * (-239.128) [-237.082] (-239.380) (-240.801) -- 0:00:07
870000 -- [-239.220] (-236.906) (-239.638) (-236.511) * (-237.042) (-236.404) (-236.008) [-238.540] -- 0:00:07
Average standard deviation of split frequencies: 0.007445
870500 -- (-238.266) (-239.245) (-237.802) [-238.086] * (-236.220) (-241.481) [-236.785] (-236.986) -- 0:00:07
871000 -- [-239.697] (-238.703) (-237.456) (-237.022) * [-240.834] (-237.562) (-238.285) (-236.864) -- 0:00:07
871500 -- (-237.812) (-241.492) [-237.283] (-237.292) * [-237.156] (-235.948) (-236.843) (-238.011) -- 0:00:07
872000 -- (-238.309) [-237.318] (-237.082) (-237.726) * (-237.116) (-236.969) [-238.738] (-237.460) -- 0:00:07
872500 -- (-237.938) (-239.662) (-240.438) [-240.765] * (-238.339) [-238.412] (-239.363) (-237.076) -- 0:00:07
873000 -- (-236.886) (-238.525) [-237.432] (-239.989) * (-239.420) (-237.883) (-237.598) [-239.290] -- 0:00:07
873500 -- (-236.734) (-238.295) (-239.608) [-239.322] * (-239.826) (-237.410) [-238.057] (-243.873) -- 0:00:07
874000 -- (-236.757) (-238.176) [-238.122] (-240.721) * (-239.865) (-236.822) [-236.791] (-238.437) -- 0:00:07
874500 -- [-237.950] (-237.771) (-239.626) (-237.056) * (-241.346) (-238.796) (-238.360) [-236.185] -- 0:00:07
875000 -- (-239.457) (-238.088) [-237.154] (-237.578) * (-236.628) (-240.533) [-236.956] (-237.085) -- 0:00:07
Average standard deviation of split frequencies: 0.007399
875500 -- (-238.671) (-239.130) (-237.094) [-238.511] * [-238.908] (-238.375) (-240.236) (-239.850) -- 0:00:07
876000 -- (-242.817) (-240.041) (-237.272) [-239.174] * (-239.984) (-236.563) [-237.042] (-238.570) -- 0:00:07
876500 -- (-238.044) (-236.852) [-238.045] (-236.678) * (-240.139) [-239.019] (-239.097) (-242.517) -- 0:00:07
877000 -- (-238.009) [-240.519] (-238.791) (-236.102) * (-237.909) [-236.717] (-241.311) (-240.037) -- 0:00:07
877500 -- (-236.190) (-238.996) (-240.644) [-238.880] * (-237.866) (-236.557) [-237.037] (-239.797) -- 0:00:07
878000 -- (-237.560) [-238.400] (-238.460) (-236.669) * [-238.483] (-237.940) (-238.546) (-237.533) -- 0:00:07
878500 -- (-239.770) [-238.443] (-242.695) (-237.405) * (-237.215) (-238.040) [-237.533] (-240.493) -- 0:00:07
879000 -- (-236.992) (-238.557) (-239.191) [-238.295] * (-237.769) [-236.982] (-237.365) (-238.849) -- 0:00:07
879500 -- (-238.641) (-237.871) (-236.257) [-236.519] * [-237.213] (-237.628) (-239.313) (-242.681) -- 0:00:06
880000 -- (-238.678) [-236.222] (-241.008) (-237.580) * (-240.284) (-236.249) (-240.175) [-238.512] -- 0:00:06
Average standard deviation of split frequencies: 0.007427
880500 -- (-238.571) [-236.655] (-237.216) (-241.463) * (-237.238) (-238.365) (-236.472) [-238.084] -- 0:00:06
881000 -- (-236.673) [-236.177] (-241.705) (-237.736) * (-238.017) (-238.995) [-237.308] (-236.461) -- 0:00:06
881500 -- (-237.577) (-237.042) (-241.663) [-236.237] * (-240.226) (-237.191) (-236.708) [-236.170] -- 0:00:06
882000 -- [-237.010] (-238.232) (-242.179) (-240.197) * (-239.105) [-236.646] (-238.556) (-236.971) -- 0:00:06
882500 -- (-237.091) (-242.424) [-243.560] (-237.316) * (-236.583) [-236.630] (-241.932) (-236.464) -- 0:00:06
883000 -- [-237.294] (-237.572) (-236.953) (-236.947) * (-239.201) (-236.908) (-238.486) [-237.626] -- 0:00:06
883500 -- [-236.663] (-238.165) (-238.088) (-237.726) * [-236.646] (-237.701) (-236.367) (-238.676) -- 0:00:06
884000 -- (-236.772) [-236.153] (-237.579) (-240.261) * (-240.764) [-240.657] (-236.990) (-236.535) -- 0:00:06
884500 -- [-237.570] (-236.768) (-238.629) (-236.982) * (-236.413) (-238.297) (-244.508) [-238.136] -- 0:00:06
885000 -- (-235.939) (-236.833) [-238.997] (-236.964) * (-241.279) (-238.516) (-237.247) [-240.321] -- 0:00:06
Average standard deviation of split frequencies: 0.007881
885500 -- [-238.134] (-237.864) (-236.517) (-237.808) * (-236.878) [-237.546] (-237.888) (-241.419) -- 0:00:06
886000 -- (-236.840) (-239.550) [-236.633] (-239.434) * (-238.187) [-237.355] (-236.753) (-238.487) -- 0:00:06
886500 -- (-238.938) (-240.475) (-236.567) [-236.991] * [-237.267] (-238.245) (-238.461) (-237.955) -- 0:00:06
887000 -- (-238.837) (-245.037) [-237.114] (-236.974) * (-240.350) (-237.220) [-238.439] (-237.424) -- 0:00:06
887500 -- (-240.656) [-238.935] (-241.705) (-237.999) * (-239.401) (-239.184) (-239.250) [-237.167] -- 0:00:06
888000 -- [-241.631] (-236.878) (-238.234) (-235.923) * (-237.108) [-236.705] (-238.379) (-237.280) -- 0:00:06
888500 -- (-238.060) (-237.505) (-237.074) [-237.116] * [-240.854] (-239.601) (-236.345) (-237.815) -- 0:00:06
889000 -- (-238.486) [-238.828] (-236.614) (-238.234) * [-239.695] (-236.991) (-237.841) (-236.569) -- 0:00:06
889500 -- (-241.596) (-239.309) [-237.470] (-242.505) * (-237.060) (-237.738) [-236.422] (-236.857) -- 0:00:06
890000 -- (-237.286) [-237.030] (-238.172) (-238.399) * (-236.795) (-237.460) (-237.045) [-239.230] -- 0:00:06
Average standard deviation of split frequencies: 0.007608
890500 -- (-236.552) [-237.318] (-238.858) (-242.599) * (-236.962) (-237.264) [-240.869] (-237.001) -- 0:00:06
891000 -- (-236.213) (-240.156) (-239.052) [-239.629] * (-237.593) (-237.976) [-243.039] (-237.095) -- 0:00:06
891500 -- (-239.458) (-238.543) (-242.858) [-237.394] * (-244.691) (-237.826) (-238.947) [-242.441] -- 0:00:06
892000 -- (-238.675) [-236.632] (-241.093) (-238.650) * (-237.423) (-237.583) [-240.141] (-241.140) -- 0:00:06
892500 -- (-236.457) (-236.928) (-239.878) [-239.717] * (-239.238) (-240.920) [-239.606] (-237.335) -- 0:00:06
893000 -- (-238.226) [-240.223] (-237.625) (-238.386) * (-237.581) (-238.850) [-237.654] (-236.550) -- 0:00:06
893500 -- [-237.518] (-239.062) (-238.413) (-242.938) * [-239.083] (-238.330) (-240.241) (-236.694) -- 0:00:06
894000 -- [-237.132] (-240.345) (-238.781) (-241.228) * [-239.566] (-239.669) (-239.582) (-236.453) -- 0:00:06
894500 -- (-236.906) (-238.631) (-238.724) [-238.420] * (-241.633) (-241.150) (-236.389) [-239.911] -- 0:00:06
895000 -- [-237.628] (-243.929) (-242.870) (-240.885) * (-238.948) [-238.448] (-237.580) (-236.787) -- 0:00:06
Average standard deviation of split frequencies: 0.007859
895500 -- [-238.563] (-238.761) (-243.816) (-237.707) * [-237.052] (-237.605) (-237.447) (-237.289) -- 0:00:06
896000 -- [-238.846] (-238.279) (-241.282) (-237.557) * (-236.428) [-238.198] (-239.582) (-240.091) -- 0:00:06
896500 -- (-240.007) [-241.716] (-237.709) (-237.251) * (-241.993) [-236.482] (-236.554) (-241.064) -- 0:00:06
897000 -- (-238.412) [-240.209] (-238.119) (-237.714) * (-237.168) (-239.074) (-236.956) [-238.112] -- 0:00:05
897500 -- [-237.955] (-238.833) (-237.943) (-238.682) * (-238.873) (-238.691) (-238.317) [-237.680] -- 0:00:05
898000 -- (-240.326) [-238.789] (-237.912) (-241.972) * (-238.768) [-236.502] (-237.085) (-241.962) -- 0:00:05
898500 -- [-236.227] (-241.844) (-241.200) (-239.482) * (-242.633) (-242.326) (-240.810) [-237.987] -- 0:00:05
899000 -- (-238.135) [-243.434] (-238.814) (-239.130) * (-241.390) (-238.825) (-242.466) [-236.384] -- 0:00:05
899500 -- (-237.556) (-240.088) (-246.180) [-238.084] * (-243.393) (-237.380) [-236.616] (-245.965) -- 0:00:05
900000 -- [-237.040] (-237.404) (-244.350) (-239.330) * [-238.957] (-243.475) (-241.327) (-237.567) -- 0:00:05
Average standard deviation of split frequencies: 0.007884
900500 -- (-237.324) [-238.489] (-239.675) (-239.983) * (-239.448) [-240.066] (-242.190) (-237.027) -- 0:00:05
901000 -- (-236.290) (-238.219) [-238.382] (-240.325) * (-240.245) (-238.212) [-238.854] (-237.441) -- 0:00:05
901500 -- (-239.285) (-240.807) (-236.969) [-237.743] * (-238.737) (-238.509) [-238.541] (-239.897) -- 0:00:05
902000 -- (-239.262) (-236.628) (-237.742) [-240.156] * (-243.876) (-238.154) [-237.971] (-239.449) -- 0:00:05
902500 -- [-235.990] (-236.457) (-236.969) (-241.508) * (-244.587) (-236.443) (-240.723) [-236.096] -- 0:00:05
903000 -- (-237.340) [-241.661] (-238.607) (-239.055) * (-244.242) (-238.651) (-236.470) [-237.990] -- 0:00:05
903500 -- (-237.293) (-238.422) [-239.675] (-237.282) * [-247.827] (-238.225) (-238.242) (-237.431) -- 0:00:05
904000 -- (-236.243) (-237.033) (-241.436) [-237.800] * (-243.778) (-238.900) (-236.688) [-237.636] -- 0:00:05
904500 -- (-236.984) (-242.949) [-237.761] (-238.407) * (-240.601) (-241.177) (-236.691) [-237.808] -- 0:00:05
905000 -- (-240.480) (-237.081) [-237.343] (-237.716) * [-237.288] (-238.744) (-237.836) (-242.179) -- 0:00:05
Average standard deviation of split frequencies: 0.007967
905500 -- (-238.030) (-236.625) (-237.520) [-237.754] * (-237.547) (-243.011) (-245.160) [-237.501] -- 0:00:05
906000 -- (-241.532) (-241.009) [-237.436] (-238.918) * (-239.000) [-238.336] (-236.532) (-240.122) -- 0:00:05
906500 -- (-238.677) (-239.308) (-238.199) [-237.331] * (-238.911) (-240.519) [-237.454] (-240.620) -- 0:00:05
907000 -- (-242.159) [-238.252] (-237.581) (-237.725) * [-237.438] (-237.724) (-237.905) (-238.522) -- 0:00:05
907500 -- (-239.006) (-239.492) [-237.035] (-237.642) * (-237.532) (-239.842) (-238.497) [-244.486] -- 0:00:05
908000 -- [-238.339] (-241.092) (-237.052) (-236.751) * (-238.839) [-239.563] (-236.549) (-239.221) -- 0:00:05
908500 -- (-239.125) (-239.087) [-241.368] (-236.739) * (-242.013) (-236.877) [-237.752] (-239.029) -- 0:00:05
909000 -- (-240.078) (-237.254) [-237.614] (-241.608) * [-236.618] (-240.543) (-237.439) (-239.280) -- 0:00:05
909500 -- (-245.517) [-237.246] (-239.235) (-240.506) * (-237.804) (-241.381) (-236.967) [-236.978] -- 0:00:05
910000 -- (-239.328) (-242.725) (-236.559) [-238.012] * (-238.877) [-238.946] (-237.562) (-237.052) -- 0:00:05
Average standard deviation of split frequencies: 0.007797
910500 -- (-240.866) (-237.195) [-241.736] (-244.904) * (-238.920) (-237.179) (-236.642) [-237.644] -- 0:00:05
911000 -- (-237.278) (-239.490) [-236.609] (-240.721) * [-239.924] (-236.290) (-243.838) (-239.476) -- 0:00:05
911500 -- (-237.243) [-243.388] (-238.889) (-238.038) * (-237.053) (-237.010) (-240.878) [-240.981] -- 0:00:05
912000 -- [-238.280] (-236.958) (-237.658) (-238.448) * [-237.600] (-239.760) (-237.166) (-237.275) -- 0:00:05
912500 -- (-237.581) (-237.179) [-238.301] (-237.421) * (-237.058) [-236.726] (-239.970) (-242.783) -- 0:00:05
913000 -- (-246.360) [-238.077] (-239.471) (-237.053) * (-240.642) (-236.592) (-240.894) [-242.026] -- 0:00:05
913500 -- (-245.463) (-236.889) [-240.004] (-237.430) * (-236.599) (-237.619) [-236.944] (-237.207) -- 0:00:05
914000 -- [-238.775] (-237.698) (-239.055) (-237.752) * [-236.947] (-239.279) (-244.850) (-236.600) -- 0:00:04
914500 -- (-237.391) [-238.077] (-240.929) (-237.048) * (-237.429) (-236.237) [-238.133] (-237.556) -- 0:00:04
915000 -- [-238.136] (-240.683) (-239.904) (-239.315) * [-240.610] (-238.411) (-238.024) (-238.992) -- 0:00:04
Average standard deviation of split frequencies: 0.008073
915500 -- (-243.549) (-239.194) (-238.989) [-236.586] * [-237.461] (-242.815) (-238.823) (-238.160) -- 0:00:04
916000 -- [-238.842] (-237.686) (-238.296) (-237.641) * (-237.373) (-237.937) [-239.011] (-236.036) -- 0:00:04
916500 -- (-238.631) (-238.619) (-239.410) [-237.367] * (-239.051) (-240.842) (-237.023) [-237.975] -- 0:00:04
917000 -- (-239.277) [-236.674] (-238.776) (-239.321) * (-238.387) (-238.069) [-236.885] (-239.229) -- 0:00:04
917500 -- (-238.073) (-241.088) [-236.258] (-239.850) * [-236.658] (-237.511) (-236.942) (-237.411) -- 0:00:04
918000 -- (-237.067) [-243.294] (-237.189) (-237.401) * (-237.467) [-239.027] (-237.840) (-236.981) -- 0:00:04
918500 -- (-238.241) (-241.687) [-238.016] (-238.264) * (-236.868) (-239.347) [-240.189] (-238.151) -- 0:00:04
919000 -- (-236.189) (-240.210) (-236.596) [-240.832] * (-240.968) (-240.205) [-236.676] (-240.553) -- 0:00:04
919500 -- (-238.294) [-235.818] (-240.830) (-238.172) * (-237.905) [-239.843] (-238.405) (-237.509) -- 0:00:04
920000 -- (-237.193) (-240.706) [-237.365] (-237.947) * (-238.832) (-240.922) [-238.410] (-237.033) -- 0:00:04
Average standard deviation of split frequencies: 0.008096
920500 -- (-241.804) (-241.427) [-240.985] (-236.217) * [-241.113] (-239.741) (-240.378) (-236.730) -- 0:00:04
921000 -- [-237.494] (-240.466) (-240.642) (-238.188) * (-242.275) [-238.137] (-239.350) (-237.992) -- 0:00:04
921500 -- (-237.730) [-237.797] (-243.707) (-237.731) * (-238.275) [-236.912] (-237.954) (-240.142) -- 0:00:04
922000 -- (-240.305) (-237.424) (-237.817) [-237.116] * (-239.283) (-242.212) [-238.982] (-238.652) -- 0:00:04
922500 -- [-241.660] (-237.554) (-244.050) (-237.420) * [-239.580] (-238.397) (-238.861) (-239.535) -- 0:00:04
923000 -- [-237.933] (-238.369) (-237.502) (-237.263) * [-238.811] (-239.121) (-240.650) (-237.235) -- 0:00:04
923500 -- [-236.540] (-239.379) (-236.598) (-239.985) * (-240.860) (-240.109) [-239.113] (-240.550) -- 0:00:04
924000 -- (-239.214) (-239.063) [-238.494] (-240.331) * (-239.613) (-236.863) [-239.955] (-241.907) -- 0:00:04
924500 -- (-238.769) [-240.457] (-237.090) (-237.207) * (-238.350) (-238.258) [-238.799] (-236.838) -- 0:00:04
925000 -- (-237.250) (-242.922) (-240.553) [-237.659] * (-240.020) (-239.631) (-236.490) [-242.256] -- 0:00:04
Average standard deviation of split frequencies: 0.008018
925500 -- (-240.862) (-238.658) [-239.353] (-236.177) * (-243.103) (-236.788) (-236.478) [-236.916] -- 0:00:04
926000 -- [-240.629] (-241.155) (-238.304) (-237.889) * [-240.586] (-237.821) (-236.345) (-237.469) -- 0:00:04
926500 -- [-239.641] (-238.250) (-239.109) (-239.845) * (-237.013) [-238.744] (-237.534) (-239.282) -- 0:00:04
927000 -- [-240.818] (-243.736) (-239.089) (-241.702) * (-241.761) (-236.964) (-237.851) [-236.561] -- 0:00:04
927500 -- (-240.845) (-242.312) (-237.787) [-237.363] * (-238.258) (-238.869) [-237.860] (-237.534) -- 0:00:04
928000 -- (-237.292) (-238.474) [-237.140] (-236.839) * (-237.751) (-240.047) (-240.136) [-237.213] -- 0:00:04
928500 -- (-238.596) [-237.527] (-239.589) (-237.238) * [-237.391] (-243.812) (-239.253) (-236.951) -- 0:00:04
929000 -- (-237.429) (-237.397) [-238.826] (-236.667) * (-236.727) [-242.599] (-238.705) (-238.112) -- 0:00:04
929500 -- (-239.735) (-239.595) [-238.394] (-240.910) * [-243.560] (-239.622) (-240.339) (-238.211) -- 0:00:04
930000 -- [-238.766] (-239.275) (-236.957) (-242.932) * [-237.020] (-237.911) (-238.842) (-236.581) -- 0:00:04
Average standard deviation of split frequencies: 0.007946
930500 -- (-240.204) (-239.238) [-236.381] (-242.265) * (-237.290) (-238.689) [-237.167] (-237.839) -- 0:00:04
931000 -- (-237.543) (-236.628) [-236.610] (-237.308) * [-239.643] (-237.561) (-240.910) (-236.294) -- 0:00:04
931500 -- (-236.980) [-238.174] (-236.189) (-240.452) * (-240.838) (-240.172) (-237.013) [-238.653] -- 0:00:03
932000 -- (-237.481) [-237.594] (-241.569) (-236.843) * (-237.805) [-237.397] (-238.588) (-237.098) -- 0:00:03
932500 -- (-236.317) (-240.381) [-237.078] (-236.583) * (-236.747) (-237.153) [-237.646] (-237.769) -- 0:00:03
933000 -- [-238.598] (-238.785) (-240.736) (-238.382) * [-239.718] (-243.639) (-238.917) (-240.296) -- 0:00:03
933500 -- (-236.511) (-237.754) [-238.738] (-236.492) * (-237.809) (-238.869) (-243.867) [-238.105] -- 0:00:03
934000 -- [-237.472] (-236.966) (-238.204) (-237.678) * (-239.738) (-242.701) (-239.569) [-237.442] -- 0:00:03
934500 -- (-236.801) [-241.637] (-237.200) (-241.377) * (-240.294) (-243.202) (-243.448) [-237.237] -- 0:00:03
935000 -- [-237.944] (-239.011) (-239.017) (-241.360) * (-238.186) [-241.270] (-236.326) (-239.338) -- 0:00:03
Average standard deviation of split frequencies: 0.007995
935500 -- (-240.447) [-239.217] (-240.921) (-242.480) * (-238.196) [-241.492] (-238.250) (-237.787) -- 0:00:03
936000 -- (-238.414) (-239.083) (-237.843) [-237.744] * [-238.857] (-241.869) (-242.876) (-239.320) -- 0:00:03
936500 -- (-239.468) (-237.295) [-239.333] (-240.529) * (-239.625) (-240.484) [-237.983] (-238.927) -- 0:00:03
937000 -- (-240.141) (-237.064) [-238.524] (-239.458) * (-237.508) (-238.343) (-237.284) [-239.484] -- 0:00:03
937500 -- (-238.222) (-238.515) [-236.456] (-239.960) * (-238.899) (-240.738) [-239.366] (-239.056) -- 0:00:03
938000 -- (-238.128) (-240.179) (-237.856) [-242.614] * [-240.556] (-236.523) (-240.072) (-236.940) -- 0:00:03
938500 -- (-237.251) [-240.885] (-239.852) (-240.571) * (-240.078) (-238.589) (-236.565) [-237.032] -- 0:00:03
939000 -- [-236.951] (-238.436) (-239.303) (-238.457) * (-242.092) (-238.972) [-239.252] (-238.504) -- 0:00:03
939500 -- [-237.839] (-242.419) (-237.928) (-239.198) * (-241.624) (-241.056) (-237.346) [-237.097] -- 0:00:03
940000 -- [-236.239] (-240.740) (-238.405) (-237.571) * (-237.599) (-236.712) [-242.689] (-238.729) -- 0:00:03
Average standard deviation of split frequencies: 0.007893
940500 -- (-239.550) (-242.899) [-240.764] (-237.907) * (-238.384) (-238.864) [-239.688] (-239.320) -- 0:00:03
941000 -- (-239.668) [-241.133] (-239.967) (-236.468) * (-238.704) [-237.583] (-237.376) (-236.404) -- 0:00:03
941500 -- (-238.445) [-240.560] (-237.545) (-238.137) * (-236.866) (-238.701) (-238.301) [-236.172] -- 0:00:03
942000 -- [-239.726] (-237.629) (-240.283) (-239.312) * (-238.307) (-239.661) (-238.682) [-236.008] -- 0:00:03
942500 -- (-238.407) [-237.168] (-242.394) (-240.421) * (-241.197) (-238.855) [-236.359] (-237.462) -- 0:00:03
943000 -- (-238.919) (-236.588) [-240.782] (-238.174) * (-240.021) (-242.920) [-236.897] (-239.943) -- 0:00:03
943500 -- (-240.192) [-237.917] (-243.012) (-237.139) * (-236.690) [-236.491] (-238.412) (-239.114) -- 0:00:03
944000 -- (-242.036) (-240.257) (-242.739) [-243.280] * (-237.558) (-237.799) [-238.336] (-242.259) -- 0:00:03
944500 -- (-236.704) (-238.094) (-238.616) [-240.822] * (-237.191) (-236.979) (-237.909) [-239.917] -- 0:00:03
945000 -- (-236.419) [-236.802] (-237.385) (-237.455) * [-238.112] (-236.710) (-238.118) (-242.924) -- 0:00:03
Average standard deviation of split frequencies: 0.007848
945500 -- (-236.304) [-237.243] (-238.486) (-237.447) * (-240.199) [-237.798] (-236.877) (-239.642) -- 0:00:03
946000 -- (-239.543) (-238.823) [-238.617] (-240.909) * (-238.743) (-239.809) [-242.282] (-236.442) -- 0:00:03
946500 -- (-238.692) [-238.033] (-237.778) (-236.267) * (-237.774) [-237.730] (-240.072) (-237.305) -- 0:00:03
947000 -- (-238.113) [-238.271] (-236.634) (-236.273) * (-239.213) (-236.413) [-237.336] (-236.533) -- 0:00:03
947500 -- (-239.821) (-244.963) (-238.079) [-239.784] * (-237.520) (-241.151) [-238.930] (-237.505) -- 0:00:03
948000 -- (-242.806) (-237.740) [-237.387] (-240.323) * (-238.842) [-238.309] (-237.282) (-238.885) -- 0:00:03
948500 -- (-240.454) [-241.552] (-236.835) (-239.005) * (-237.889) (-237.050) (-237.183) [-240.444] -- 0:00:02
949000 -- [-237.354] (-241.278) (-237.453) (-238.200) * (-239.668) [-236.634] (-237.375) (-239.213) -- 0:00:02
949500 -- [-238.749] (-244.725) (-241.867) (-237.069) * (-238.648) (-237.344) [-238.768] (-238.690) -- 0:00:02
950000 -- (-236.478) [-239.182] (-243.937) (-236.888) * [-239.682] (-237.243) (-237.493) (-240.716) -- 0:00:02
Average standard deviation of split frequencies: 0.007872
950500 -- (-236.361) [-237.438] (-239.566) (-236.744) * [-237.224] (-238.090) (-237.355) (-240.101) -- 0:00:02
951000 -- (-236.810) (-240.275) (-237.632) [-236.445] * (-238.551) [-239.434] (-236.743) (-238.056) -- 0:00:02
951500 -- (-240.775) (-239.577) (-237.568) [-237.876] * [-237.014] (-238.959) (-238.664) (-243.260) -- 0:00:02
952000 -- (-237.401) (-238.311) (-242.298) [-239.000] * (-238.927) (-237.087) (-243.187) [-239.342] -- 0:00:02
952500 -- (-238.140) (-236.690) [-238.135] (-238.035) * (-237.783) (-241.517) (-239.470) [-239.216] -- 0:00:02
953000 -- [-237.561] (-237.399) (-238.392) (-241.704) * (-239.328) (-240.196) (-239.335) [-238.997] -- 0:00:02
953500 -- (-237.761) (-236.987) [-237.839] (-238.159) * [-240.816] (-239.118) (-238.711) (-240.975) -- 0:00:02
954000 -- (-238.905) (-236.379) (-238.655) [-239.587] * [-240.700] (-236.496) (-237.449) (-239.963) -- 0:00:02
954500 -- (-242.051) [-236.815] (-238.007) (-236.653) * (-240.156) [-239.215] (-236.827) (-237.341) -- 0:00:02
955000 -- (-238.224) (-236.713) [-236.153] (-237.080) * (-237.375) (-237.719) [-240.785] (-237.274) -- 0:00:02
Average standard deviation of split frequencies: 0.007612
955500 -- (-237.624) (-237.672) (-237.318) [-238.124] * (-236.891) (-237.732) (-239.866) [-238.340] -- 0:00:02
956000 -- (-238.754) [-241.281] (-241.774) (-237.580) * [-238.022] (-238.826) (-239.458) (-237.622) -- 0:00:02
956500 -- (-236.396) [-238.746] (-240.188) (-235.979) * (-238.383) (-237.793) [-238.213] (-239.963) -- 0:00:02
957000 -- [-237.041] (-239.490) (-238.038) (-236.766) * (-237.422) [-241.200] (-240.015) (-237.088) -- 0:00:02
957500 -- (-237.258) [-237.614] (-238.725) (-236.448) * (-239.001) (-238.197) (-237.175) [-236.526] -- 0:00:02
958000 -- [-236.453] (-237.205) (-239.503) (-241.293) * (-236.216) (-241.366) (-236.874) [-237.494] -- 0:00:02
958500 -- [-240.299] (-242.211) (-239.363) (-240.235) * (-238.526) [-238.452] (-240.808) (-239.051) -- 0:00:02
959000 -- (-237.177) [-239.244] (-237.600) (-241.394) * (-237.848) (-239.392) (-237.497) [-236.961] -- 0:00:02
959500 -- (-237.814) (-237.220) (-236.650) [-240.250] * (-242.507) (-241.369) (-238.149) [-238.414] -- 0:00:02
960000 -- (-238.252) (-237.666) (-237.681) [-240.793] * (-240.578) (-241.702) (-239.007) [-238.996] -- 0:00:02
Average standard deviation of split frequencies: 0.007391
960500 -- (-240.649) (-239.532) (-239.197) [-238.863] * (-240.824) [-237.937] (-241.527) (-241.395) -- 0:00:02
961000 -- (-237.108) (-240.157) (-236.719) [-240.935] * [-237.770] (-238.957) (-237.046) (-241.784) -- 0:00:02
961500 -- (-235.974) (-240.136) [-236.731] (-238.044) * (-241.608) (-240.003) (-237.068) [-238.700] -- 0:00:02
962000 -- [-236.530] (-240.674) (-244.622) (-240.227) * (-239.328) (-236.458) [-237.038] (-238.764) -- 0:00:02
962500 -- (-241.564) (-239.750) [-237.959] (-241.597) * (-237.740) [-236.914] (-240.030) (-237.143) -- 0:00:02
963000 -- (-239.008) [-239.160] (-239.605) (-238.311) * [-237.794] (-238.708) (-242.813) (-241.866) -- 0:00:02
963500 -- (-239.075) (-238.074) [-239.542] (-236.903) * [-238.558] (-238.078) (-237.448) (-238.030) -- 0:00:02
964000 -- [-237.690] (-240.431) (-237.924) (-237.057) * (-239.797) [-236.643] (-239.234) (-239.847) -- 0:00:02
964500 -- (-237.493) [-238.707] (-238.010) (-240.792) * (-236.945) [-237.108] (-239.647) (-237.044) -- 0:00:02
965000 -- [-239.373] (-237.778) (-237.516) (-238.211) * (-238.636) (-243.437) (-238.120) [-236.276] -- 0:00:02
Average standard deviation of split frequencies: 0.007015
965500 -- (-239.011) (-239.359) [-237.332] (-240.367) * (-240.231) (-239.587) (-237.587) [-237.755] -- 0:00:02
966000 -- (-245.640) (-240.502) (-236.430) [-237.663] * (-241.713) (-236.652) (-238.300) [-239.014] -- 0:00:01
966500 -- (-237.180) (-237.192) (-236.425) [-238.793] * (-238.751) (-236.936) (-238.549) [-238.414] -- 0:00:01
967000 -- (-236.230) (-239.790) [-237.517] (-241.607) * (-236.117) (-238.974) (-239.983) [-237.897] -- 0:00:01
967500 -- [-239.504] (-237.673) (-237.001) (-239.207) * (-240.765) (-238.065) (-237.510) [-238.015] -- 0:00:01
968000 -- (-241.300) (-238.290) (-236.773) [-238.364] * (-237.236) (-239.498) [-238.513] (-236.642) -- 0:00:01
968500 -- [-241.321] (-237.458) (-237.519) (-240.086) * [-240.311] (-241.439) (-237.127) (-236.957) -- 0:00:01
969000 -- (-236.964) [-236.923] (-241.231) (-237.738) * (-240.612) [-236.690] (-236.729) (-238.017) -- 0:00:01
969500 -- [-236.112] (-238.751) (-241.048) (-238.000) * [-238.069] (-236.971) (-239.177) (-238.903) -- 0:00:01
970000 -- [-237.985] (-237.851) (-241.337) (-239.682) * (-236.780) (-238.872) (-245.520) [-238.050] -- 0:00:01
Average standard deviation of split frequencies: 0.006951
970500 -- [-238.992] (-237.810) (-240.488) (-237.231) * (-237.192) [-237.821] (-242.506) (-236.769) -- 0:00:01
971000 -- (-242.695) [-241.409] (-241.584) (-238.381) * [-240.370] (-236.408) (-242.995) (-237.001) -- 0:00:01
971500 -- (-238.502) (-240.239) [-241.433] (-240.846) * (-238.053) [-238.055] (-238.588) (-239.413) -- 0:00:01
972000 -- (-241.660) (-240.771) (-238.298) [-237.862] * (-239.895) [-237.646] (-237.648) (-238.731) -- 0:00:01
972500 -- (-237.352) [-240.014] (-238.881) (-236.212) * (-240.288) (-238.427) (-237.496) [-239.578] -- 0:00:01
973000 -- (-236.609) (-240.652) [-237.767] (-236.095) * [-236.998] (-239.167) (-241.122) (-238.639) -- 0:00:01
973500 -- [-237.631] (-239.017) (-238.586) (-237.944) * [-236.754] (-237.549) (-239.913) (-240.406) -- 0:00:01
974000 -- [-239.732] (-237.460) (-241.085) (-239.386) * (-239.994) [-238.919] (-236.861) (-238.964) -- 0:00:01
974500 -- (-236.938) (-237.081) [-238.453] (-238.399) * [-238.813] (-239.846) (-236.544) (-238.846) -- 0:00:01
975000 -- (-236.861) [-237.041] (-237.646) (-237.261) * (-239.110) (-238.233) (-236.014) [-239.304] -- 0:00:01
Average standard deviation of split frequencies: 0.006762
975500 -- [-240.108] (-236.046) (-238.675) (-236.529) * (-237.322) (-242.557) (-244.372) [-238.046] -- 0:00:01
976000 -- (-238.106) (-236.990) [-238.204] (-236.432) * (-237.861) [-236.896] (-240.620) (-237.056) -- 0:00:01
976500 -- (-241.741) [-237.613] (-235.833) (-242.455) * (-240.056) (-237.005) (-238.879) [-236.742] -- 0:00:01
977000 -- (-241.827) (-237.289) [-236.399] (-237.158) * (-236.715) [-239.202] (-238.365) (-237.599) -- 0:00:01
977500 -- [-241.691] (-236.940) (-236.514) (-237.716) * (-237.853) (-239.221) (-240.921) [-237.134] -- 0:00:01
978000 -- (-238.414) [-237.291] (-239.051) (-236.905) * (-237.646) (-237.729) (-240.986) [-239.893] -- 0:00:01
978500 -- (-238.078) [-238.299] (-238.096) (-239.175) * [-238.378] (-237.206) (-237.512) (-235.973) -- 0:00:01
979000 -- (-240.034) (-240.145) [-239.088] (-236.313) * (-238.065) (-236.817) [-238.179] (-239.761) -- 0:00:01
979500 -- [-237.585] (-238.475) (-237.327) (-238.414) * [-238.100] (-239.925) (-238.141) (-237.030) -- 0:00:01
980000 -- (-236.607) (-237.390) [-238.799] (-238.612) * (-239.890) [-238.810] (-236.446) (-237.892) -- 0:00:01
Average standard deviation of split frequencies: 0.007060
980500 -- (-236.452) (-236.761) [-237.680] (-239.334) * [-237.014] (-241.833) (-237.058) (-237.981) -- 0:00:01
981000 -- (-236.875) (-238.332) [-240.583] (-242.880) * (-241.730) [-237.046] (-237.035) (-236.544) -- 0:00:01
981500 -- (-236.892) (-238.132) (-241.626) [-237.539] * [-243.053] (-236.329) (-237.580) (-238.417) -- 0:00:01
982000 -- (-237.798) (-237.593) [-242.019] (-237.933) * (-238.862) [-238.114] (-238.870) (-240.017) -- 0:00:01
982500 -- [-236.192] (-237.697) (-238.530) (-238.080) * (-240.167) (-238.991) [-239.177] (-238.670) -- 0:00:01
983000 -- (-238.439) [-239.128] (-239.226) (-236.408) * (-237.645) [-237.623] (-237.410) (-236.779) -- 0:00:00
983500 -- (-238.064) [-238.190] (-238.049) (-237.811) * (-237.280) (-236.700) (-237.229) [-237.538] -- 0:00:00
984000 -- [-236.601] (-239.379) (-238.557) (-239.342) * (-238.072) (-236.826) [-237.224] (-239.647) -- 0:00:00
984500 -- (-236.703) (-237.003) [-238.138] (-237.535) * (-238.132) (-238.024) (-238.784) [-238.914] -- 0:00:00
985000 -- [-237.330] (-237.773) (-236.724) (-236.755) * (-240.650) (-239.190) [-241.106] (-238.260) -- 0:00:00
Average standard deviation of split frequencies: 0.007231
985500 -- (-236.584) (-237.673) (-239.164) [-236.361] * (-238.618) (-236.569) [-236.132] (-239.960) -- 0:00:00
986000 -- (-237.969) [-237.569] (-237.467) (-237.143) * [-237.773] (-238.060) (-237.338) (-240.219) -- 0:00:00
986500 -- (-241.125) (-237.621) (-239.485) [-240.202] * [-242.222] (-240.548) (-241.300) (-239.407) -- 0:00:00
987000 -- [-240.031] (-236.837) (-239.317) (-239.473) * (-238.943) [-238.976] (-240.880) (-238.321) -- 0:00:00
987500 -- [-235.970] (-237.883) (-236.312) (-237.007) * (-239.156) (-239.744) (-237.530) [-237.295] -- 0:00:00
988000 -- (-240.028) (-237.059) (-240.195) [-236.911] * (-237.541) (-237.082) (-235.931) [-240.706] -- 0:00:00
988500 -- [-237.989] (-240.207) (-236.550) (-238.589) * (-239.257) (-239.078) [-236.579] (-238.463) -- 0:00:00
989000 -- (-239.166) [-239.399] (-238.208) (-237.258) * (-238.198) [-238.905] (-237.513) (-237.466) -- 0:00:00
989500 -- (-237.700) (-236.223) [-237.019] (-238.214) * (-238.137) (-237.249) (-236.092) [-239.775] -- 0:00:00
990000 -- (-237.824) (-237.183) [-237.680] (-238.081) * (-237.747) [-237.754] (-236.601) (-239.254) -- 0:00:00
Average standard deviation of split frequencies: 0.007167
990500 -- (-238.555) [-237.844] (-240.836) (-238.328) * (-244.340) (-237.976) [-236.516] (-238.677) -- 0:00:00
991000 -- (-238.603) (-236.618) (-240.183) [-239.565] * (-238.412) (-237.927) (-238.436) [-237.372] -- 0:00:00
991500 -- [-239.399] (-238.567) (-239.652) (-236.935) * [-242.010] (-238.331) (-236.848) (-236.653) -- 0:00:00
992000 -- (-236.932) (-238.058) [-238.065] (-239.744) * [-244.647] (-236.569) (-237.781) (-236.470) -- 0:00:00
992500 -- (-237.379) (-237.022) [-238.532] (-242.559) * (-238.278) (-237.937) (-239.681) [-240.061] -- 0:00:00
993000 -- (-237.779) [-236.073] (-239.211) (-236.478) * (-236.099) [-236.864] (-239.774) (-239.348) -- 0:00:00
993500 -- (-240.207) [-237.875] (-238.785) (-238.626) * (-237.659) (-242.555) (-238.344) [-238.798] -- 0:00:00
994000 -- (-237.610) (-240.153) [-240.816] (-238.233) * [-240.254] (-242.033) (-237.461) (-239.092) -- 0:00:00
994500 -- (-237.828) (-242.591) (-238.887) [-238.853] * (-238.668) (-240.715) (-240.386) [-237.703] -- 0:00:00
995000 -- [-239.529] (-237.968) (-237.654) (-238.387) * (-241.364) (-237.370) [-237.762] (-243.919) -- 0:00:00
Average standard deviation of split frequencies: 0.007070
995500 -- (-239.006) (-238.379) [-236.496] (-237.935) * (-238.219) (-241.735) [-237.608] (-239.791) -- 0:00:00
996000 -- (-240.050) (-239.518) (-238.566) [-238.288] * (-237.185) (-239.522) (-236.220) [-243.442] -- 0:00:00
996500 -- (-237.424) (-238.377) [-240.240] (-236.623) * (-236.095) (-239.285) (-238.200) [-240.153] -- 0:00:00
997000 -- (-236.312) (-240.838) [-239.832] (-240.381) * (-242.923) (-237.084) [-238.618] (-238.744) -- 0:00:00
997500 -- (-238.362) (-236.269) [-245.490] (-235.987) * (-237.531) [-237.604] (-242.474) (-240.406) -- 0:00:00
998000 -- (-237.283) [-236.624] (-240.370) (-238.617) * (-242.986) [-239.156] (-235.899) (-238.330) -- 0:00:00
998500 -- (-239.485) (-241.790) [-239.274] (-238.100) * (-238.394) (-242.629) [-236.115] (-239.863) -- 0:00:00
999000 -- (-241.460) [-238.895] (-239.354) (-239.995) * (-237.313) (-241.452) (-237.686) [-237.724] -- 0:00:00
999500 -- (-238.977) (-238.902) [-236.467] (-238.344) * (-239.032) [-240.488] (-240.493) (-237.931) -- 0:00:00
1000000 -- (-240.252) (-237.323) (-238.582) [-241.768] * (-237.100) (-239.102) [-239.707] (-243.284) -- 0:00:00
Average standard deviation of split frequencies: 0.007096
Analysis completed in 58 seconds
Analysis used 56.83 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -235.82
Likelihood of best state for "cold" chain of run 2 was -235.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
49.7 % ( 37 %) Dirichlet(Pi{all})
46.8 % ( 28 %) Slider(Pi{all})
78.3 % ( 51 %) Multiplier(Alpha{1,2})
77.7 % ( 46 %) Multiplier(Alpha{3})
28.5 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 61 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
49.3 % ( 46 %) Dirichlet(Pi{all})
46.8 % ( 32 %) Slider(Pi{all})
78.6 % ( 63 %) Multiplier(Alpha{1,2})
77.5 % ( 46 %) Multiplier(Alpha{3})
28.4 % ( 24 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 166216 0.82 0.67
3 | 166228 167241 0.84
4 | 166907 166999 166409
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166713 0.82 0.67
3 | 166196 166739 0.84
4 | 167545 166552 166255
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -237.61
| 2 2 |
| 2 2 2 1 * |
|2 2 |
| 2 * 22 1 2 1 1 2 2 |
| 2 2 1 * 1 1 2 |
| 2 2 1 1 2 22 |
| 1 2 2 2 2 111 1 1 1 1 |
| 11 12 1* 1* 2 2 2*1 1 112 1 |
| 2 1 2 1 1 1 2 2 1 2 |
|1 * 1 1 2 2 2 2 1 2 * 2 2 1|
| 1 1 21 1 221 12 1 |
| 1 11 1 2 2 |
| 1 2 1 2 2|
| 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -239.22
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -237.64 -241.52
2 -237.58 -242.57
--------------------------------------
TOTAL -237.61 -242.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889365 0.089527 0.371980 1.488276 0.855744 1346.00 1423.50 1.000
r(A<->C){all} 0.163272 0.017487 0.000178 0.424947 0.131666 214.40 230.91 1.000
r(A<->G){all} 0.162742 0.020441 0.000036 0.453449 0.122719 215.30 307.34 1.001
r(A<->T){all} 0.168292 0.019803 0.000008 0.452638 0.133621 227.91 232.39 1.001
r(C<->G){all} 0.169629 0.021630 0.000084 0.463604 0.128774 278.39 285.09 1.000
r(C<->T){all} 0.167002 0.020270 0.000004 0.458367 0.128547 173.87 206.15 1.001
r(G<->T){all} 0.169063 0.019363 0.000095 0.442165 0.133754 236.09 295.66 1.001
pi(A){all} 0.190062 0.000872 0.129423 0.243185 0.189803 1146.16 1186.54 1.000
pi(C){all} 0.331390 0.001274 0.268005 0.408101 0.330160 1005.91 1167.67 1.000
pi(G){all} 0.287011 0.001177 0.219680 0.352182 0.286376 1030.69 1150.20 1.000
pi(T){all} 0.191537 0.000892 0.133663 0.249243 0.190320 1277.78 1326.73 1.001
alpha{1,2} 0.410538 0.222613 0.000127 1.365882 0.250699 1289.13 1310.45 1.000
alpha{3} 0.447001 0.213666 0.000248 1.390457 0.295809 1333.60 1370.59 1.000
pinvar{all} 0.989763 0.000158 0.965762 0.999992 0.993820 1207.53 1245.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ..****
9 -- .*...*
10 -- .*.*..
11 -- .***.*
12 -- ...*.*
13 -- ...**.
14 -- ..**..
15 -- .****.
16 -- .*.***
17 -- ..*.*.
18 -- ..*..*
19 -- ....**
20 -- .*..*.
21 -- .**.**
22 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 447 0.148901 0.020257 0.134577 0.163225 2
8 447 0.148901 0.012719 0.139907 0.157895 2
9 446 0.148568 0.000942 0.147901 0.149234 2
10 443 0.147568 0.008009 0.141905 0.153231 2
11 437 0.145570 0.008951 0.139241 0.151899 2
12 435 0.144903 0.014604 0.134577 0.155230 2
13 435 0.144903 0.004240 0.141905 0.147901 2
14 434 0.144570 0.000942 0.143904 0.145237 2
15 429 0.142905 0.003298 0.140573 0.145237 2
16 420 0.139907 0.010364 0.132578 0.147235 2
17 418 0.139241 0.001884 0.137908 0.140573 2
18 415 0.138241 0.001413 0.137242 0.139241 2
19 414 0.137908 0.001884 0.136576 0.139241 2
20 406 0.135243 0.005653 0.131246 0.139241 2
21 403 0.134244 0.004240 0.131246 0.137242 2
22 284 0.094604 0.014133 0.084610 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096861 0.008990 0.000000 0.290624 0.068512 1.000 2
length{all}[2] 0.098092 0.008999 0.000003 0.281497 0.069889 1.000 2
length{all}[3] 0.101383 0.010297 0.000019 0.302719 0.070897 1.000 2
length{all}[4] 0.097620 0.009631 0.000046 0.298781 0.066661 1.000 2
length{all}[5] 0.098567 0.010431 0.000005 0.299211 0.067067 1.000 2
length{all}[6] 0.099986 0.009659 0.000023 0.297146 0.070906 1.000 2
length{all}[7] 0.097829 0.009671 0.000041 0.301542 0.070286 0.998 2
length{all}[8] 0.096879 0.008636 0.000102 0.282685 0.068685 0.998 2
length{all}[9] 0.094285 0.009486 0.000010 0.290697 0.058770 1.000 2
length{all}[10] 0.103232 0.011455 0.000254 0.331753 0.065788 0.998 2
length{all}[11] 0.092653 0.008248 0.000091 0.240797 0.067730 0.998 2
length{all}[12] 0.104081 0.009696 0.000274 0.309324 0.075113 0.999 2
length{all}[13] 0.096812 0.008202 0.000270 0.279422 0.070990 1.005 2
length{all}[14] 0.093246 0.008601 0.000081 0.273592 0.064918 1.007 2
length{all}[15] 0.101364 0.009892 0.000332 0.307523 0.071839 0.998 2
length{all}[16] 0.090748 0.008468 0.000073 0.262315 0.059021 1.003 2
length{all}[17] 0.100528 0.010053 0.000166 0.283318 0.072233 0.998 2
length{all}[18] 0.099135 0.010382 0.000093 0.324993 0.061570 1.003 2
length{all}[19] 0.100211 0.009318 0.000087 0.317696 0.069322 0.998 2
length{all}[20] 0.104655 0.011256 0.000283 0.300908 0.069376 1.000 2
length{all}[21] 0.098683 0.011291 0.000143 0.295984 0.065797 0.999 2
length{all}[22] 0.094661 0.008822 0.000205 0.256681 0.069267 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007096
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 174
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 34 patterns at 58 / 58 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 34 patterns at 58 / 58 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
33184 bytes for conP
2992 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103609 0.016851 0.101223 0.089421 0.050362 0.072946 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -253.125447
Iterating by ming2
Initial: fx= 253.125447
x= 0.10361 0.01685 0.10122 0.08942 0.05036 0.07295 0.30000 1.30000
1 h-m-p 0.0000 0.0003 138.4687 +++ 247.460678 m 0.0003 14 | 1/8
2 h-m-p 0.0020 0.0200 18.4688 ------------.. | 1/8
3 h-m-p 0.0000 0.0006 126.5341 +++ 237.978854 m 0.0006 47 | 2/8
4 h-m-p 0.0045 0.0287 14.6912 ------------.. | 2/8
5 h-m-p 0.0000 0.0004 113.7002 +++ 232.802858 m 0.0004 80 | 3/8
6 h-m-p 0.0035 0.0503 11.1941 ------------.. | 3/8
7 h-m-p 0.0000 0.0003 98.7626 +++ 229.946660 m 0.0003 113 | 4/8
8 h-m-p 0.0028 0.0928 8.5530 ------------.. | 4/8
9 h-m-p 0.0000 0.0002 80.8197 +++ 228.574102 m 0.0002 146 | 5/8
10 h-m-p 0.0020 0.1966 5.8702 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 57.2600 ++ 228.434843 m 0.0000 178 | 6/8
12 h-m-p 0.2444 8.0000 0.0000 Y 228.434843 0 0.2444 189 | 6/8
13 h-m-p 0.4541 8.0000 0.0000 C 228.434843 0 0.4541 202 | 6/8
14 h-m-p 0.0190 8.0000 0.0000 -N 228.434843 0 0.0012 216
Out..
lnL = -228.434843
217 lfun, 217 eigenQcodon, 1302 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014754 0.093070 0.083914 0.068535 0.051748 0.022552 0.299876 0.641863 0.527058
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.555465
np = 9
lnL0 = -247.250248
Iterating by ming2
Initial: fx= 247.250248
x= 0.01475 0.09307 0.08391 0.06853 0.05175 0.02255 0.29988 0.64186 0.52706
1 h-m-p 0.0000 0.0003 136.0292 +++ 242.356693 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0007 67.8905 ++ 240.152738 m 0.0007 27 | 2/9
3 h-m-p 0.0003 0.0013 58.8376 ++ 234.385605 m 0.0013 39 | 3/9
4 h-m-p 0.0003 0.0014 88.9452 ++ 230.599990 m 0.0014 51 | 4/9
5 h-m-p 0.0000 0.0000 3793.9291 ++ 228.875132 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 804.3334 ++ 228.434836 m 0.0001 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 228.434836 m 8.0000 87 | 6/9
8 h-m-p 0.0324 8.0000 0.0402 ---------Y 228.434836 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0003 +++++ 228.434836 m 8.0000 129 | 6/9
10 h-m-p 0.0057 2.5496 0.3600 ----------Y 228.434836 0 0.0000 154 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434836 m 8.0000 172 | 6/9
12 h-m-p 0.0047 2.3725 0.3245 --------C 228.434836 0 0.0000 195 | 6/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 228.434836 m 8.0000 213 | 6/9
14 h-m-p 0.0055 2.6207 0.2952 ---------C 228.434836 0 0.0000 237 | 6/9
15 h-m-p 0.0160 8.0000 0.0001 ----C 228.434836 0 0.0000 256 | 6/9
16 h-m-p 0.0160 8.0000 0.0002 +++++ 228.434836 m 8.0000 274 | 6/9
17 h-m-p 0.0026 0.9625 0.7350 ---------Y 228.434836 0 0.0000 298 | 6/9
18 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434836 m 8.0000 316 | 6/9
19 h-m-p 0.0005 0.2532 0.7050 +++++ 228.434834 m 0.2532 334 | 7/9
20 h-m-p 0.1337 5.0021 0.7905 ----------C 228.434834 0 0.0000 359 | 7/9
21 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434834 m 8.0000 401 | 7/9
23 h-m-p 0.0044 2.2078 0.3216 --------Y 228.434834 0 0.0000 423 | 7/9
24 h-m-p 0.0160 8.0000 0.0075 +++++ 228.434832 m 8.0000 440 | 7/9
25 h-m-p 0.1691 2.1597 0.3526 -----------C 228.434832 0 0.0000 465 | 7/9
26 h-m-p 0.0160 8.0000 0.0005 +++++ 228.434832 m 8.0000 482 | 7/9
27 h-m-p 0.0126 2.4705 0.3055 ----------Y 228.434832 0 0.0000 506 | 7/9
28 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434832 m 8.0000 523 | 7/9
29 h-m-p 0.0049 2.4709 0.3036 ---------C 228.434832 0 0.0000 546 | 7/9
30 h-m-p 0.0160 8.0000 0.0001 +++++ 228.434832 m 8.0000 563 | 7/9
31 h-m-p 0.0050 2.4795 0.3034 ---------N 228.434832 0 0.0000 586 | 7/9
32 h-m-p 0.0160 8.0000 0.0006 +++++ 228.434832 m 8.0000 603 | 7/9
33 h-m-p 0.0149 2.5118 0.3002 -------------.. | 7/9
34 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434832 m 8.0000 645 | 7/9
35 h-m-p 0.0051 2.5516 0.3040 ----------C 228.434832 0 0.0000 669 | 7/9
36 h-m-p 0.0160 8.0000 0.0061 +++++ 228.434830 m 8.0000 686 | 7/9
37 h-m-p 0.1571 2.5996 0.3130 ------------Y 228.434830 0 0.0000 712 | 7/9
38 h-m-p 0.0160 8.0000 0.0004 +++++ 228.434830 m 8.0000 729 | 7/9
39 h-m-p 0.0104 2.9591 0.2764 ---------C 228.434830 0 0.0000 752 | 7/9
40 h-m-p 0.0160 8.0000 0.0002 ------N 228.434830 0 0.0000 772 | 7/9
41 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434830 m 8.0000 789 | 7/9
42 h-m-p 0.0060 2.9786 0.2704 ------------.. | 7/9
43 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434830 m 8.0000 830 | 7/9
44 h-m-p 0.0061 3.0550 0.2702 --------Y 228.434830 0 0.0000 852 | 7/9
45 h-m-p 0.0160 8.0000 0.0002 -----C 228.434830 0 0.0000 871 | 7/9
46 h-m-p 0.0160 8.0000 0.0001 +++++ 228.434830 m 8.0000 888 | 7/9
47 h-m-p 0.0060 2.9756 0.2710 ------------.. | 7/9
48 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434830 m 8.0000 929 | 7/9
49 h-m-p 0.0059 2.9495 0.2803 ------------.. | 7/9
50 h-m-p 0.0160 8.0000 0.0000 +++++ 228.434830 m 8.0000 970 | 7/9
51 h-m-p 0.0061 3.0575 0.2705 --------C 228.434830 0 0.0000 992 | 7/9
52 h-m-p 0.0160 8.0000 0.0001 +++++ 228.434830 m 8.0000 1009 | 7/9
53 h-m-p 0.0160 8.0000 0.9596 ----------N 228.434830 0 0.0000 1033 | 7/9
54 h-m-p 0.0160 8.0000 0.0030 ------Y 228.434830 0 0.0000 1053 | 7/9
55 h-m-p 0.0160 8.0000 0.0000 ---Y 228.434830 0 0.0001 1070
Out..
lnL = -228.434830
1071 lfun, 3213 eigenQcodon, 12852 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104961 0.105234 0.051442 0.086489 0.015590 0.077217 0.163405 1.088228 0.397758 0.399820 1.476363
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.574134
np = 11
lnL0 = -252.496512
Iterating by ming2
Initial: fx= 252.496512
x= 0.10496 0.10523 0.05144 0.08649 0.01559 0.07722 0.16340 1.08823 0.39776 0.39982 1.47636
1 h-m-p 0.0000 0.0003 128.2494 +++ 247.621532 m 0.0003 17 | 1/11
2 h-m-p 0.0004 0.0023 77.1558 ++ 237.684209 m 0.0023 31 | 2/11
3 h-m-p 0.0001 0.0003 330.6503 ++ 232.207356 m 0.0003 45 | 3/11
4 h-m-p 0.0006 0.0030 38.1126 ++ 230.322456 m 0.0030 59 | 4/11
5 h-m-p 0.0000 0.0000 14794.6350 ++ 229.531212 m 0.0000 73 | 5/11
6 h-m-p 0.0088 0.3604 2.4028 -------------.. | 5/11
7 h-m-p 0.0000 0.0002 79.4633 +++ 228.447529 m 0.0002 113 | 6/11
8 h-m-p 0.0103 0.3605 0.9326 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 57.0326 ++ 228.434838 m 0.0000 157 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +Y 228.434838 0 0.2031 172 | 7/11
11 h-m-p 0.4965 8.0000 0.0000 ------------Y 228.434838 0 0.0000 202
Out..
lnL = -228.434838
203 lfun, 812 eigenQcodon, 3654 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -228.437851 S = -228.434069 -0.001445
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:04
did 20 / 34 patterns 0:05
did 30 / 34 patterns 0:05
did 34 / 34 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022484 0.058414 0.028676 0.027781 0.044241 0.017415 0.137604 0.505022 1.538586
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.152600
np = 9
lnL0 = -239.446404
Iterating by ming2
Initial: fx= 239.446404
x= 0.02248 0.05841 0.02868 0.02778 0.04424 0.01741 0.13760 0.50502 1.53859
1 h-m-p 0.0000 0.0003 132.3880 +++ 233.761059 m 0.0003 15 | 1/9
2 h-m-p 0.0055 0.0422 7.0326 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 123.8424 ++ 232.350807 m 0.0001 49 | 2/9
4 h-m-p 0.0020 0.0568 5.0736 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 111.3661 ++ 231.162797 m 0.0001 83 | 3/9
6 h-m-p 0.0021 0.0653 4.3089 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 96.8831 ++ 231.011927 m 0.0000 117 | 4/9
8 h-m-p 0.0003 0.0714 3.8331 ----------.. | 4/9
9 h-m-p 0.0000 0.0003 78.9489 +++ 229.249799 m 0.0003 150 | 5/9
10 h-m-p 0.0052 0.0884 3.0258 ------------.. | 5/9
11 h-m-p 0.0000 0.0003 56.3389 +++ 228.434832 m 0.0003 185 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 228.434832 m 8.0000 197 | 6/9
13 h-m-p 0.0250 8.0000 0.0003 +++++ 228.434832 m 8.0000 215 | 6/9
14 h-m-p 0.0160 8.0000 0.4856 +++Y 228.434831 0 1.9399 233 | 6/9
15 h-m-p 1.6000 8.0000 0.0969 C 228.434831 0 1.6000 248 | 6/9
16 h-m-p 1.6000 8.0000 0.0049 Y 228.434831 0 1.0153 263 | 6/9
17 h-m-p 1.6000 8.0000 0.0005 +C 228.434831 0 6.4000 279 | 6/9
18 h-m-p 1.6000 8.0000 0.0001 ++ 228.434831 m 8.0000 294 | 6/9
19 h-m-p 0.0160 8.0000 0.2103 +++Y 228.434831 0 2.0993 312 | 6/9
20 h-m-p 1.6000 8.0000 0.0769 ++ 228.434831 m 8.0000 327 | 6/9
21 h-m-p 0.2782 1.3912 1.1861 -----------Y 228.434831 0 0.0000 353 | 6/9
22 h-m-p 0.0084 4.2234 0.6450 +++Y 228.434831 0 1.3129 368 | 6/9
23 h-m-p 1.6000 8.0000 0.0898 C 228.434831 0 0.6082 383 | 6/9
24 h-m-p 1.6000 8.0000 0.0014 Y 228.434831 0 0.8783 398 | 6/9
25 h-m-p 1.6000 8.0000 0.0004 Y 228.434831 0 3.5584 413 | 6/9
26 h-m-p 1.6000 8.0000 0.0001 ++ 228.434831 m 8.0000 428 | 6/9
27 h-m-p 0.0908 8.0000 0.0104 +++Y 228.434831 0 4.8420 446 | 6/9
28 h-m-p 1.6000 8.0000 0.0006 ++ 228.434831 m 8.0000 461 | 6/9
29 h-m-p 0.0000 0.0124 190.5307 ++++Y 228.434830 0 0.0069 480 | 6/9
30 h-m-p 1.6000 8.0000 0.6877 -------------N 228.434830 0 0.0000 505 | 6/9
31 h-m-p 0.0004 0.2049 2.9247 +++++ 228.434822 m 0.2049 523 | 7/9
32 h-m-p 1.6000 8.0000 0.0439 -----------Y 228.434822 0 0.0000 546 | 7/9
33 h-m-p 0.0197 8.0000 0.0000 -C 228.434822 0 0.0012 561
Out..
lnL = -228.434822
562 lfun, 6182 eigenQcodon, 33720 P(t)
Time used: 0:13
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068278 0.010190 0.108009 0.079509 0.052647 0.018661 0.405776 0.900000 1.073298 1.838479 1.299946
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.794855
np = 11
lnL0 = -246.813696
Iterating by ming2
Initial: fx= 246.813696
x= 0.06828 0.01019 0.10801 0.07951 0.05265 0.01866 0.40578 0.90000 1.07330 1.83848 1.29995
1 h-m-p 0.0000 0.0002 128.3240 +++ 243.623627 m 0.0002 17 | 1/11
2 h-m-p 0.0003 0.0015 44.8227 ++ 241.275379 m 0.0015 31 | 2/11
3 h-m-p 0.0004 0.0021 43.4775 ++ 233.798588 m 0.0021 45 | 3/11
4 h-m-p 0.0049 0.0370 17.5410 ++ 231.147869 m 0.0370 59 | 4/11
5 h-m-p 0.0001 0.0004 146.0917 ++ 230.023826 m 0.0004 73 | 5/11
6 h-m-p 0.0012 0.0226 47.8509 ++
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
+ 229.490365 m 0.0226 88
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.178798e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139034e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28447) = 1.139035e-160 2000 rounds
| 6/11
7 h-m-p 0.0024 0.0122 112.8932
QuantileBeta(0.15, 0.00500, 2.36498) = 1.091029e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60649) = 9.683942e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+ 228.963424 m 0.0122 102
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.659611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68700) = 9.333766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
| 7/11
8 h-m-p 0.0172 0.0860 37.2808
QuantileBeta(0.15, 0.00500, 2.49874) = 1.019554e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63993) = 9.535371e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.67523) = 9.383375e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68405) = 9.346124e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68626) = 9.336858e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68681) = 9.334544e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68695) = 9.333965e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68698) = 9.333821e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333785e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.659611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68700) = 9.333766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
| 7/11
9 h-m-p 0.0000 0.0002 57.0075
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+ 228.434846 m 0.0002 142
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.659611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68700) = 9.333766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
| 8/11
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+ 228.434846 m 8.0000 156
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.659611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68713) = 9.333211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68686) = 9.334335e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
| 8/11
11 h-m-p 0.0369 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
C 228.434846 0 0.0006 175
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.659611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68713) = 9.333211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68686) = 9.334335e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
| 8/11
12 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333773e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333774e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
+ 228.434846 m 8.0000 195
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.659615e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68713) = 9.333214e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68686) = 9.334338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
| 8/11
13 h-m-p 0.0006 0.3073 9.7856
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68696) = 9.333916e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68686) = 9.334337e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68646) = 9.336018e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68486) = 9.342751e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
+ 228.434840 m 0.3073 215
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.677773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351315e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
| 9/11
14 h-m-p 0.4753 4.1982 0.1918
QuantileBeta(0.15, 0.00500, 2.68699) = 9.333776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.69952) = 9.281530e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
+ 228.434817 m 4.1982 229
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.519705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71984) = 9.198037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71957) = 9.199135e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71970) = 9.198586e-161 2000 rounds
| 10/11
15 h-m-p 1.0000 8.0000 0.0369
QuantileBeta(0.15, 0.00500, 2.68282) = 9.351322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71048) = 9.236304e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.71740) = 9.207987e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71884) = 9.202109e-161 2000 rounds
C 228.434817 0 0.0156 247
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.522136e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71926) = 9.200385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71899) = 9.201484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
| 10/11
16 h-m-p 0.9998 8.0000 0.0006
QuantileBeta(0.15, 0.00500, 2.71855) = 9.203284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71898) = 9.201522e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.71909) = 9.201081e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200971e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
N 228.434817 0 0.0078 264
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.522155e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71926) = 9.200403e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71899) = 9.201502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
| 10/11
17 h-m-p 0.5000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200948e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200953e-161 2000 rounds
N 228.434817 0 0.0078 281
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.522154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71926) = 9.200403e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71899) = 9.201502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
| 10/11
18 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
N 228.434817 0 1.6000 296
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
Out..
lnL = -228.434817
297 lfun, 3564 eigenQcodon, 19602 P(t)
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -228.447799 S = -228.435018 -0.005611
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:18
did 20 / 34 patterns 0:18
did 30 / 34 patterns 0:18
did 34 / 34 patterns 0:18
QuantileBeta(0.15, 0.00500, 2.71912) = 9.200952e-161 2000 rounds
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=58
NC_011896_1_WP_010907933_1_832_MLBR_RS03895 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
NC_002677_1_NP_301609_1_481_ML0796 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV
**************************************************
NC_011896_1_WP_010907933_1_832_MLBR_RS03895 VAFSTTRA
NC_002677_1_NP_301609_1_481_ML0796 VAFSTTRA
NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065 VAFSTTRA
NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995 VAFSTTRA
NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320 VAFSTTRA
NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390 VAFSTTRA
********
>NC_011896_1_WP_010907933_1_832_MLBR_RS03895 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG GTCGCCTTTTCGACTACAAGAGCC >NC_002677_1_NP_301609_1_481_ML0796 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG GTCGCCTTTTCGACTACAAGAGCC >NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG GTCGCCTTTTCGACTACAAGAGCC >NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG GTCGCCTTTTCGACTACAAGAGCC >NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG GTCGCCTTTTCGACTACAAGAGCC >NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390 ATGACCTACCGCACTGACCAGATCAGCGTCTTAGCCGACGATTACCCGGT TACCCGCCCAGGTGTGGTGCGCACCCTAACGTCTAGCGGACGAGTGGAGG TTTCCGACGGCCGCATGGTGCTGCCCGCCATCCGGGAACTGCAGCCAGTG GTCGCCTTTTCGACTACAAGAGCC
>NC_011896_1_WP_010907933_1_832_MLBR_RS03895 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV VAFSTTRA >NC_002677_1_NP_301609_1_481_ML0796 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV VAFSTTRA >NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV VAFSTTRA >NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV VAFSTTRA >NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV VAFSTTRA >NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390 MTYRTDQISVLADDYPVTRPGVVRTLTSSGRVEVSDGRMVLPAIRELQPV VAFSTTRA
#NEXUS
[ID: 0350163234]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907933_1_832_MLBR_RS03895
NC_002677_1_NP_301609_1_481_ML0796
NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065
NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995
NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320
NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907933_1_832_MLBR_RS03895,
2 NC_002677_1_NP_301609_1_481_ML0796,
3 NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065,
4 NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995,
5 NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320,
6 NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06851244,2:0.06988946,3:0.07089694,4:0.06666101,5:0.06706707,6:0.07090559);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06851244,2:0.06988946,3:0.07089694,4:0.06666101,5:0.06706707,6:0.07090559);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -237.64 -241.52
2 -237.58 -242.57
--------------------------------------
TOTAL -237.61 -242.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889365 0.089527 0.371980 1.488276 0.855744 1346.00 1423.50 1.000
r(A<->C){all} 0.163272 0.017487 0.000178 0.424947 0.131666 214.40 230.91 1.000
r(A<->G){all} 0.162742 0.020441 0.000036 0.453449 0.122719 215.30 307.34 1.001
r(A<->T){all} 0.168292 0.019803 0.000008 0.452638 0.133621 227.91 232.39 1.001
r(C<->G){all} 0.169629 0.021630 0.000084 0.463604 0.128774 278.39 285.09 1.000
r(C<->T){all} 0.167002 0.020270 0.000004 0.458367 0.128547 173.87 206.15 1.001
r(G<->T){all} 0.169063 0.019363 0.000095 0.442165 0.133754 236.09 295.66 1.001
pi(A){all} 0.190062 0.000872 0.129423 0.243185 0.189803 1146.16 1186.54 1.000
pi(C){all} 0.331390 0.001274 0.268005 0.408101 0.330160 1005.91 1167.67 1.000
pi(G){all} 0.287011 0.001177 0.219680 0.352182 0.286376 1030.69 1150.20 1.000
pi(T){all} 0.191537 0.000892 0.133663 0.249243 0.190320 1277.78 1326.73 1.001
alpha{1,2} 0.410538 0.222613 0.000127 1.365882 0.250699 1289.13 1310.45 1.000
alpha{3} 0.447001 0.213666 0.000248 1.390457 0.295809 1333.60 1370.59 1.000
pinvar{all} 0.989763 0.000158 0.965762 0.999992 0.993820 1207.53 1245.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0796/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 58
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 4 4 4 4 4 4
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 3 3 3 3 3 3 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 4 4 4 4 4 4 | GAC 3 3 3 3 3 3 | GGC 1 1 1 1 1 1
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 5 5 5 5 5 5 | GCG 0 0 0 0 0 0 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907933_1_832_MLBR_RS03895
position 1: T:0.12069 C:0.25862 A:0.24138 G:0.37931
position 2: T:0.31034 C:0.31034 A:0.17241 G:0.20690
position 3: T:0.13793 C:0.43103 A:0.15517 G:0.27586
Average T:0.18966 C:0.33333 A:0.18966 G:0.28736
#2: NC_002677_1_NP_301609_1_481_ML0796
position 1: T:0.12069 C:0.25862 A:0.24138 G:0.37931
position 2: T:0.31034 C:0.31034 A:0.17241 G:0.20690
position 3: T:0.13793 C:0.43103 A:0.15517 G:0.27586
Average T:0.18966 C:0.33333 A:0.18966 G:0.28736
#3: NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065
position 1: T:0.12069 C:0.25862 A:0.24138 G:0.37931
position 2: T:0.31034 C:0.31034 A:0.17241 G:0.20690
position 3: T:0.13793 C:0.43103 A:0.15517 G:0.27586
Average T:0.18966 C:0.33333 A:0.18966 G:0.28736
#4: NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995
position 1: T:0.12069 C:0.25862 A:0.24138 G:0.37931
position 2: T:0.31034 C:0.31034 A:0.17241 G:0.20690
position 3: T:0.13793 C:0.43103 A:0.15517 G:0.27586
Average T:0.18966 C:0.33333 A:0.18966 G:0.28736
#5: NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320
position 1: T:0.12069 C:0.25862 A:0.24138 G:0.37931
position 2: T:0.31034 C:0.31034 A:0.17241 G:0.20690
position 3: T:0.13793 C:0.43103 A:0.15517 G:0.27586
Average T:0.18966 C:0.33333 A:0.18966 G:0.28736
#6: NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390
position 1: T:0.12069 C:0.25862 A:0.24138 G:0.37931
position 2: T:0.31034 C:0.31034 A:0.17241 G:0.20690
position 3: T:0.13793 C:0.43103 A:0.15517 G:0.27586
Average T:0.18966 C:0.33333 A:0.18966 G:0.28736
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 0 | TCC 6 | TAC 12 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 6 | CAC 0 | CGC 24
CTA 6 | CCA 12 | Gln Q CAA 0 | CGA 6
CTG 12 | CCG 6 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 12 | ACC 18 | AAC 0 | AGC 12
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 12 | ACG 6 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 6
GTC 12 | GCC 24 | GAC 18 | GGC 6
GTA 0 | GCA 0 | Glu E GAA 6 | GGA 6
GTG 30 | GCG 0 | GAG 6 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12069 C:0.25862 A:0.24138 G:0.37931
position 2: T:0.31034 C:0.31034 A:0.17241 G:0.20690
position 3: T:0.13793 C:0.43103 A:0.15517 G:0.27586
Average T:0.18966 C:0.33333 A:0.18966 G:0.28736
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -228.434843 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299876 1.299946
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907933_1_832_MLBR_RS03895: 0.000004, NC_002677_1_NP_301609_1_481_ML0796: 0.000004, NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065: 0.000004, NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995: 0.000004, NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320: 0.000004, NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29988
omega (dN/dS) = 1.29995
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 129.2 44.8 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 129.2 44.8 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 129.2 44.8 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 129.2 44.8 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 129.2 44.8 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 129.2 44.8 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -228.434830 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.163405 0.807177 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907933_1_832_MLBR_RS03895: 0.000004, NC_002677_1_NP_301609_1_481_ML0796: 0.000004, NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065: 0.000004, NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995: 0.000004, NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320: 0.000004, NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.16340
MLEs of dN/dS (w) for site classes (K=2)
p: 0.80718 0.19282
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 129.3 44.7 0.1928 0.0000 0.0000 0.0 0.0
7..2 0.000 129.3 44.7 0.1928 0.0000 0.0000 0.0 0.0
7..3 0.000 129.3 44.7 0.1928 0.0000 0.0000 0.0 0.0
7..4 0.000 129.3 44.7 0.1928 0.0000 0.0000 0.0 0.0
7..5 0.000 129.3 44.7 0.1928 0.0000 0.0000 0.0 0.0
7..6 0.000 129.3 44.7 0.1928 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -228.434838 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.137604 0.557286 0.260771 0.000001 1.576601
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907933_1_832_MLBR_RS03895: 0.000004, NC_002677_1_NP_301609_1_481_ML0796: 0.000004, NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065: 0.000004, NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995: 0.000004, NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320: 0.000004, NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.13760
MLEs of dN/dS (w) for site classes (K=3)
p: 0.55729 0.26077 0.18194
w: 0.00000 1.00000 1.57660
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 129.3 44.7 0.5476 0.0000 0.0000 0.0 0.0
7..2 0.000 129.3 44.7 0.5476 0.0000 0.0000 0.0 0.0
7..3 0.000 129.3 44.7 0.5476 0.0000 0.0000 0.0 0.0
7..4 0.000 129.3 44.7 0.5476 0.0000 0.0000 0.0 0.0
7..5 0.000 129.3 44.7 0.5476 0.0000 0.0000 0.0 0.0
7..6 0.000 129.3 44.7 0.5476 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907933_1_832_MLBR_RS03895)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907933_1_832_MLBR_RS03895)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -228.434822 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.405776 0.005000 0.448553
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907933_1_832_MLBR_RS03895: 0.000004, NC_002677_1_NP_301609_1_481_ML0796: 0.000004, NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065: 0.000004, NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995: 0.000004, NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320: 0.000004, NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.40578
Parameters in M7 (beta):
p = 0.00500 q = 0.44855
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00018
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 129.1 44.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 129.1 44.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 129.1 44.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 129.1 44.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 129.1 44.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 129.1 44.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:13
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -228.434817 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.719120 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907933_1_832_MLBR_RS03895: 0.000004, NC_002677_1_NP_301609_1_481_ML0796: 0.000004, NZ_LVXE01000001_1_WP_010907933_1_217_A3216_RS01065: 0.000004, NZ_LYPH01000001_1_WP_010907933_1_206_A8144_RS00995: 0.000004, NZ_CP029543_1_WP_010907933_1_850_DIJ64_RS04320: 0.000004, NZ_AP014567_1_WP_010907933_1_864_JK2ML_RS04390: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.71912
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 129.4 44.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 129.4 44.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 129.4 44.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 129.4 44.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 129.4 44.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 129.4 44.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907933_1_832_MLBR_RS03895)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:18
Model 1: NearlyNeutral -228.43483 Model 2: PositiveSelection -228.434838 Model 0: one-ratio -228.434843 Model 7: beta -228.434822 Model 8: beta&w>1 -228.434817 Model 0 vs 1 2.599999999119973E-5 Model 2 vs 1 1.6000000016447302E-5 Model 8 vs 7 9.999999974752427E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
