--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:39:44 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0799/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -552.77 -556.06
2 -552.77 -556.56
--------------------------------------
TOTAL -552.77 -556.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894084 0.084884 0.353254 1.453920 0.864430 1478.85 1489.93 1.000
r(A<->C){all} 0.164411 0.020446 0.000074 0.458020 0.123223 204.09 363.28 1.000
r(A<->G){all} 0.161685 0.018144 0.000261 0.428213 0.126274 203.00 206.42 1.001
r(A<->T){all} 0.182620 0.020549 0.000164 0.465062 0.152375 130.43 196.98 1.000
r(C<->G){all} 0.164374 0.018970 0.000023 0.445916 0.128614 167.39 217.45 1.000
r(C<->T){all} 0.165022 0.019693 0.000052 0.442745 0.128992 156.38 239.21 1.005
r(G<->T){all} 0.161888 0.020073 0.000133 0.453407 0.119725 169.75 196.72 1.006
pi(A){all} 0.188148 0.000351 0.150420 0.223565 0.187962 1164.95 1273.42 1.000
pi(C){all} 0.308716 0.000503 0.267630 0.354628 0.309055 1254.47 1254.90 1.000
pi(G){all} 0.302940 0.000479 0.263196 0.348201 0.302433 1209.07 1270.36 1.000
pi(T){all} 0.200196 0.000389 0.162595 0.240174 0.199496 1247.39 1319.69 1.000
alpha{1,2} 0.426636 0.256601 0.000126 1.494055 0.249399 1175.47 1261.05 1.000
alpha{3} 0.448832 0.235838 0.000402 1.391626 0.281808 1414.90 1451.98 1.000
pinvar{all} 0.995883 0.000027 0.986775 0.999998 0.997493 1338.63 1360.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -545.729288
Model 2: PositiveSelection -545.729201
Model 0: one-ratio -545.729196
Model 7: beta -545.729317
Model 8: beta&w>1 -545.729196
Model 0 vs 1 1.83999999990192E-4
Model 2 vs 1 1.7400000001543958E-4
Model 8 vs 7 2.4200000007112976E-4
>C1
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C2
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C3
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C4
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C5
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C6
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=135
C1 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C2 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C3 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C4 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C5 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C6 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
**************************************************
C1 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C2 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C3 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C4 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C5 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C6 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
**************************************************
C1 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C2 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C3 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C4 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C5 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C6 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
***********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4050]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4050]--->[4050]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.666 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C2 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C3 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C4 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C5 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
C6 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
**************************************************
C1 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C2 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C3 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C4 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C5 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
C6 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
**************************************************
C1 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C2 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C3 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C4 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C5 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
C6 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
***********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
C2 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
C3 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
C4 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
C5 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
C6 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
**************************************************
C1 TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
C2 TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
C3 TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
C4 TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
C5 TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
C6 TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
**************************************************
C1 CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
C2 CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
C3 CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
C4 CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
C5 CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
C6 CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
**************************************************
C1 GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
C2 GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
C3 GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
C4 GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
C5 GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
C6 GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
**************************************************
C1 GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
C2 GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
C3 GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
C4 GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
C5 GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
C6 GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
**************************************************
C1 AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
C2 AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
C3 AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
C4 AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
C5 AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
C6 AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
**************************************************
C1 CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
C2 CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
C3 CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
C4 CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
C5 CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
C6 CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
**************************************************
C1 CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
C2 CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
C3 CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
C4 CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
C5 CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
C6 CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
**************************************************
C1 GCTGG
C2 GCTGG
C3 GCTGG
C4 GCTGG
C5 GCTGG
C6 GCTGG
*****
>C1
TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
GCTGG
>C2
TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
GCTGG
>C3
TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
GCTGG
>C4
TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
GCTGG
>C5
TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
GCTGG
>C6
TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG
TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG
CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC
GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA
GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA
AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG
CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG
CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT
GCTGG
>C1
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C2
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C3
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C4
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C5
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
>C6
LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 405 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579797508
Setting output file names to "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1553207771
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0904094917
Seed = 1021982208
Swapseed = 1579797508
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -906.409416 -- -24.965149
Chain 2 -- -906.409416 -- -24.965149
Chain 3 -- -906.409416 -- -24.965149
Chain 4 -- -906.409416 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -906.409416 -- -24.965149
Chain 2 -- -906.409416 -- -24.965149
Chain 3 -- -906.409364 -- -24.965149
Chain 4 -- -906.409278 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-906.409] (-906.409) (-906.409) (-906.409) * [-906.409] (-906.409) (-906.409) (-906.409)
500 -- (-563.894) [-561.236] (-565.594) (-561.443) * (-559.901) [-559.998] (-556.861) (-560.447) -- 0:00:00
1000 -- [-559.522] (-558.848) (-562.314) (-565.258) * [-562.568] (-561.458) (-559.144) (-563.053) -- 0:16:39
1500 -- [-564.785] (-565.183) (-560.774) (-561.780) * (-576.989) [-564.991] (-559.034) (-560.064) -- 0:11:05
2000 -- (-563.783) (-562.685) (-563.047) [-556.095] * (-560.067) [-563.803] (-565.850) (-564.585) -- 0:08:19
2500 -- [-557.400] (-562.049) (-561.618) (-566.752) * (-560.937) (-571.704) (-558.465) [-567.585] -- 0:06:39
3000 -- [-558.624] (-559.129) (-561.495) (-557.466) * (-569.428) (-566.614) [-567.066] (-568.521) -- 0:05:32
3500 -- (-562.240) (-563.071) (-560.065) [-560.468] * [-561.918] (-564.283) (-566.244) (-557.727) -- 0:04:44
4000 -- (-556.702) (-560.537) (-560.059) [-561.080] * (-562.434) (-565.443) [-560.520] (-571.679) -- 0:04:09
4500 -- [-563.902] (-569.445) (-556.409) (-562.549) * (-564.271) (-569.029) (-557.155) [-561.187] -- 0:03:41
5000 -- (-563.243) [-565.207] (-556.916) (-562.299) * (-561.065) [-560.726] (-565.448) (-559.028) -- 0:03:19
Average standard deviation of split frequencies: 0.107137
5500 -- (-566.229) (-563.597) (-563.510) [-561.637] * (-559.433) (-563.100) [-565.954] (-561.146) -- 0:03:00
6000 -- [-558.224] (-569.455) (-561.340) (-570.957) * [-573.149] (-566.088) (-559.269) (-565.076) -- 0:02:45
6500 -- [-558.419] (-561.121) (-558.556) (-563.871) * (-566.065) (-569.687) (-565.751) [-560.096] -- 0:02:32
7000 -- (-563.260) [-566.668] (-561.424) (-560.652) * [-566.504] (-557.618) (-560.423) (-561.292) -- 0:02:21
7500 -- (-563.125) (-562.444) [-564.019] (-559.814) * (-561.485) [-562.887] (-562.070) (-565.592) -- 0:02:12
8000 -- (-565.433) (-565.408) [-565.668] (-564.497) * [-563.237] (-562.174) (-567.662) (-560.746) -- 0:02:04
8500 -- (-572.381) (-567.734) [-565.346] (-574.599) * (-569.499) (-562.133) [-558.144] (-571.156) -- 0:01:56
9000 -- (-561.506) (-566.380) [-561.370] (-574.827) * [-560.978] (-564.267) (-572.528) (-562.119) -- 0:01:50
9500 -- [-565.679] (-559.305) (-562.884) (-558.131) * (-565.997) (-564.495) (-565.616) [-558.124] -- 0:01:44
10000 -- (-569.735) (-565.032) (-567.950) [-553.125] * (-567.393) [-560.015] (-564.784) (-564.652) -- 0:01:39
Average standard deviation of split frequencies: 0.079550
10500 -- (-567.421) (-565.454) [-566.013] (-557.715) * (-566.625) (-558.804) (-566.973) [-567.947] -- 0:01:34
11000 -- (-567.416) (-569.027) (-576.152) [-554.868] * [-568.249] (-559.339) (-565.310) (-575.920) -- 0:01:29
11500 -- (-567.702) (-576.130) [-558.151] (-555.375) * (-576.076) [-571.196] (-561.955) (-565.553) -- 0:01:25
12000 -- (-561.871) [-554.447] (-554.224) (-552.263) * (-577.598) (-560.223) (-563.163) [-565.899] -- 0:01:22
12500 -- [-559.046] (-553.163) (-556.480) (-552.835) * (-571.146) [-559.123] (-564.835) (-557.224) -- 0:01:19
13000 -- (-564.376) (-554.885) (-553.918) [-552.451] * (-558.802) (-569.393) (-563.313) [-560.306] -- 0:01:15
13500 -- (-563.052) [-554.607] (-553.390) (-552.709) * (-552.386) [-560.190] (-567.436) (-560.310) -- 0:01:13
14000 -- (-565.469) (-555.657) [-555.705] (-553.196) * (-552.822) (-563.646) [-557.368] (-568.157) -- 0:01:10
14500 -- [-558.366] (-557.806) (-552.261) (-554.812) * (-553.720) [-560.336] (-566.184) (-559.569) -- 0:01:07
15000 -- (-574.141) [-553.760] (-552.572) (-553.744) * (-552.932) (-568.652) (-560.281) [-567.016] -- 0:01:05
Average standard deviation of split frequencies: 0.068230
15500 -- [-563.519] (-555.242) (-555.281) (-552.628) * (-555.214) [-558.524] (-573.273) (-560.085) -- 0:01:03
16000 -- (-568.120) (-555.635) (-554.939) [-552.540] * [-559.464] (-568.268) (-562.164) (-567.552) -- 0:01:01
16500 -- (-561.461) [-558.099] (-554.167) (-554.105) * (-555.364) (-567.177) [-564.571] (-566.958) -- 0:01:59
17000 -- (-564.194) (-552.753) [-552.851] (-557.335) * (-552.274) (-560.415) (-561.747) [-561.686] -- 0:01:55
17500 -- [-568.008] (-552.245) (-556.291) (-553.974) * (-552.877) (-563.878) [-566.486] (-564.252) -- 0:01:52
18000 -- (-563.218) [-555.088] (-552.126) (-554.650) * (-551.517) (-565.172) [-557.640] (-559.888) -- 0:01:49
18500 -- (-567.054) [-555.086] (-552.267) (-557.829) * (-553.130) [-565.316] (-563.040) (-564.629) -- 0:01:46
19000 -- (-565.589) (-554.387) [-552.672] (-554.804) * (-556.939) (-568.399) (-562.222) [-561.607] -- 0:01:43
19500 -- (-566.250) [-552.684] (-553.519) (-555.951) * (-552.402) (-566.929) (-563.242) [-559.102] -- 0:01:40
20000 -- (-566.160) [-553.043] (-551.701) (-553.959) * (-553.423) (-564.119) (-574.382) [-563.739] -- 0:01:38
Average standard deviation of split frequencies: 0.059037
20500 -- [-566.196] (-553.469) (-551.969) (-554.264) * (-553.403) (-557.232) [-555.693] (-560.786) -- 0:01:35
21000 -- (-556.059) (-552.992) (-551.779) [-552.664] * (-551.562) [-568.561] (-556.118) (-565.855) -- 0:01:33
21500 -- (-551.913) (-553.212) (-552.212) [-552.617] * (-551.688) (-570.726) [-555.516] (-559.291) -- 0:01:31
22000 -- (-552.254) [-553.214] (-551.820) (-555.188) * (-552.562) [-568.053] (-553.600) (-565.111) -- 0:01:28
22500 -- [-551.856] (-554.210) (-551.700) (-552.985) * (-554.604) (-567.178) [-554.073] (-562.585) -- 0:01:26
23000 -- [-552.230] (-553.687) (-556.106) (-554.901) * (-559.281) (-564.452) (-555.069) [-560.899] -- 0:01:24
23500 -- [-553.517] (-559.045) (-555.168) (-557.299) * (-554.071) (-561.452) (-553.541) [-560.858] -- 0:01:23
24000 -- (-552.283) (-554.806) (-554.877) [-554.703] * (-553.634) (-566.476) [-555.257] (-563.757) -- 0:01:21
24500 -- (-552.759) (-553.875) (-557.153) [-551.561] * (-553.854) (-565.130) (-553.506) [-563.900] -- 0:01:19
25000 -- (-551.793) [-554.580] (-553.047) (-553.466) * (-553.821) [-558.184] (-553.495) (-564.965) -- 0:01:18
Average standard deviation of split frequencies: 0.048349
25500 -- (-554.000) (-554.037) [-553.263] (-553.760) * [-551.700] (-564.434) (-553.520) (-560.121) -- 0:01:16
26000 -- (-553.910) (-557.990) [-554.365] (-553.610) * [-555.228] (-561.092) (-560.525) (-559.592) -- 0:01:14
26500 -- [-552.342] (-552.075) (-555.985) (-555.270) * (-562.050) (-562.122) (-553.231) [-560.172] -- 0:01:13
27000 -- [-552.213] (-553.011) (-556.228) (-555.145) * [-551.962] (-560.959) (-554.028) (-565.019) -- 0:01:12
27500 -- (-555.277) (-554.190) [-552.279] (-554.727) * [-552.234] (-557.963) (-552.602) (-565.246) -- 0:01:10
28000 -- (-557.804) (-552.937) (-553.617) [-554.217] * (-553.108) (-557.761) [-552.898] (-559.979) -- 0:01:09
28500 -- [-556.828] (-555.907) (-553.518) (-555.395) * (-553.781) [-551.455] (-555.607) (-562.885) -- 0:01:08
29000 -- (-554.045) (-553.396) (-554.296) [-551.515] * (-553.294) [-556.547] (-553.258) (-564.822) -- 0:01:06
29500 -- (-553.559) (-553.541) (-553.624) [-553.984] * (-551.497) (-558.692) [-552.645] (-557.029) -- 0:01:05
30000 -- [-554.814] (-555.650) (-555.145) (-553.435) * [-552.561] (-557.279) (-553.106) (-567.604) -- 0:01:04
Average standard deviation of split frequencies: 0.037576
30500 -- (-559.776) (-555.363) [-553.704] (-553.413) * [-553.729] (-552.942) (-553.103) (-566.409) -- 0:01:03
31000 -- (-552.471) [-552.887] (-557.997) (-554.657) * (-553.472) (-555.974) (-555.793) [-562.224] -- 0:01:02
31500 -- (-552.712) [-552.513] (-552.661) (-555.114) * (-555.582) [-552.600] (-552.505) (-560.929) -- 0:01:01
32000 -- [-553.794] (-553.031) (-555.047) (-553.138) * (-552.795) [-552.923] (-555.095) (-571.579) -- 0:01:00
32500 -- (-553.943) [-553.933] (-556.460) (-555.145) * (-553.713) [-555.773] (-551.939) (-568.225) -- 0:00:59
33000 -- [-551.656] (-552.461) (-554.060) (-557.263) * [-553.253] (-555.081) (-552.991) (-567.262) -- 0:00:58
33500 -- (-555.067) (-553.970) (-555.048) [-560.587] * (-560.247) (-553.848) [-553.779] (-564.269) -- 0:01:26
34000 -- (-554.981) (-552.681) [-554.913] (-555.116) * [-551.794] (-554.834) (-557.530) (-559.151) -- 0:01:25
34500 -- [-553.386] (-557.781) (-553.256) (-556.606) * (-553.943) (-556.096) [-551.741] (-562.115) -- 0:01:23
35000 -- (-553.661) [-555.910] (-554.469) (-557.223) * (-553.755) (-553.489) [-553.764] (-557.886) -- 0:01:22
Average standard deviation of split frequencies: 0.023432
35500 -- [-553.204] (-557.249) (-553.698) (-552.888) * [-554.362] (-555.943) (-553.730) (-572.886) -- 0:01:21
36000 -- [-557.315] (-555.134) (-553.384) (-553.132) * (-553.770) (-557.106) (-553.533) [-559.426] -- 0:01:20
36500 -- (-562.681) [-553.992] (-552.771) (-552.333) * [-552.225] (-552.778) (-553.452) (-553.495) -- 0:01:19
37000 -- (-554.176) (-552.793) (-553.852) [-554.641] * (-552.524) [-554.849] (-555.385) (-553.994) -- 0:01:18
37500 -- (-554.171) [-557.895] (-552.035) (-554.053) * (-552.458) (-553.916) (-555.258) [-553.723] -- 0:01:17
38000 -- (-558.027) (-555.166) [-554.149] (-553.566) * (-556.349) (-555.572) (-552.340) [-553.831] -- 0:01:15
38500 -- [-552.474] (-556.731) (-554.318) (-554.696) * (-552.050) (-553.875) (-552.336) [-552.515] -- 0:01:14
39000 -- (-555.179) (-553.846) (-552.814) [-551.339] * (-553.051) [-553.278] (-552.162) (-551.784) -- 0:01:13
39500 -- (-553.004) (-552.424) [-553.753] (-554.958) * [-551.698] (-553.199) (-552.300) (-553.413) -- 0:01:12
40000 -- (-554.714) [-552.813] (-552.906) (-553.246) * (-552.718) [-554.858] (-553.786) (-553.640) -- 0:01:12
Average standard deviation of split frequencies: 0.030505
40500 -- (-555.712) (-552.981) [-552.623] (-553.043) * (-555.063) (-554.805) (-552.485) [-552.099] -- 0:01:11
41000 -- (-555.058) (-552.187) (-556.799) [-553.242] * (-552.437) [-555.196] (-554.226) (-552.099) -- 0:01:10
41500 -- (-552.790) (-555.623) [-554.615] (-552.412) * (-557.006) (-554.881) (-552.702) [-552.670] -- 0:01:09
42000 -- (-556.889) [-553.827] (-558.128) (-553.897) * (-554.549) [-553.921] (-552.684) (-552.450) -- 0:01:08
42500 -- (-556.160) [-552.240] (-553.587) (-554.321) * (-555.235) (-553.341) [-554.771] (-551.804) -- 0:01:07
43000 -- [-552.936] (-553.502) (-553.588) (-556.908) * (-557.404) [-552.160] (-553.299) (-551.859) -- 0:01:06
43500 -- (-555.787) [-553.707] (-556.986) (-553.444) * (-555.806) (-552.882) (-556.904) [-551.741] -- 0:01:05
44000 -- (-555.722) [-551.559] (-553.034) (-555.287) * [-551.787] (-551.629) (-562.471) (-552.384) -- 0:01:05
44500 -- (-551.647) (-552.501) (-555.573) [-552.617] * (-551.744) (-553.959) [-554.249] (-554.090) -- 0:01:04
45000 -- [-552.135] (-554.289) (-558.163) (-560.520) * (-554.893) [-553.275] (-557.620) (-555.425) -- 0:01:03
Average standard deviation of split frequencies: 0.021521
45500 -- [-557.623] (-554.245) (-560.202) (-555.187) * (-554.835) (-555.547) [-553.341] (-555.662) -- 0:01:02
46000 -- (-554.405) [-555.656] (-555.072) (-553.240) * [-551.760] (-556.217) (-555.132) (-551.954) -- 0:01:02
46500 -- (-555.922) (-551.634) [-553.728] (-552.476) * (-552.991) (-552.758) [-553.232] (-552.965) -- 0:01:01
47000 -- (-552.096) [-553.501] (-555.590) (-552.237) * (-553.083) (-552.509) (-553.065) [-555.137] -- 0:01:00
47500 -- [-553.240] (-553.382) (-554.910) (-556.768) * (-552.805) [-554.401] (-552.013) (-554.164) -- 0:01:00
48000 -- (-553.735) (-554.701) [-552.863] (-556.024) * [-552.158] (-552.087) (-552.260) (-554.159) -- 0:00:59
48500 -- [-554.378] (-553.031) (-554.279) (-554.199) * [-555.077] (-554.208) (-554.563) (-559.811) -- 0:00:58
49000 -- [-554.706] (-553.484) (-558.183) (-552.088) * (-556.990) (-555.994) (-555.849) [-553.289] -- 0:00:58
49500 -- [-555.552] (-552.539) (-551.709) (-551.736) * (-556.185) (-555.748) [-554.634] (-553.011) -- 0:00:57
50000 -- [-556.921] (-553.461) (-553.184) (-555.016) * [-554.119] (-552.738) (-553.666) (-552.023) -- 0:01:16
Average standard deviation of split frequencies: 0.024484
50500 -- (-555.095) [-554.296] (-552.487) (-554.003) * (-553.859) (-552.394) [-552.127] (-552.097) -- 0:01:15
51000 -- (-556.734) [-552.849] (-554.512) (-552.493) * [-551.192] (-552.392) (-554.334) (-553.694) -- 0:01:14
51500 -- (-553.575) [-552.565] (-554.316) (-554.946) * [-553.118] (-552.192) (-555.099) (-551.471) -- 0:01:13
52000 -- (-557.682) [-553.687] (-553.452) (-555.797) * (-556.447) (-552.040) [-553.372] (-553.644) -- 0:01:12
52500 -- [-555.869] (-552.129) (-552.700) (-554.363) * (-552.389) (-552.767) (-554.016) [-552.004] -- 0:01:12
53000 -- [-553.623] (-552.226) (-551.545) (-553.559) * (-552.538) [-551.806] (-551.617) (-551.702) -- 0:01:11
53500 -- (-552.790) [-552.847] (-555.174) (-553.958) * (-552.613) (-551.162) (-554.677) [-553.515] -- 0:01:10
54000 -- [-552.420] (-553.458) (-555.554) (-553.059) * (-554.237) (-553.216) (-554.156) [-552.979] -- 0:01:10
54500 -- [-552.778] (-554.131) (-556.622) (-558.243) * (-552.090) (-553.321) (-553.803) [-556.260] -- 0:01:09
55000 -- (-552.781) (-552.963) [-552.377] (-554.697) * [-552.576] (-554.064) (-551.636) (-552.491) -- 0:01:08
Average standard deviation of split frequencies: 0.026244
55500 -- (-551.935) [-555.708] (-556.831) (-556.691) * (-553.205) (-561.777) (-553.909) [-551.753] -- 0:01:08
56000 -- (-552.662) (-552.110) (-555.940) [-552.415] * (-553.162) (-553.512) (-558.338) [-551.952] -- 0:01:07
56500 -- (-552.473) (-559.172) [-554.109] (-552.740) * (-555.124) (-552.119) (-558.655) [-552.408] -- 0:01:06
57000 -- [-554.684] (-556.659) (-553.535) (-555.901) * [-554.706] (-554.399) (-553.881) (-553.075) -- 0:01:06
57500 -- (-554.083) [-554.471] (-554.890) (-553.274) * (-555.439) (-552.840) (-551.209) [-551.352] -- 0:01:05
58000 -- [-553.324] (-556.317) (-552.103) (-553.004) * (-553.948) (-551.731) (-551.673) [-557.898] -- 0:01:04
58500 -- (-552.950) (-554.747) [-552.020] (-552.489) * (-557.885) [-552.095] (-551.654) (-554.442) -- 0:01:04
59000 -- [-554.375] (-554.526) (-554.947) (-551.433) * (-554.944) [-552.874] (-551.721) (-556.974) -- 0:01:03
59500 -- (-555.886) [-552.179] (-554.624) (-551.528) * (-554.848) (-554.286) [-551.219] (-552.362) -- 0:01:03
60000 -- [-552.547] (-555.473) (-555.141) (-551.493) * [-553.180] (-553.329) (-552.880) (-553.076) -- 0:01:02
Average standard deviation of split frequencies: 0.031491
60500 -- (-552.384) (-552.534) (-553.587) [-551.790] * (-558.064) (-552.135) (-553.611) [-555.842] -- 0:01:02
61000 -- (-553.994) (-556.541) [-555.263] (-554.034) * (-553.499) [-554.071] (-553.889) (-553.920) -- 0:01:01
61500 -- (-553.636) [-552.327] (-554.082) (-554.178) * (-555.440) [-556.321] (-555.762) (-553.535) -- 0:01:01
62000 -- (-553.248) (-552.019) (-556.171) [-553.135] * (-556.745) [-555.239] (-553.886) (-552.545) -- 0:01:00
62500 -- [-553.111] (-552.488) (-553.746) (-554.445) * (-556.665) [-552.803] (-552.549) (-553.990) -- 0:01:00
63000 -- (-552.963) (-553.229) (-558.894) [-554.227] * [-554.397] (-554.140) (-554.024) (-553.958) -- 0:00:59
63500 -- (-552.317) (-552.767) (-552.590) [-554.775] * (-553.527) [-557.820] (-553.122) (-553.874) -- 0:00:58
64000 -- [-552.872] (-554.383) (-551.265) (-552.203) * (-553.148) [-559.259] (-552.934) (-556.718) -- 0:00:58
64500 -- (-552.467) (-552.801) [-553.486] (-551.404) * (-552.103) [-556.677] (-552.681) (-553.060) -- 0:00:58
65000 -- [-551.966] (-553.113) (-553.420) (-552.681) * (-555.428) (-560.035) (-555.380) [-557.073] -- 0:00:57
Average standard deviation of split frequencies: 0.027499
65500 -- (-551.978) (-554.185) (-552.908) [-554.125] * [-554.778] (-555.339) (-553.477) (-552.579) -- 0:00:57
66000 -- (-552.148) (-553.969) [-554.826] (-554.067) * (-552.143) [-554.918] (-554.338) (-553.676) -- 0:00:56
66500 -- [-551.364] (-552.502) (-552.808) (-553.326) * (-552.613) (-553.572) [-553.391] (-555.652) -- 0:01:10
67000 -- (-552.428) (-554.650) [-553.491] (-553.596) * (-553.187) (-553.144) [-552.472] (-554.448) -- 0:01:09
67500 -- (-555.450) [-554.603] (-557.216) (-552.860) * (-558.203) [-552.866] (-552.866) (-553.627) -- 0:01:09
68000 -- (-553.495) (-556.409) [-556.303] (-553.380) * (-551.312) [-552.425] (-558.059) (-557.060) -- 0:01:08
68500 -- (-554.479) (-555.491) (-553.931) [-552.980] * (-553.707) [-551.788] (-551.981) (-556.962) -- 0:01:07
69000 -- [-554.951] (-555.626) (-554.608) (-555.920) * (-551.867) (-552.807) (-554.096) [-556.103] -- 0:01:07
69500 -- [-552.267] (-553.092) (-551.533) (-554.572) * (-553.500) [-562.773] (-552.966) (-553.138) -- 0:01:06
70000 -- [-553.811] (-553.677) (-552.818) (-553.212) * (-554.518) (-557.959) (-551.960) [-552.725] -- 0:01:06
Average standard deviation of split frequencies: 0.030194
70500 -- (-552.618) (-554.659) (-551.708) [-552.517] * [-554.389] (-553.964) (-552.520) (-554.517) -- 0:01:05
71000 -- [-552.553] (-556.744) (-552.244) (-553.403) * (-557.646) (-553.668) [-554.431] (-552.720) -- 0:01:05
71500 -- (-552.204) [-553.440] (-554.644) (-555.481) * (-556.295) [-552.615] (-553.741) (-552.843) -- 0:01:04
72000 -- (-552.315) (-552.915) [-552.905] (-556.642) * (-559.253) [-552.382] (-553.052) (-555.200) -- 0:01:04
72500 -- [-553.618] (-552.750) (-552.697) (-551.690) * (-556.240) (-554.272) (-554.599) [-552.857] -- 0:01:03
73000 -- (-557.464) (-554.027) (-557.713) [-551.478] * [-554.768] (-552.766) (-555.298) (-553.573) -- 0:01:03
73500 -- (-555.665) (-555.469) (-557.705) [-553.443] * (-553.215) (-553.383) [-551.299] (-555.088) -- 0:01:03
74000 -- (-554.304) [-555.880] (-557.187) (-553.823) * (-555.134) (-559.082) (-551.395) [-555.702] -- 0:01:02
74500 -- (-554.788) (-556.173) (-556.328) [-552.011] * (-552.790) [-556.258] (-553.123) (-557.028) -- 0:01:02
75000 -- (-555.092) (-558.399) [-553.565] (-552.711) * (-551.806) (-553.942) [-553.876] (-555.147) -- 0:01:01
Average standard deviation of split frequencies: 0.034115
75500 -- [-556.524] (-554.015) (-553.048) (-554.631) * (-555.783) (-552.783) (-556.515) [-551.538] -- 0:01:01
76000 -- (-553.381) (-552.207) [-553.646] (-554.296) * (-551.737) (-552.396) [-551.461] (-553.068) -- 0:01:00
76500 -- (-552.750) [-554.201] (-553.321) (-555.964) * (-555.796) [-552.522] (-552.693) (-554.457) -- 0:01:00
77000 -- (-552.950) (-552.768) (-556.728) [-552.276] * (-553.798) (-551.572) [-553.990] (-553.350) -- 0:00:59
77500 -- (-554.523) (-562.414) (-553.332) [-554.476] * (-553.006) (-552.453) (-555.121) [-553.571] -- 0:00:59
78000 -- (-553.571) [-551.356] (-552.432) (-554.799) * (-551.637) (-552.327) (-555.776) [-554.267] -- 0:00:59
78500 -- (-552.915) (-551.861) [-551.407] (-551.812) * [-551.870] (-552.524) (-553.563) (-553.695) -- 0:00:58
79000 -- (-553.749) (-554.788) (-551.997) [-552.898] * (-552.237) (-552.172) (-554.241) [-552.677] -- 0:00:58
79500 -- (-554.066) (-554.217) [-555.392] (-554.252) * (-552.129) (-556.216) (-554.278) [-554.657] -- 0:00:57
80000 -- (-552.735) [-553.969] (-553.777) (-560.207) * (-556.192) (-553.550) (-556.296) [-551.798] -- 0:00:57
Average standard deviation of split frequencies: 0.034414
80500 -- (-554.423) (-553.185) [-551.935] (-552.817) * (-554.034) (-554.387) (-552.049) [-553.244] -- 0:00:57
81000 -- [-554.483] (-552.932) (-555.238) (-552.418) * (-551.609) [-555.715] (-552.843) (-557.386) -- 0:00:56
81500 -- (-552.947) (-553.282) [-552.033] (-554.265) * (-552.300) [-552.490] (-552.871) (-556.047) -- 0:00:56
82000 -- (-553.297) [-553.936] (-553.236) (-555.035) * [-555.166] (-554.918) (-553.671) (-553.491) -- 0:00:55
82500 -- (-554.896) [-555.281] (-554.496) (-553.165) * (-554.518) (-555.953) [-556.004] (-554.587) -- 0:01:06
83000 -- [-553.342] (-554.669) (-553.901) (-553.332) * [-556.536] (-554.501) (-555.105) (-553.725) -- 0:01:06
83500 -- [-552.882] (-554.137) (-555.833) (-552.324) * (-555.549) (-551.436) (-553.205) [-553.161] -- 0:01:05
84000 -- (-552.507) (-553.983) (-552.941) [-552.118] * [-552.435] (-552.026) (-551.915) (-552.049) -- 0:01:05
84500 -- [-553.806] (-556.134) (-553.699) (-551.532) * (-554.570) (-551.504) [-553.391] (-552.834) -- 0:01:05
85000 -- (-552.822) [-551.914] (-552.925) (-553.092) * (-551.886) [-552.922] (-553.769) (-553.625) -- 0:01:04
Average standard deviation of split frequencies: 0.030801
85500 -- (-554.254) [-552.747] (-553.642) (-552.315) * (-553.220) [-552.590] (-553.262) (-554.285) -- 0:01:04
86000 -- (-555.352) [-553.322] (-551.868) (-551.426) * (-552.149) (-552.606) (-555.917) [-554.971] -- 0:01:03
86500 -- (-552.460) (-554.566) [-557.982] (-552.864) * [-551.539] (-555.559) (-555.225) (-555.925) -- 0:01:03
87000 -- (-554.643) (-552.013) [-553.922] (-552.999) * (-551.953) [-554.599] (-554.880) (-553.580) -- 0:01:02
87500 -- (-553.264) [-553.993] (-554.903) (-555.054) * (-551.657) (-553.940) [-553.187] (-553.242) -- 0:01:02
88000 -- (-553.681) (-551.662) [-553.528] (-555.031) * (-554.069) (-554.195) [-552.180] (-552.750) -- 0:01:02
88500 -- (-556.995) [-552.991] (-552.536) (-554.979) * [-554.613] (-552.887) (-553.713) (-552.529) -- 0:01:01
89000 -- (-555.335) (-554.297) [-553.608] (-552.725) * (-559.221) (-556.038) [-552.255] (-555.233) -- 0:01:01
89500 -- (-556.069) (-554.260) [-552.645] (-554.159) * (-557.287) (-553.035) (-552.335) [-555.734] -- 0:01:01
90000 -- (-551.686) (-552.018) (-552.513) [-555.394] * (-555.073) [-553.471] (-551.989) (-552.647) -- 0:01:00
Average standard deviation of split frequencies: 0.032236
90500 -- (-553.374) (-553.284) (-554.429) [-556.998] * [-554.039] (-554.542) (-552.817) (-555.150) -- 0:01:00
91000 -- (-555.846) [-554.812] (-552.747) (-552.928) * (-551.617) (-554.914) (-551.810) [-554.791] -- 0:00:59
91500 -- [-555.673] (-551.835) (-552.177) (-552.193) * [-555.251] (-553.632) (-553.143) (-553.066) -- 0:00:59
92000 -- (-553.820) (-553.295) [-554.246] (-554.817) * [-554.993] (-551.951) (-552.380) (-551.567) -- 0:00:59
92500 -- (-552.976) (-553.053) (-557.153) [-552.292] * [-554.343] (-553.675) (-551.570) (-553.135) -- 0:00:58
93000 -- (-554.445) (-554.310) (-555.189) [-553.453] * (-554.655) (-553.821) [-552.914] (-552.660) -- 0:00:58
93500 -- [-553.451] (-553.826) (-555.080) (-555.117) * (-555.799) (-552.809) [-551.715] (-553.862) -- 0:00:58
94000 -- (-552.394) (-553.904) (-558.277) [-552.887] * (-553.964) (-554.185) [-552.969] (-553.603) -- 0:00:57
94500 -- (-552.333) (-553.953) (-554.251) [-553.468] * (-553.287) (-551.469) (-554.971) [-555.613] -- 0:00:57
95000 -- (-557.475) (-552.787) [-552.446] (-552.580) * (-555.701) [-551.666] (-554.117) (-554.323) -- 0:00:57
Average standard deviation of split frequencies: 0.031801
95500 -- (-553.381) (-554.525) (-556.101) [-552.848] * (-553.663) [-555.484] (-554.283) (-556.027) -- 0:00:56
96000 -- (-552.942) (-551.798) [-551.899] (-552.970) * (-554.804) [-554.803] (-555.623) (-562.576) -- 0:00:56
96500 -- (-552.652) [-555.182] (-552.210) (-551.789) * (-558.062) (-551.361) (-556.282) [-555.078] -- 0:00:56
97000 -- [-554.698] (-551.905) (-556.125) (-551.669) * (-557.768) (-553.192) (-558.558) [-553.876] -- 0:00:55
97500 -- (-554.657) [-551.508] (-552.868) (-553.203) * (-558.898) [-551.740] (-553.944) (-553.499) -- 0:00:55
98000 -- (-561.482) [-551.724] (-552.944) (-551.527) * (-551.800) (-553.881) (-552.918) [-553.491] -- 0:00:55
98500 -- (-553.145) [-553.632] (-552.444) (-556.334) * (-553.164) [-553.096] (-552.011) (-554.404) -- 0:00:54
99000 -- (-553.721) [-554.933] (-554.261) (-551.557) * (-552.180) (-554.401) [-552.315] (-555.330) -- 0:00:54
99500 -- (-552.031) (-556.841) (-553.285) [-554.150] * (-552.012) (-555.647) [-553.135] (-554.142) -- 0:00:54
100000 -- [-556.368] (-553.242) (-556.452) (-556.624) * [-553.796] (-555.719) (-553.876) (-554.726) -- 0:01:02
Average standard deviation of split frequencies: 0.027358
100500 -- (-555.431) (-554.524) [-554.185] (-553.937) * (-555.082) [-552.454] (-553.114) (-553.807) -- 0:01:02
101000 -- (-552.613) (-551.981) (-558.774) [-553.227] * (-554.098) (-553.639) [-553.295] (-555.801) -- 0:01:02
101500 -- (-552.075) [-554.437] (-553.685) (-552.684) * (-555.198) (-559.239) [-553.507] (-554.069) -- 0:01:01
102000 -- (-552.613) (-552.899) [-551.582] (-555.690) * (-557.340) [-555.294] (-552.867) (-553.413) -- 0:01:01
102500 -- [-551.368] (-555.240) (-553.036) (-553.809) * (-557.827) (-553.112) [-553.674] (-552.204) -- 0:01:01
103000 -- (-553.302) [-554.631] (-554.835) (-553.112) * (-556.120) (-555.705) (-552.878) [-552.301] -- 0:01:00
103500 -- [-552.128] (-556.886) (-553.698) (-554.080) * (-553.466) [-552.836] (-555.096) (-552.370) -- 0:01:00
104000 -- (-553.221) (-556.452) (-555.075) [-554.067] * [-551.694] (-554.923) (-562.636) (-553.442) -- 0:01:00
104500 -- (-554.292) [-552.460] (-556.006) (-555.584) * (-556.097) (-552.406) (-552.219) [-553.378] -- 0:00:59
105000 -- (-551.728) [-554.497] (-553.015) (-552.486) * [-553.719] (-553.610) (-551.579) (-552.505) -- 0:00:59
Average standard deviation of split frequencies: 0.025571
105500 -- [-552.751] (-553.288) (-553.183) (-552.921) * (-552.319) (-557.894) [-551.904] (-555.292) -- 0:00:59
106000 -- (-552.222) (-551.863) (-552.041) [-553.231] * (-551.428) [-554.271] (-554.558) (-555.104) -- 0:00:59
106500 -- (-554.415) [-552.170] (-553.934) (-555.839) * (-553.736) [-552.963] (-552.584) (-552.761) -- 0:00:58
107000 -- (-552.908) [-551.744] (-554.926) (-556.427) * (-557.689) (-552.104) (-551.816) [-551.538] -- 0:00:58
107500 -- (-553.675) (-551.755) (-553.688) [-553.834] * (-559.072) (-552.009) (-553.412) [-554.700] -- 0:00:58
108000 -- (-554.088) (-556.162) [-551.971] (-553.105) * (-558.867) (-552.334) (-554.953) [-554.844] -- 0:00:57
108500 -- (-553.075) (-555.195) (-551.978) [-552.525] * (-554.248) [-555.654] (-553.792) (-557.590) -- 0:00:57
109000 -- [-551.554] (-556.543) (-556.068) (-556.930) * (-552.965) [-554.361] (-554.268) (-556.370) -- 0:00:57
109500 -- (-552.128) (-552.379) (-555.747) [-554.831] * (-552.004) (-557.446) (-556.266) [-552.861] -- 0:00:56
110000 -- [-553.899] (-552.284) (-552.909) (-557.987) * (-551.902) [-553.330] (-554.234) (-560.999) -- 0:00:56
Average standard deviation of split frequencies: 0.023854
110500 -- (-552.547) [-553.182] (-554.630) (-551.890) * (-555.820) (-556.641) [-551.980] (-558.457) -- 0:00:56
111000 -- (-553.402) [-553.293] (-552.499) (-552.979) * (-554.171) (-556.180) (-552.663) [-553.350] -- 0:00:56
111500 -- (-553.047) (-554.138) [-553.003] (-552.697) * (-557.308) [-554.595] (-552.499) (-553.888) -- 0:00:55
112000 -- (-551.965) [-551.742] (-554.714) (-556.668) * (-553.042) (-552.431) [-555.258] (-554.024) -- 0:00:55
112500 -- (-552.803) (-553.713) (-553.850) [-552.763] * (-552.692) (-563.693) [-553.073] (-554.374) -- 0:00:55
113000 -- (-552.167) [-555.074] (-553.657) (-556.174) * [-552.324] (-556.067) (-551.466) (-553.202) -- 0:00:54
113500 -- (-556.254) (-559.687) [-555.195] (-557.288) * (-554.297) [-552.898] (-553.725) (-554.903) -- 0:00:54
114000 -- [-557.443] (-557.445) (-554.444) (-555.004) * (-552.973) [-552.851] (-556.904) (-555.880) -- 0:00:54
114500 -- [-557.429] (-557.856) (-554.545) (-555.082) * (-555.172) (-553.134) (-554.215) [-554.096] -- 0:00:54
115000 -- (-551.705) (-555.746) (-555.594) [-551.909] * (-552.001) (-557.623) (-556.249) [-555.422] -- 0:00:53
Average standard deviation of split frequencies: 0.021742
115500 -- (-553.618) [-555.657] (-553.688) (-553.050) * (-551.857) [-552.321] (-557.173) (-554.258) -- 0:00:53
116000 -- [-553.787] (-554.912) (-555.527) (-554.315) * (-552.097) [-553.489] (-556.471) (-555.079) -- 0:00:53
116500 -- (-554.786) [-551.999] (-556.872) (-553.439) * [-553.638] (-551.940) (-555.787) (-555.226) -- 0:00:53
117000 -- (-552.252) (-551.807) [-551.720] (-552.717) * (-554.700) [-552.868] (-552.837) (-556.712) -- 0:01:00
117500 -- (-556.621) [-557.340] (-552.276) (-559.838) * [-555.095] (-554.547) (-558.959) (-555.126) -- 0:01:00
118000 -- [-554.610] (-557.075) (-555.739) (-558.420) * [-556.024] (-553.825) (-554.286) (-558.259) -- 0:00:59
118500 -- (-551.630) (-553.779) [-555.253] (-559.407) * (-552.424) (-554.170) [-553.241] (-557.458) -- 0:00:59
119000 -- (-551.999) (-552.451) [-552.924] (-556.961) * [-552.094] (-554.521) (-553.999) (-554.723) -- 0:00:59
119500 -- (-553.841) (-553.727) [-551.941] (-555.200) * (-551.802) (-553.778) [-553.143] (-554.308) -- 0:00:58
120000 -- (-554.713) (-553.352) [-552.535] (-553.121) * (-554.992) (-554.314) [-552.508] (-554.655) -- 0:00:58
Average standard deviation of split frequencies: 0.022659
120500 -- (-554.058) (-552.207) (-554.317) [-555.110] * (-553.692) [-553.954] (-552.866) (-555.052) -- 0:00:58
121000 -- (-553.663) [-553.909] (-553.113) (-555.929) * (-556.583) (-554.186) [-552.556] (-556.539) -- 0:00:58
121500 -- (-553.324) (-554.270) [-552.754] (-553.155) * [-555.661] (-554.654) (-551.757) (-553.923) -- 0:00:57
122000 -- (-564.320) (-553.823) (-552.473) [-554.745] * (-553.031) [-553.160] (-553.587) (-552.460) -- 0:00:57
122500 -- [-559.343] (-553.234) (-552.326) (-552.237) * (-553.275) [-552.589] (-552.611) (-552.693) -- 0:00:57
123000 -- [-553.916] (-554.176) (-553.636) (-552.548) * (-552.155) (-551.448) (-553.377) [-552.354] -- 0:00:57
123500 -- (-554.490) (-553.636) [-553.024] (-554.553) * (-555.041) (-553.973) [-552.587] (-554.018) -- 0:00:56
124000 -- [-555.789] (-552.885) (-552.710) (-557.330) * (-552.637) (-559.801) (-553.403) [-552.756] -- 0:00:56
124500 -- (-556.677) [-551.738] (-552.256) (-553.424) * (-551.992) (-553.077) (-552.733) [-555.251] -- 0:00:56
125000 -- [-554.920] (-551.866) (-555.500) (-552.938) * [-552.594] (-553.484) (-552.918) (-553.489) -- 0:00:56
Average standard deviation of split frequencies: 0.024829
125500 -- (-556.074) (-553.760) (-553.661) [-552.856] * (-555.582) [-554.286] (-555.531) (-555.686) -- 0:00:55
126000 -- [-554.720] (-553.045) (-554.313) (-552.363) * (-553.233) (-553.058) (-560.749) [-554.142] -- 0:00:55
126500 -- (-555.407) [-557.747] (-552.570) (-553.541) * (-552.626) [-553.101] (-555.063) (-552.295) -- 0:00:55
127000 -- (-553.488) (-554.609) [-553.108] (-554.582) * [-554.258] (-553.703) (-554.731) (-552.749) -- 0:00:54
127500 -- (-552.582) (-554.446) [-553.565] (-555.891) * (-557.382) (-552.385) [-554.883] (-554.423) -- 0:00:54
128000 -- (-551.858) (-554.640) [-552.776] (-556.388) * (-553.781) [-552.789] (-553.457) (-553.809) -- 0:00:54
128500 -- (-553.652) (-554.404) (-551.652) [-558.261] * (-553.559) (-552.681) (-556.943) [-555.136] -- 0:00:54
129000 -- (-552.603) (-556.274) (-553.846) [-553.926] * [-556.006] (-553.496) (-557.344) (-555.487) -- 0:00:54
129500 -- [-552.748] (-551.734) (-554.089) (-554.519) * (-555.421) (-555.691) (-553.544) [-560.801] -- 0:00:53
130000 -- (-551.892) [-552.736] (-552.763) (-556.851) * (-561.477) (-552.127) (-554.303) [-558.756] -- 0:00:53
Average standard deviation of split frequencies: 0.024223
130500 -- [-554.391] (-552.552) (-552.234) (-552.530) * (-553.523) (-552.193) [-554.794] (-552.735) -- 0:00:53
131000 -- (-555.877) [-553.539] (-551.779) (-559.445) * (-553.844) [-552.412] (-552.294) (-551.929) -- 0:00:53
131500 -- (-552.345) (-553.245) (-552.965) [-554.694] * [-553.162] (-560.201) (-555.310) (-553.730) -- 0:00:52
132000 -- (-555.922) [-554.668] (-553.703) (-553.826) * (-553.565) (-556.094) [-552.600] (-553.106) -- 0:00:52
132500 -- (-556.514) (-558.715) [-553.379] (-552.724) * (-553.744) (-556.597) [-554.699] (-552.402) -- 0:00:52
133000 -- (-557.806) (-553.468) [-553.579] (-556.481) * (-552.858) [-551.212] (-553.686) (-553.267) -- 0:00:52
133500 -- [-554.932] (-553.556) (-557.233) (-553.318) * (-553.237) (-555.034) (-554.843) [-559.260] -- 0:00:51
134000 -- [-551.677] (-552.375) (-553.198) (-553.302) * (-552.974) [-552.883] (-553.617) (-554.313) -- 0:00:51
134500 -- (-552.511) [-554.130] (-552.760) (-552.043) * (-552.247) (-554.605) [-552.652] (-555.842) -- 0:00:57
135000 -- (-553.290) (-551.816) [-553.645] (-552.789) * (-552.653) [-554.909] (-553.405) (-554.758) -- 0:00:57
Average standard deviation of split frequencies: 0.025089
135500 -- (-555.550) [-554.854] (-552.957) (-552.387) * (-553.623) (-551.680) (-553.053) [-557.368] -- 0:00:57
136000 -- (-563.957) (-555.853) (-560.108) [-556.200] * (-552.164) (-552.089) [-552.341] (-556.461) -- 0:00:57
136500 -- (-551.713) (-553.062) [-556.447] (-554.186) * (-553.558) (-552.966) [-553.791] (-556.524) -- 0:00:56
137000 -- [-551.287] (-552.623) (-556.825) (-554.689) * (-553.623) (-553.129) (-553.265) [-551.764] -- 0:00:56
137500 -- (-553.976) [-553.851] (-561.232) (-554.844) * (-554.088) (-551.676) [-553.017] (-553.191) -- 0:00:56
138000 -- (-553.500) [-554.599] (-560.252) (-556.428) * (-554.496) [-552.145] (-553.048) (-552.334) -- 0:00:56
138500 -- (-553.317) [-553.454] (-563.350) (-553.870) * (-553.780) [-553.012] (-553.141) (-556.480) -- 0:00:55
139000 -- (-552.241) (-554.003) (-555.779) [-555.127] * (-552.461) (-552.396) (-553.492) [-552.256] -- 0:00:55
139500 -- [-553.140] (-554.010) (-553.481) (-553.892) * (-551.362) (-552.431) [-552.021] (-552.462) -- 0:00:55
140000 -- (-555.937) (-553.965) [-555.052] (-554.198) * (-551.862) (-554.568) (-553.012) [-553.545] -- 0:00:55
Average standard deviation of split frequencies: 0.024464
140500 -- (-554.514) (-552.043) (-557.502) [-554.837] * (-554.102) (-553.131) [-551.782] (-553.382) -- 0:00:55
141000 -- (-552.965) [-554.818] (-553.464) (-558.410) * (-552.416) (-556.726) (-553.376) [-553.055] -- 0:00:54
141500 -- [-554.375] (-556.245) (-553.080) (-556.094) * (-552.907) [-552.601] (-555.220) (-551.232) -- 0:00:54
142000 -- (-554.692) (-553.730) (-551.907) [-559.573] * [-555.679] (-552.538) (-561.019) (-553.501) -- 0:00:54
142500 -- (-554.892) [-552.556] (-557.989) (-552.050) * (-556.191) [-552.759] (-554.651) (-556.250) -- 0:00:54
143000 -- (-552.913) [-552.353] (-554.790) (-551.808) * (-558.022) [-554.185] (-552.687) (-553.098) -- 0:00:53
143500 -- (-554.385) (-552.946) (-552.415) [-553.754] * [-553.095] (-555.381) (-553.216) (-552.844) -- 0:00:53
144000 -- (-551.656) (-554.759) (-551.865) [-553.419] * (-553.559) [-553.838] (-552.516) (-552.903) -- 0:00:53
144500 -- [-551.980] (-553.441) (-552.693) (-558.422) * [-554.730] (-553.965) (-553.204) (-551.378) -- 0:00:53
145000 -- (-554.023) (-553.949) (-553.599) [-553.890] * (-552.771) (-555.890) (-551.654) [-551.948] -- 0:00:53
Average standard deviation of split frequencies: 0.022602
145500 -- (-552.663) [-552.931] (-554.746) (-553.290) * (-553.611) (-552.693) [-551.710] (-554.968) -- 0:00:52
146000 -- (-551.300) [-552.614] (-552.174) (-555.679) * (-555.435) (-554.398) (-552.696) [-552.820] -- 0:00:52
146500 -- (-551.955) [-552.244] (-553.642) (-557.331) * (-556.155) (-551.703) (-553.534) [-553.793] -- 0:00:52
147000 -- (-553.830) (-552.612) [-552.689] (-556.190) * (-556.744) [-552.402] (-552.953) (-554.706) -- 0:00:52
147500 -- (-553.555) [-553.180] (-555.477) (-555.361) * (-552.522) [-555.357] (-554.517) (-553.561) -- 0:00:52
148000 -- (-552.000) (-552.560) (-558.729) [-556.296] * (-554.550) (-551.552) [-556.123] (-551.822) -- 0:00:51
148500 -- [-551.916] (-552.523) (-553.131) (-553.791) * (-553.853) [-552.416] (-554.293) (-551.987) -- 0:00:51
149000 -- (-551.895) (-552.579) (-552.957) [-555.163] * [-553.767] (-552.784) (-551.482) (-552.966) -- 0:00:51
149500 -- (-551.827) (-554.830) [-554.600] (-554.617) * (-555.567) (-553.381) [-554.224] (-552.205) -- 0:00:51
150000 -- (-554.848) (-554.169) [-554.099] (-553.385) * (-555.552) (-555.735) [-552.345] (-553.235) -- 0:00:51
Average standard deviation of split frequencies: 0.022840
150500 -- (-556.588) (-555.246) (-553.500) [-553.679] * (-551.758) [-551.868] (-551.853) (-555.747) -- 0:00:50
151000 -- [-554.839] (-556.158) (-552.935) (-553.582) * (-553.353) (-552.771) (-553.314) [-554.535] -- 0:00:50
151500 -- (-555.900) (-554.203) [-562.634] (-557.216) * (-555.493) (-551.564) [-552.673] (-553.791) -- 0:00:56
152000 -- (-553.394) [-553.062] (-555.177) (-552.756) * (-551.784) [-552.196] (-553.598) (-554.334) -- 0:00:55
152500 -- (-553.734) (-554.942) [-552.014] (-552.550) * (-556.610) [-552.213] (-555.439) (-555.980) -- 0:00:55
153000 -- (-555.816) [-555.775] (-554.614) (-553.030) * (-552.210) (-552.988) (-553.429) [-556.501] -- 0:00:55
153500 -- (-554.483) (-554.834) (-554.901) [-554.825] * (-553.998) (-554.782) (-552.976) [-556.980] -- 0:00:55
154000 -- (-554.607) [-552.320] (-552.760) (-552.714) * (-556.191) (-553.676) [-552.920] (-553.605) -- 0:00:54
154500 -- (-553.877) [-553.590] (-556.746) (-554.101) * [-552.296] (-551.878) (-553.136) (-552.353) -- 0:00:54
155000 -- (-556.305) (-552.634) [-552.268] (-551.468) * (-553.461) (-552.150) [-552.516] (-552.730) -- 0:00:54
Average standard deviation of split frequencies: 0.022059
155500 -- [-554.736] (-553.210) (-552.008) (-552.149) * (-551.547) (-553.679) [-553.129] (-552.260) -- 0:00:54
156000 -- (-551.817) (-553.350) (-551.729) [-551.455] * (-554.392) [-552.547] (-552.831) (-551.858) -- 0:00:54
156500 -- (-551.790) [-552.968] (-551.905) (-552.510) * (-553.035) (-552.245) (-558.717) [-552.480] -- 0:00:53
157000 -- (-555.661) (-566.155) (-551.687) [-552.703] * (-556.353) (-551.349) (-552.654) [-556.117] -- 0:00:53
157500 -- (-552.455) (-554.838) [-552.468] (-552.122) * (-552.663) (-554.417) (-553.474) [-558.075] -- 0:00:53
158000 -- (-552.887) [-551.575] (-556.034) (-552.415) * (-552.423) (-557.850) (-554.089) [-553.895] -- 0:00:53
158500 -- (-551.901) [-553.341] (-552.815) (-555.352) * (-551.535) (-554.659) (-554.871) [-552.603] -- 0:00:53
159000 -- [-552.413] (-552.640) (-555.247) (-553.233) * (-554.360) (-554.438) (-553.893) [-553.910] -- 0:00:52
159500 -- (-554.240) (-557.808) (-553.477) [-554.783] * (-551.547) (-555.980) (-553.616) [-554.392] -- 0:00:52
160000 -- (-555.076) (-556.634) [-552.605] (-553.589) * (-551.998) (-552.784) (-554.955) [-552.968] -- 0:00:52
Average standard deviation of split frequencies: 0.020818
160500 -- [-552.607] (-554.676) (-554.129) (-553.092) * (-552.749) (-551.991) (-552.756) [-554.222] -- 0:00:52
161000 -- (-555.147) (-552.069) (-555.000) [-552.409] * (-554.211) (-552.077) [-551.908] (-555.502) -- 0:00:52
161500 -- (-554.307) (-552.358) (-554.225) [-554.500] * [-555.313] (-552.279) (-553.548) (-551.337) -- 0:00:51
162000 -- (-552.426) [-552.577] (-557.902) (-552.927) * (-554.480) (-551.561) (-552.179) [-552.076] -- 0:00:51
162500 -- (-552.801) [-555.573] (-553.209) (-551.970) * (-553.592) [-555.082] (-553.315) (-553.634) -- 0:00:51
163000 -- [-552.351] (-554.861) (-557.875) (-554.862) * (-551.684) (-551.451) (-555.419) [-553.463] -- 0:00:51
163500 -- (-555.062) (-551.944) [-553.447] (-556.936) * (-551.359) [-554.943] (-552.504) (-554.681) -- 0:00:51
164000 -- (-555.974) [-553.137] (-554.250) (-553.294) * (-551.595) (-556.908) [-551.299] (-553.146) -- 0:00:50
164500 -- [-555.615] (-553.198) (-555.260) (-556.514) * [-551.591] (-553.587) (-552.363) (-554.340) -- 0:00:50
165000 -- (-552.631) (-551.871) (-554.835) [-552.987] * (-557.686) [-553.820] (-555.975) (-553.261) -- 0:00:50
Average standard deviation of split frequencies: 0.019608
165500 -- (-553.029) (-555.046) (-557.301) [-552.689] * [-552.931] (-553.390) (-555.363) (-553.122) -- 0:00:50
166000 -- [-552.473] (-560.150) (-553.291) (-552.169) * (-552.812) (-553.216) (-552.526) [-553.181] -- 0:00:50
166500 -- (-554.650) (-553.336) (-553.206) [-555.683] * (-553.461) (-556.711) [-557.028] (-552.800) -- 0:00:50
167000 -- (-553.385) (-555.628) (-554.474) [-552.178] * (-553.284) (-555.989) (-555.894) [-552.067] -- 0:00:49
167500 -- (-552.944) [-553.958] (-553.164) (-552.229) * (-553.608) (-554.682) (-556.619) [-551.732] -- 0:00:49
168000 -- (-556.756) [-554.779] (-553.232) (-557.741) * (-552.764) (-554.473) (-554.352) [-553.918] -- 0:00:49
168500 -- (-551.829) [-554.711] (-551.809) (-553.794) * (-552.807) (-552.065) (-555.011) [-554.058] -- 0:00:49
169000 -- (-552.401) (-555.441) (-554.495) [-553.308] * (-554.607) [-552.490] (-554.221) (-558.592) -- 0:00:54
169500 -- [-554.895] (-554.384) (-558.848) (-552.654) * (-557.081) (-557.124) (-554.580) [-553.897] -- 0:00:53
170000 -- [-557.919] (-554.159) (-554.736) (-552.564) * (-555.834) (-553.472) (-554.641) [-552.343] -- 0:00:53
Average standard deviation of split frequencies: 0.019473
170500 -- (-559.541) (-553.375) (-551.367) [-553.084] * [-555.866] (-554.508) (-552.460) (-552.565) -- 0:00:53
171000 -- (-552.044) (-551.499) [-554.560] (-553.757) * (-554.792) [-552.280] (-554.235) (-554.079) -- 0:00:53
171500 -- (-554.361) (-552.819) (-555.819) [-554.555] * [-561.308] (-553.262) (-552.581) (-552.234) -- 0:00:53
172000 -- [-556.179] (-552.570) (-554.688) (-553.568) * (-555.914) (-552.135) (-552.932) [-554.620] -- 0:00:52
172500 -- (-553.485) (-555.333) (-551.508) [-551.731] * (-553.428) [-552.721] (-555.286) (-553.642) -- 0:00:52
173000 -- (-551.627) [-551.566] (-554.204) (-554.484) * (-557.712) (-553.808) [-552.589] (-553.853) -- 0:00:52
173500 -- (-553.709) (-552.772) (-553.709) [-556.079] * (-553.521) [-551.819] (-555.005) (-552.606) -- 0:00:52
174000 -- (-553.979) (-557.839) [-552.662] (-556.292) * (-552.855) (-552.390) (-554.365) [-551.123] -- 0:00:52
174500 -- (-552.721) (-554.934) (-552.940) [-553.339] * (-558.837) [-553.962] (-554.800) (-554.728) -- 0:00:52
175000 -- [-551.265] (-553.080) (-557.304) (-555.093) * (-554.638) [-555.337] (-555.798) (-553.475) -- 0:00:51
Average standard deviation of split frequencies: 0.017946
175500 -- (-555.444) (-554.513) (-554.013) [-552.761] * [-552.547] (-552.264) (-553.348) (-552.597) -- 0:00:51
176000 -- (-554.356) (-551.642) [-552.825] (-554.154) * (-555.049) (-552.179) [-552.435] (-554.019) -- 0:00:51
176500 -- (-558.390) (-555.145) [-552.386] (-552.457) * (-552.646) (-554.654) (-555.174) [-551.523] -- 0:00:51
177000 -- (-552.558) (-551.907) [-552.004] (-555.817) * (-554.835) [-553.374] (-552.676) (-551.634) -- 0:00:51
177500 -- [-552.159] (-554.806) (-551.712) (-556.060) * [-553.583] (-551.829) (-552.604) (-554.265) -- 0:00:50
178000 -- (-551.801) (-555.333) [-551.345] (-553.890) * (-553.686) [-552.840] (-558.076) (-557.440) -- 0:00:50
178500 -- (-555.799) (-552.308) [-551.419] (-555.314) * (-552.682) [-552.875] (-552.836) (-553.572) -- 0:00:50
179000 -- (-559.774) (-552.242) (-553.748) [-552.818] * (-553.588) (-552.724) (-552.079) [-554.236] -- 0:00:50
179500 -- (-556.460) (-554.241) [-553.131] (-560.335) * [-553.133] (-556.453) (-553.271) (-553.173) -- 0:00:50
180000 -- (-554.988) [-557.279] (-553.130) (-554.545) * [-554.950] (-555.233) (-552.399) (-553.236) -- 0:00:50
Average standard deviation of split frequencies: 0.020462
180500 -- (-554.478) (-554.204) [-556.391] (-553.289) * (-556.038) (-552.472) (-553.326) [-554.037] -- 0:00:49
181000 -- (-561.214) (-552.289) (-554.547) [-553.072] * (-552.848) [-553.382] (-552.988) (-555.647) -- 0:00:49
181500 -- [-555.498] (-557.943) (-555.736) (-551.708) * [-554.068] (-556.617) (-555.007) (-556.517) -- 0:00:49
182000 -- (-552.861) (-553.750) [-554.068] (-551.836) * (-555.866) (-551.981) [-551.804] (-554.002) -- 0:00:49
182500 -- [-552.535] (-554.054) (-552.637) (-552.566) * (-555.294) (-551.618) [-553.650] (-555.677) -- 0:00:49
183000 -- (-552.916) (-554.899) (-553.355) [-552.046] * (-554.029) (-552.281) [-558.655] (-553.916) -- 0:00:49
183500 -- [-553.732] (-554.976) (-554.260) (-552.087) * [-551.951] (-552.382) (-553.629) (-552.450) -- 0:00:48
184000 -- (-555.534) [-552.192] (-551.761) (-551.811) * (-551.341) (-551.138) [-552.524] (-552.085) -- 0:00:48
184500 -- (-554.070) (-555.035) (-552.465) [-551.668] * [-553.741] (-552.116) (-551.138) (-553.131) -- 0:00:48
185000 -- (-553.907) [-553.502] (-552.194) (-552.973) * (-553.202) (-551.659) (-555.374) [-552.493] -- 0:00:48
Average standard deviation of split frequencies: 0.020022
185500 -- (-553.079) (-555.083) [-553.227] (-553.114) * [-558.465] (-556.592) (-555.770) (-556.835) -- 0:00:48
186000 -- (-553.699) (-553.365) (-554.289) [-553.733] * (-553.660) [-551.702] (-557.225) (-555.737) -- 0:00:52
186500 -- (-557.697) [-552.980] (-553.831) (-552.943) * (-553.546) [-551.518] (-559.933) (-552.990) -- 0:00:52
187000 -- (-552.853) [-551.743] (-552.540) (-553.583) * (-554.668) [-552.298] (-557.462) (-552.203) -- 0:00:52
187500 -- (-553.021) (-554.271) [-552.798] (-554.422) * [-555.626] (-552.877) (-552.626) (-552.599) -- 0:00:52
188000 -- (-554.231) [-553.724] (-551.694) (-554.014) * (-553.557) (-553.283) [-553.084] (-552.497) -- 0:00:51
188500 -- [-552.770] (-553.683) (-552.592) (-552.325) * (-556.922) [-555.793] (-552.956) (-556.655) -- 0:00:51
189000 -- [-552.380] (-552.719) (-554.839) (-554.482) * (-554.120) (-553.783) (-557.291) [-552.672] -- 0:00:51
189500 -- (-553.083) [-552.727] (-551.970) (-555.151) * [-554.694] (-553.184) (-552.112) (-551.997) -- 0:00:51
190000 -- (-554.550) (-556.814) (-557.457) [-554.951] * (-551.804) [-554.570] (-554.682) (-553.890) -- 0:00:51
Average standard deviation of split frequencies: 0.020768
190500 -- (-553.391) (-555.031) (-557.285) [-553.729] * [-552.315] (-551.934) (-554.868) (-554.073) -- 0:00:50
191000 -- (-553.165) (-552.652) [-553.633] (-553.822) * [-553.121] (-553.349) (-559.332) (-553.372) -- 0:00:50
191500 -- [-552.552] (-555.201) (-554.997) (-554.072) * [-553.325] (-556.263) (-554.394) (-552.081) -- 0:00:50
192000 -- (-553.700) (-553.674) [-553.286] (-555.612) * (-552.564) (-554.449) (-551.893) [-552.414] -- 0:00:50
192500 -- (-552.979) (-555.184) (-553.512) [-555.343] * (-552.261) (-553.484) [-555.833] (-552.687) -- 0:00:50
193000 -- (-552.510) [-551.931] (-553.392) (-554.266) * [-556.183] (-553.575) (-555.579) (-557.329) -- 0:00:50
193500 -- (-555.948) (-551.874) [-551.720] (-551.431) * (-553.176) (-554.973) [-552.972] (-552.930) -- 0:00:50
194000 -- (-557.552) (-553.048) [-552.651] (-555.555) * (-556.140) [-552.863] (-556.076) (-556.429) -- 0:00:49
194500 -- (-558.399) (-556.179) (-556.316) [-555.798] * (-553.082) (-554.191) (-554.174) [-557.735] -- 0:00:49
195000 -- (-555.725) (-555.211) [-554.373] (-556.996) * (-561.534) [-554.458] (-554.465) (-556.389) -- 0:00:49
Average standard deviation of split frequencies: 0.020804
195500 -- (-556.962) (-554.183) (-553.715) [-555.960] * (-555.076) (-554.248) (-556.360) [-552.914] -- 0:00:49
196000 -- (-556.024) [-551.445] (-553.809) (-552.909) * [-553.911] (-551.780) (-552.985) (-552.830) -- 0:00:49
196500 -- [-551.459] (-553.216) (-557.482) (-554.279) * [-553.380] (-552.226) (-553.875) (-554.353) -- 0:00:49
197000 -- [-553.890] (-552.064) (-552.863) (-554.176) * (-557.340) (-553.876) (-557.826) [-552.956] -- 0:00:48
197500 -- (-555.033) [-554.265] (-552.158) (-552.921) * (-562.082) [-552.138] (-553.172) (-552.688) -- 0:00:48
198000 -- (-554.223) (-556.132) (-552.884) [-553.099] * [-554.332] (-554.035) (-554.869) (-552.261) -- 0:00:48
198500 -- (-557.512) (-556.147) (-552.352) [-555.020] * (-557.577) [-552.638] (-553.117) (-555.891) -- 0:00:48
199000 -- (-557.482) (-552.958) (-552.873) [-553.062] * (-558.282) (-552.755) [-554.076] (-554.224) -- 0:00:48
199500 -- (-559.221) [-556.848] (-555.865) (-556.612) * (-553.779) [-552.297] (-554.659) (-552.770) -- 0:00:48
200000 -- (-553.698) (-561.513) (-558.345) [-554.421] * (-556.430) [-552.507] (-553.435) (-553.811) -- 0:00:48
Average standard deviation of split frequencies: 0.021143
200500 -- (-555.748) (-555.523) (-555.728) [-553.340] * [-552.784] (-553.099) (-552.484) (-553.997) -- 0:00:47
201000 -- [-553.716] (-555.544) (-555.125) (-555.064) * (-554.911) [-552.281] (-552.343) (-554.035) -- 0:00:47
201500 -- (-558.169) [-557.560] (-552.692) (-552.761) * (-556.000) (-552.353) (-551.970) [-551.771] -- 0:00:47
202000 -- (-554.076) (-554.490) (-554.558) [-551.680] * (-556.333) (-553.269) [-552.775] (-557.385) -- 0:00:47
202500 -- (-551.702) [-554.621] (-552.617) (-553.953) * (-553.982) (-552.127) [-555.118] (-552.688) -- 0:00:51
203000 -- (-554.703) (-552.700) (-552.044) [-552.169] * (-554.293) (-552.789) [-551.711] (-552.727) -- 0:00:51
203500 -- (-553.587) (-554.035) [-551.621] (-554.304) * [-554.820] (-553.634) (-551.704) (-552.089) -- 0:00:50
204000 -- [-552.732] (-553.118) (-551.685) (-553.282) * (-554.614) (-555.262) [-554.559] (-556.243) -- 0:00:50
204500 -- (-552.682) (-553.503) [-552.628] (-551.834) * [-556.303] (-555.087) (-554.649) (-555.467) -- 0:00:50
205000 -- (-554.905) (-552.392) [-553.706] (-555.104) * (-552.488) [-553.069] (-556.747) (-552.797) -- 0:00:50
Average standard deviation of split frequencies: 0.019833
205500 -- [-554.936] (-558.716) (-554.873) (-555.706) * (-552.992) (-552.395) [-556.058] (-552.754) -- 0:00:50
206000 -- (-553.571) (-560.861) [-552.990] (-557.863) * (-554.630) (-554.721) [-552.284] (-553.405) -- 0:00:50
206500 -- [-553.626] (-555.165) (-554.458) (-553.229) * [-556.921] (-554.964) (-552.287) (-554.869) -- 0:00:49
207000 -- (-554.341) [-555.242] (-553.092) (-552.918) * [-553.689] (-551.204) (-553.144) (-552.831) -- 0:00:49
207500 -- [-553.964] (-553.643) (-553.004) (-553.553) * (-561.109) [-552.469] (-552.839) (-553.611) -- 0:00:49
208000 -- (-552.606) [-553.274] (-557.012) (-554.044) * (-552.831) (-551.663) [-553.532] (-553.349) -- 0:00:49
208500 -- [-551.917] (-553.277) (-557.394) (-553.477) * [-553.144] (-552.612) (-555.344) (-553.785) -- 0:00:49
209000 -- (-552.508) (-556.244) [-556.758] (-552.154) * [-554.122] (-553.183) (-552.763) (-553.365) -- 0:00:49
209500 -- (-555.008) [-557.198] (-552.929) (-553.338) * [-553.562] (-553.046) (-554.502) (-556.124) -- 0:00:49
210000 -- [-553.321] (-553.250) (-554.660) (-553.535) * (-553.697) (-555.490) [-553.973] (-553.671) -- 0:00:48
Average standard deviation of split frequencies: 0.018908
210500 -- [-554.223] (-552.865) (-559.447) (-552.514) * [-553.830] (-558.273) (-553.035) (-552.755) -- 0:00:48
211000 -- (-551.877) [-553.185] (-555.651) (-551.496) * (-552.412) (-560.861) [-552.681] (-552.050) -- 0:00:48
211500 -- [-551.915] (-553.355) (-556.755) (-552.618) * (-552.289) (-556.968) (-553.867) [-552.760] -- 0:00:48
212000 -- (-554.816) (-555.004) (-554.647) [-553.339] * (-555.148) [-556.240] (-557.591) (-554.629) -- 0:00:48
212500 -- (-552.754) [-553.804] (-554.576) (-554.530) * (-554.603) [-551.634] (-556.199) (-553.356) -- 0:00:48
213000 -- (-553.521) [-553.706] (-555.440) (-553.974) * [-553.174] (-553.955) (-554.313) (-557.770) -- 0:00:48
213500 -- [-559.226] (-556.587) (-551.807) (-555.993) * (-553.509) (-552.854) (-555.618) [-552.433] -- 0:00:47
214000 -- (-552.423) [-553.002] (-554.969) (-557.854) * (-555.691) (-555.504) [-553.200] (-553.673) -- 0:00:47
214500 -- (-554.072) (-552.529) [-556.298] (-558.316) * (-558.022) [-552.357] (-551.395) (-553.932) -- 0:00:47
215000 -- [-554.330] (-553.417) (-552.394) (-555.325) * (-556.684) (-553.404) [-552.744] (-554.411) -- 0:00:47
Average standard deviation of split frequencies: 0.018551
215500 -- (-555.292) (-551.774) (-552.438) [-552.617] * [-553.866] (-553.570) (-552.769) (-555.935) -- 0:00:47
216000 -- (-553.693) [-551.449] (-552.842) (-553.412) * [-552.064] (-554.544) (-561.940) (-553.188) -- 0:00:47
216500 -- (-551.334) [-551.589] (-553.057) (-555.065) * (-554.797) [-552.756] (-561.624) (-556.218) -- 0:00:47
217000 -- (-552.346) [-552.371] (-551.736) (-552.451) * (-554.247) [-554.590] (-555.688) (-555.825) -- 0:00:46
217500 -- [-554.066] (-552.284) (-553.307) (-558.411) * [-554.727] (-554.464) (-553.666) (-558.767) -- 0:00:46
218000 -- (-553.827) (-553.739) [-553.723] (-554.941) * (-554.822) (-558.072) [-554.044] (-560.798) -- 0:00:46
218500 -- (-558.265) (-555.846) (-558.120) [-557.985] * [-551.725] (-555.880) (-552.259) (-553.871) -- 0:00:46
219000 -- [-553.990] (-552.568) (-553.528) (-553.256) * (-555.572) (-556.984) (-552.869) [-553.334] -- 0:00:46
219500 -- [-552.615] (-556.017) (-553.497) (-553.441) * (-554.804) [-554.787] (-555.783) (-553.329) -- 0:00:49
220000 -- [-553.966] (-554.144) (-551.424) (-552.413) * [-552.569] (-551.944) (-554.704) (-554.322) -- 0:00:49
Average standard deviation of split frequencies: 0.017203
220500 -- (-553.401) (-552.176) [-551.892] (-556.864) * [-552.542] (-553.873) (-553.254) (-552.645) -- 0:00:49
221000 -- [-552.106] (-552.965) (-551.892) (-554.164) * (-555.844) (-553.036) (-557.039) [-552.633] -- 0:00:49
221500 -- (-555.713) (-552.230) [-551.849] (-555.104) * [-553.284] (-553.266) (-552.568) (-556.334) -- 0:00:49
222000 -- (-552.291) (-553.396) (-552.150) [-552.907] * [-553.527] (-553.139) (-553.173) (-552.575) -- 0:00:49
222500 -- (-553.237) (-556.603) (-552.601) [-553.441] * (-555.430) (-555.389) (-553.026) [-554.575] -- 0:00:48
223000 -- [-554.553] (-557.384) (-552.499) (-552.846) * [-552.569] (-555.642) (-556.459) (-553.926) -- 0:00:48
223500 -- (-555.574) (-553.125) (-552.138) [-552.104] * [-553.267] (-553.542) (-556.674) (-553.677) -- 0:00:48
224000 -- [-555.454] (-552.692) (-555.767) (-552.765) * (-554.121) (-553.043) [-552.406] (-555.400) -- 0:00:48
224500 -- (-553.183) [-555.142] (-554.965) (-552.201) * (-553.484) (-552.551) (-553.397) [-558.046] -- 0:00:48
225000 -- [-554.493] (-554.543) (-552.353) (-554.768) * (-553.506) (-553.246) [-553.947] (-553.238) -- 0:00:48
Average standard deviation of split frequencies: 0.016687
225500 -- (-552.717) (-553.726) [-553.377] (-553.842) * (-556.433) (-552.937) [-551.392] (-552.748) -- 0:00:48
226000 -- [-551.820] (-555.505) (-553.062) (-552.607) * (-551.738) (-554.672) [-552.604] (-553.249) -- 0:00:47
226500 -- (-554.425) (-556.704) (-554.004) [-551.785] * [-554.635] (-553.333) (-552.521) (-555.245) -- 0:00:47
227000 -- (-558.052) (-556.460) (-555.826) [-553.224] * (-553.147) (-557.861) (-556.733) [-552.106] -- 0:00:47
227500 -- [-554.295] (-553.877) (-553.904) (-554.616) * (-554.167) (-552.291) (-553.035) [-554.998] -- 0:00:47
228000 -- (-553.367) (-553.228) (-554.179) [-553.083] * (-554.984) (-552.697) [-552.110] (-555.515) -- 0:00:47
228500 -- (-552.640) (-554.572) (-554.427) [-553.627] * (-552.073) [-555.117] (-552.774) (-553.426) -- 0:00:47
229000 -- (-557.747) (-552.598) (-552.745) [-554.020] * [-553.137] (-552.303) (-552.017) (-553.478) -- 0:00:47
229500 -- (-553.221) (-555.412) (-557.972) [-553.584] * (-551.974) [-554.307] (-552.469) (-555.086) -- 0:00:47
230000 -- (-554.624) [-552.956] (-553.623) (-552.661) * (-555.802) (-552.764) [-553.097] (-554.323) -- 0:00:46
Average standard deviation of split frequencies: 0.016860
230500 -- (-553.156) (-554.823) (-552.593) [-555.405] * [-552.087] (-555.761) (-552.581) (-554.866) -- 0:00:46
231000 -- [-554.136] (-554.426) (-554.195) (-553.231) * [-553.571] (-553.199) (-554.586) (-554.275) -- 0:00:46
231500 -- (-555.617) (-553.617) [-552.048] (-552.662) * (-553.373) [-553.872] (-555.793) (-556.563) -- 0:00:46
232000 -- [-555.006] (-554.450) (-552.741) (-552.944) * [-552.219] (-552.346) (-554.768) (-553.982) -- 0:00:46
232500 -- (-559.021) (-559.233) (-554.490) [-554.789] * (-552.421) (-552.209) (-552.336) [-552.464] -- 0:00:46
233000 -- (-558.888) [-553.757] (-552.568) (-552.337) * (-553.519) [-553.989] (-560.345) (-551.704) -- 0:00:46
233500 -- (-553.681) (-552.562) [-551.543] (-551.423) * (-554.570) (-555.915) (-558.453) [-553.237] -- 0:00:45
234000 -- (-553.575) (-552.724) (-552.894) [-551.973] * (-553.640) [-552.945] (-553.083) (-556.560) -- 0:00:45
234500 -- (-553.062) (-555.178) (-555.157) [-555.210] * (-553.730) (-552.588) (-553.261) [-557.410] -- 0:00:45
235000 -- (-552.649) (-554.569) (-555.914) [-553.105] * (-555.689) [-553.154] (-553.171) (-554.278) -- 0:00:45
Average standard deviation of split frequencies: 0.016926
235500 -- (-556.917) [-553.908] (-554.700) (-555.278) * (-554.067) (-553.471) [-553.483] (-555.274) -- 0:00:45
236000 -- (-551.313) [-556.567] (-554.792) (-553.367) * (-553.807) (-552.650) [-552.018] (-553.400) -- 0:00:45
236500 -- (-551.834) (-551.175) (-554.411) [-553.668] * (-554.400) (-553.469) (-554.983) [-555.619] -- 0:00:48
237000 -- (-553.337) (-554.601) (-551.778) [-551.159] * (-552.485) [-554.908] (-553.118) (-554.415) -- 0:00:48
237500 -- (-552.029) (-552.692) [-553.426] (-552.329) * (-554.871) [-554.931] (-552.982) (-553.184) -- 0:00:48
238000 -- (-553.678) [-553.515] (-555.376) (-551.997) * (-552.001) [-553.547] (-556.458) (-551.797) -- 0:00:48
238500 -- [-553.099] (-551.930) (-553.140) (-554.891) * (-558.166) [-554.187] (-554.385) (-552.681) -- 0:00:47
239000 -- (-556.495) [-553.525] (-553.988) (-554.466) * (-551.645) [-553.153] (-553.864) (-554.639) -- 0:00:47
239500 -- (-554.623) [-554.841] (-554.133) (-551.653) * (-551.677) [-553.512] (-554.124) (-551.904) -- 0:00:47
240000 -- [-553.188] (-554.903) (-558.823) (-552.772) * (-554.128) (-552.500) (-555.312) [-553.458] -- 0:00:47
Average standard deviation of split frequencies: 0.018453
240500 -- (-555.322) (-552.253) (-556.170) [-553.755] * (-552.215) (-554.244) (-552.714) [-552.473] -- 0:00:47
241000 -- (-558.003) (-553.736) (-553.727) [-554.644] * (-554.244) (-554.965) [-553.039] (-552.136) -- 0:00:47
241500 -- (-554.394) [-555.620] (-556.993) (-557.319) * (-555.097) (-552.436) (-555.299) [-552.765] -- 0:00:47
242000 -- (-554.478) (-555.113) (-552.453) [-554.003] * (-553.466) (-553.821) [-553.207] (-552.015) -- 0:00:46
242500 -- (-559.479) [-554.588] (-553.193) (-552.859) * (-552.596) (-552.713) (-555.760) [-556.601] -- 0:00:46
243000 -- (-554.993) (-559.239) (-553.517) [-555.566] * (-553.243) [-552.629] (-553.480) (-551.904) -- 0:00:46
243500 -- (-557.399) (-561.015) [-552.694] (-554.646) * (-553.629) (-551.992) (-551.747) [-552.626] -- 0:00:46
244000 -- [-554.349] (-563.872) (-552.161) (-554.145) * [-552.306] (-551.737) (-552.956) (-553.593) -- 0:00:46
244500 -- (-552.822) (-558.997) [-552.397] (-553.286) * (-551.959) (-551.948) (-553.100) [-553.115] -- 0:00:46
245000 -- (-553.134) (-557.656) (-553.327) [-554.310] * (-552.663) (-551.559) (-552.416) [-553.469] -- 0:00:46
Average standard deviation of split frequencies: 0.016882
245500 -- (-554.155) (-556.372) (-554.761) [-552.582] * (-553.561) (-554.602) (-551.703) [-555.685] -- 0:00:46
246000 -- (-558.930) (-552.340) (-556.139) [-554.125] * [-553.353] (-554.048) (-552.346) (-553.021) -- 0:00:45
246500 -- (-562.330) (-555.164) (-552.179) [-553.591] * [-552.067] (-551.990) (-552.426) (-553.073) -- 0:00:45
247000 -- (-559.536) (-554.204) (-551.799) [-551.796] * (-554.494) (-552.208) (-554.478) [-553.603] -- 0:00:45
247500 -- (-554.932) (-553.111) [-553.345] (-559.355) * (-552.875) [-556.529] (-553.580) (-555.235) -- 0:00:45
248000 -- (-553.837) (-553.749) (-552.414) [-556.777] * [-553.253] (-552.688) (-553.068) (-553.791) -- 0:00:45
248500 -- [-554.332] (-554.914) (-551.390) (-553.586) * [-553.749] (-559.429) (-552.741) (-553.556) -- 0:00:45
249000 -- (-555.688) (-553.384) [-553.163] (-557.693) * (-554.787) (-556.901) [-552.692] (-556.068) -- 0:00:45
249500 -- (-552.953) (-552.161) (-552.866) [-551.784] * (-553.903) [-553.524] (-552.678) (-553.637) -- 0:00:45
250000 -- (-554.483) [-556.135] (-553.340) (-551.825) * (-558.995) (-553.526) [-551.490] (-558.685) -- 0:00:45
Average standard deviation of split frequencies: 0.017618
250500 -- (-555.981) (-551.704) [-552.343] (-551.312) * (-553.985) (-554.299) [-552.880] (-555.693) -- 0:00:44
251000 -- (-553.306) (-553.357) [-553.427] (-552.634) * (-552.637) [-554.329] (-552.840) (-555.349) -- 0:00:44
251500 -- (-552.961) (-556.808) (-559.658) [-553.173] * (-554.291) [-554.676] (-553.906) (-555.653) -- 0:00:44
252000 -- (-554.410) (-552.159) (-554.178) [-553.512] * (-556.271) [-553.975] (-553.842) (-554.628) -- 0:00:44
252500 -- [-553.008] (-551.544) (-553.678) (-551.980) * (-551.632) (-554.257) (-555.918) [-551.895] -- 0:00:44
253000 -- (-554.862) [-551.548] (-552.646) (-552.475) * (-553.833) (-552.909) (-556.907) [-554.393] -- 0:00:44
253500 -- (-553.723) [-554.737] (-555.697) (-551.889) * (-554.871) (-552.814) (-553.560) [-553.326] -- 0:00:44
254000 -- (-552.657) [-555.783] (-551.619) (-555.184) * (-553.941) (-552.095) [-552.085] (-555.973) -- 0:00:46
254500 -- [-552.983] (-556.692) (-551.258) (-554.584) * (-555.804) [-553.922] (-552.807) (-552.794) -- 0:00:46
255000 -- (-552.151) (-552.051) [-552.962] (-554.376) * (-555.380) [-552.665] (-552.983) (-553.833) -- 0:00:46
Average standard deviation of split frequencies: 0.017348
255500 -- (-551.850) [-553.074] (-552.549) (-554.567) * (-552.938) (-551.743) [-551.845] (-552.856) -- 0:00:46
256000 -- (-553.507) (-553.302) (-551.548) [-553.610] * (-553.172) [-553.588] (-552.074) (-554.263) -- 0:00:46
256500 -- [-552.841] (-553.806) (-552.958) (-553.882) * (-552.958) (-559.253) [-552.446] (-557.425) -- 0:00:46
257000 -- (-551.395) [-555.334] (-553.982) (-552.876) * (-553.714) (-557.075) [-552.877] (-554.351) -- 0:00:46
257500 -- (-553.393) (-554.873) [-552.754] (-561.242) * (-555.713) [-555.441] (-552.633) (-551.873) -- 0:00:46
258000 -- (-551.886) (-551.853) (-556.127) [-553.215] * (-552.797) (-555.490) [-553.112] (-552.198) -- 0:00:46
258500 -- (-554.259) [-551.984] (-555.095) (-559.055) * (-552.590) [-554.164] (-554.267) (-553.028) -- 0:00:45
259000 -- (-553.769) [-553.473] (-552.726) (-557.281) * [-552.483] (-556.248) (-554.864) (-552.948) -- 0:00:45
259500 -- (-553.659) (-557.240) [-555.775] (-553.937) * [-553.346] (-553.057) (-556.016) (-553.247) -- 0:00:45
260000 -- (-553.842) (-558.882) (-552.838) [-553.226] * [-551.445] (-553.599) (-559.719) (-554.962) -- 0:00:45
Average standard deviation of split frequencies: 0.017080
260500 -- (-553.279) (-555.235) [-552.773] (-553.237) * [-551.976] (-555.506) (-553.789) (-556.861) -- 0:00:45
261000 -- (-560.452) (-556.581) [-554.824] (-552.566) * [-553.207] (-556.238) (-552.320) (-556.196) -- 0:00:45
261500 -- [-552.899] (-556.638) (-552.129) (-554.977) * (-553.589) (-553.145) (-553.387) [-555.215] -- 0:00:45
262000 -- (-553.530) [-552.639] (-552.300) (-553.867) * (-553.505) (-554.974) [-552.852] (-554.695) -- 0:00:45
262500 -- (-551.849) [-551.431] (-555.065) (-554.675) * [-552.061] (-553.604) (-552.523) (-552.265) -- 0:00:44
263000 -- (-552.203) (-552.421) (-555.074) [-552.470] * (-551.395) (-559.752) [-552.971] (-553.149) -- 0:00:44
263500 -- (-559.457) (-552.993) [-552.863] (-552.948) * (-554.549) (-557.103) (-555.918) [-553.784] -- 0:00:44
264000 -- (-553.587) [-552.762] (-554.609) (-554.774) * (-554.691) (-555.539) [-551.845] (-552.005) -- 0:00:44
264500 -- [-552.140] (-557.413) (-554.906) (-553.266) * [-552.429] (-555.076) (-553.730) (-553.423) -- 0:00:44
265000 -- (-553.194) (-553.337) (-553.444) [-555.155] * (-551.684) (-557.888) (-558.442) [-553.525] -- 0:00:44
Average standard deviation of split frequencies: 0.015851
265500 -- (-552.357) (-555.647) (-558.966) [-552.404] * (-552.615) [-553.378] (-555.886) (-553.463) -- 0:00:44
266000 -- (-553.170) (-555.014) [-552.291] (-553.236) * (-551.900) (-555.981) [-554.646] (-551.504) -- 0:00:44
266500 -- (-554.857) (-552.467) (-551.965) [-552.887] * (-553.272) [-553.784] (-555.234) (-551.918) -- 0:00:44
267000 -- (-552.173) (-553.263) (-552.126) [-552.050] * (-552.869) (-552.573) (-551.695) [-552.200] -- 0:00:43
267500 -- (-553.875) (-552.324) [-552.593] (-552.056) * (-554.963) (-555.218) (-552.181) [-552.664] -- 0:00:43
268000 -- (-555.079) [-551.785] (-551.663) (-555.479) * (-554.325) (-553.616) (-555.009) [-556.840] -- 0:00:43
268500 -- (-555.140) (-555.674) (-555.841) [-552.696] * (-552.852) (-553.089) (-556.431) [-554.165] -- 0:00:43
269000 -- [-553.953] (-559.360) (-554.279) (-553.096) * (-555.080) (-555.671) (-555.282) [-554.377] -- 0:00:43
269500 -- (-553.658) (-553.015) (-554.370) [-553.556] * (-553.254) [-552.718] (-553.343) (-552.822) -- 0:00:43
270000 -- (-552.954) (-553.805) [-555.670] (-554.297) * (-555.928) [-554.559] (-552.579) (-552.884) -- 0:00:43
Average standard deviation of split frequencies: 0.014610
270500 -- [-552.283] (-552.422) (-552.628) (-553.043) * [-552.670] (-554.519) (-551.875) (-551.429) -- 0:00:45
271000 -- [-554.832] (-553.129) (-553.193) (-554.445) * [-553.019] (-554.122) (-555.851) (-554.193) -- 0:00:45
271500 -- [-553.692] (-552.896) (-554.331) (-560.912) * (-553.102) (-553.338) (-553.132) [-552.883] -- 0:00:45
272000 -- (-554.362) (-553.809) [-555.009] (-554.347) * [-552.602] (-557.393) (-553.018) (-555.813) -- 0:00:45
272500 -- (-555.589) [-553.307] (-555.665) (-560.928) * (-551.862) (-555.744) (-553.697) [-551.882] -- 0:00:45
273000 -- (-555.480) (-554.745) [-553.158] (-558.988) * (-551.942) (-552.365) [-552.065] (-552.157) -- 0:00:45
273500 -- [-555.329] (-553.503) (-556.403) (-555.015) * (-553.805) (-554.687) (-553.817) [-552.167] -- 0:00:45
274000 -- (-552.271) (-552.287) (-554.356) [-553.854] * [-551.714] (-554.255) (-553.647) (-552.635) -- 0:00:45
274500 -- (-554.423) (-553.855) (-553.156) [-551.886] * [-553.012] (-556.305) (-552.505) (-554.393) -- 0:00:44
275000 -- (-552.314) [-554.119] (-553.897) (-553.595) * (-551.694) (-557.327) [-558.345] (-553.749) -- 0:00:44
Average standard deviation of split frequencies: 0.015277
275500 -- (-551.884) [-552.215] (-554.551) (-554.268) * [-553.622] (-552.085) (-552.532) (-552.748) -- 0:00:44
276000 -- (-552.152) (-553.636) [-551.919] (-552.672) * (-553.642) (-557.670) (-552.261) [-554.031] -- 0:00:44
276500 -- (-552.573) (-554.199) (-554.071) [-551.873] * [-552.507] (-552.508) (-554.813) (-556.449) -- 0:00:44
277000 -- (-551.303) [-552.369] (-552.553) (-558.699) * [-552.146] (-552.949) (-553.695) (-552.130) -- 0:00:44
277500 -- (-553.805) [-554.939] (-552.599) (-552.195) * (-553.209) (-554.377) [-554.244] (-554.251) -- 0:00:44
278000 -- (-554.593) (-554.858) [-552.114] (-555.313) * (-552.075) (-561.137) [-551.465] (-553.119) -- 0:00:44
278500 -- (-552.136) (-556.678) (-552.761) [-552.724] * (-553.005) (-554.017) [-555.525] (-552.748) -- 0:00:44
279000 -- (-552.085) [-553.518] (-556.767) (-558.522) * [-552.674] (-552.837) (-552.176) (-557.008) -- 0:00:43
279500 -- [-553.537] (-552.652) (-555.183) (-556.983) * [-555.588] (-552.769) (-556.218) (-554.118) -- 0:00:43
280000 -- (-553.630) (-553.195) [-552.983] (-552.024) * [-552.256] (-553.544) (-552.730) (-554.096) -- 0:00:43
Average standard deviation of split frequencies: 0.016329
280500 -- (-552.223) (-556.643) (-556.003) [-553.207] * (-553.059) (-553.629) [-556.925] (-554.633) -- 0:00:43
281000 -- (-557.235) (-554.813) (-554.421) [-554.683] * (-556.529) [-556.578] (-553.510) (-556.169) -- 0:00:43
281500 -- (-554.887) (-557.342) (-553.144) [-551.509] * (-555.030) [-551.975] (-552.333) (-556.384) -- 0:00:43
282000 -- (-551.676) (-553.053) [-551.694] (-554.934) * (-554.294) [-551.942] (-554.810) (-553.545) -- 0:00:43
282500 -- (-555.442) (-554.446) (-553.066) [-553.386] * (-551.182) [-553.617] (-553.880) (-554.602) -- 0:00:43
283000 -- (-552.380) [-552.786] (-555.786) (-553.778) * (-551.767) [-551.679] (-551.531) (-554.277) -- 0:00:43
283500 -- (-556.628) (-555.540) (-555.182) [-553.110] * (-552.402) (-551.705) [-551.879] (-554.502) -- 0:00:42
284000 -- (-555.581) (-553.582) (-552.388) [-553.723] * (-555.318) (-555.768) [-552.130] (-552.211) -- 0:00:42
284500 -- [-554.744] (-555.268) (-551.306) (-553.854) * [-555.094] (-553.807) (-551.761) (-551.956) -- 0:00:42
285000 -- (-553.873) (-554.813) [-551.458] (-560.924) * (-556.839) [-553.829] (-553.017) (-552.792) -- 0:00:42
Average standard deviation of split frequencies: 0.015292
285500 -- (-551.896) (-554.123) [-555.492] (-553.867) * (-553.287) (-552.593) [-551.696] (-552.512) -- 0:00:42
286000 -- [-551.369] (-558.572) (-553.243) (-555.630) * (-552.618) (-554.576) [-552.155] (-552.622) -- 0:00:42
286500 -- (-552.449) (-558.983) [-552.456] (-551.723) * (-553.245) [-553.399] (-554.684) (-554.317) -- 0:00:42
287000 -- (-552.931) (-553.545) (-553.093) [-552.494] * (-554.454) (-552.459) (-557.288) [-553.251] -- 0:00:42
287500 -- [-552.719] (-553.700) (-551.930) (-553.587) * (-553.179) (-554.953) [-551.544] (-554.032) -- 0:00:42
288000 -- (-552.828) [-553.411] (-552.058) (-552.340) * (-552.801) (-553.973) (-553.557) [-552.147] -- 0:00:44
288500 -- (-557.025) (-553.931) [-553.189] (-552.655) * (-551.574) (-554.683) [-552.467] (-552.709) -- 0:00:44
289000 -- (-552.702) [-554.548] (-552.811) (-551.639) * (-555.090) (-558.125) (-554.765) [-555.603] -- 0:00:44
289500 -- (-553.699) (-554.892) (-556.989) [-551.759] * [-552.537] (-552.771) (-555.914) (-555.601) -- 0:00:44
290000 -- [-554.832] (-551.994) (-557.045) (-552.166) * (-553.712) [-551.841] (-552.925) (-552.640) -- 0:00:44
Average standard deviation of split frequencies: 0.015677
290500 -- (-554.224) (-551.606) (-552.401) [-551.376] * (-555.705) [-551.895] (-554.852) (-552.826) -- 0:00:43
291000 -- (-555.073) [-551.334] (-554.384) (-552.800) * [-552.753] (-553.192) (-552.943) (-556.409) -- 0:00:43
291500 -- (-554.615) [-551.916] (-554.474) (-552.343) * (-554.777) (-552.566) (-552.230) [-556.308] -- 0:00:43
292000 -- [-552.709] (-553.965) (-554.556) (-552.970) * (-552.791) [-552.551] (-555.518) (-554.150) -- 0:00:43
292500 -- (-555.894) (-552.178) [-551.560] (-556.835) * (-553.473) [-553.975] (-555.299) (-552.490) -- 0:00:43
293000 -- (-554.485) (-556.290) (-551.525) [-554.604] * (-555.031) [-554.940] (-553.046) (-551.465) -- 0:00:43
293500 -- [-552.496] (-556.591) (-551.990) (-553.485) * (-556.294) (-555.094) (-557.462) [-555.210] -- 0:00:43
294000 -- (-557.070) [-552.914] (-552.913) (-553.935) * (-554.298) (-553.250) [-554.641] (-552.888) -- 0:00:43
294500 -- (-554.270) (-558.514) [-552.371] (-553.094) * (-554.317) (-552.214) [-554.373] (-556.649) -- 0:00:43
295000 -- [-554.309] (-556.071) (-553.407) (-552.185) * (-555.830) (-554.536) [-556.910] (-555.317) -- 0:00:43
Average standard deviation of split frequencies: 0.015218
295500 -- (-552.890) (-554.208) [-552.933] (-551.937) * [-552.296] (-556.258) (-552.014) (-554.679) -- 0:00:42
296000 -- [-554.577] (-553.478) (-552.771) (-554.536) * (-551.360) (-554.523) (-551.851) [-552.644] -- 0:00:42
296500 -- [-553.610] (-552.968) (-554.803) (-555.857) * (-551.954) [-552.312] (-552.747) (-552.632) -- 0:00:42
297000 -- (-555.362) (-553.760) (-552.754) [-554.998] * (-552.740) (-552.531) [-555.490] (-552.319) -- 0:00:42
297500 -- (-552.263) [-551.324] (-556.387) (-559.533) * (-553.000) (-554.043) [-554.557] (-556.011) -- 0:00:42
298000 -- (-553.440) (-551.311) (-556.452) [-555.166] * (-555.464) (-552.458) (-553.907) [-555.315] -- 0:00:42
298500 -- (-552.775) (-551.311) (-554.866) [-559.705] * (-552.854) (-554.746) [-554.403] (-555.642) -- 0:00:42
299000 -- (-553.172) [-553.601] (-552.032) (-554.774) * (-553.286) [-553.541] (-553.930) (-554.799) -- 0:00:42
299500 -- (-552.516) (-552.782) (-552.050) [-552.878] * (-554.079) (-555.011) [-552.948] (-555.436) -- 0:00:42
300000 -- (-553.179) (-553.051) [-553.757] (-555.868) * (-555.021) (-554.567) (-552.924) [-556.574] -- 0:00:42
Average standard deviation of split frequencies: 0.014849
300500 -- (-553.467) (-556.211) (-553.111) [-555.631] * (-554.125) [-556.762] (-552.252) (-553.309) -- 0:00:41
301000 -- (-553.777) (-554.150) (-554.471) [-552.740] * (-559.409) (-556.299) [-554.352] (-556.613) -- 0:00:41
301500 -- (-556.988) (-554.673) (-555.001) [-552.470] * [-556.096] (-554.081) (-553.823) (-555.131) -- 0:00:41
302000 -- [-553.391] (-554.397) (-554.151) (-556.691) * [-554.230] (-553.004) (-553.196) (-555.211) -- 0:00:41
302500 -- [-553.187] (-554.971) (-560.305) (-553.543) * (-552.677) (-555.018) (-553.516) [-552.482] -- 0:00:41
303000 -- (-552.087) (-554.954) (-556.816) [-558.529] * (-554.451) (-554.333) (-552.068) [-555.541] -- 0:00:41
303500 -- [-554.184] (-555.006) (-554.583) (-554.821) * (-551.556) [-554.959] (-553.380) (-554.746) -- 0:00:41
304000 -- (-552.666) (-554.054) [-553.034] (-553.084) * (-552.401) (-556.401) [-555.734] (-555.316) -- 0:00:41
304500 -- (-552.511) (-554.572) [-553.904] (-552.710) * (-559.086) [-552.947] (-551.683) (-555.522) -- 0:00:41
305000 -- [-553.489] (-553.656) (-553.921) (-553.366) * [-553.579] (-552.042) (-551.511) (-555.658) -- 0:00:43
Average standard deviation of split frequencies: 0.014378
305500 -- (-554.858) (-553.822) [-551.839] (-553.187) * (-553.892) (-553.373) (-553.735) [-553.144] -- 0:00:43
306000 -- (-553.287) (-553.033) (-554.273) [-552.175] * (-553.247) (-554.996) (-554.030) [-556.734] -- 0:00:43
306500 -- (-554.220) (-554.993) (-554.890) [-556.007] * (-554.839) [-552.837] (-555.465) (-551.506) -- 0:00:42
307000 -- (-555.385) (-553.946) (-553.919) [-552.562] * [-552.712] (-552.394) (-553.622) (-553.193) -- 0:00:42
307500 -- [-557.769] (-556.088) (-552.092) (-553.954) * (-555.930) (-555.463) [-554.764] (-552.210) -- 0:00:42
308000 -- (-552.266) [-552.027] (-552.938) (-554.508) * (-553.333) (-552.534) (-555.800) [-552.411] -- 0:00:42
308500 -- (-552.547) (-553.187) (-552.496) [-553.252] * (-552.930) [-553.650] (-554.900) (-553.242) -- 0:00:42
309000 -- (-554.589) (-555.811) (-553.268) [-552.339] * [-552.457] (-551.645) (-561.582) (-556.061) -- 0:00:42
309500 -- [-554.428] (-552.224) (-552.278) (-552.478) * [-552.815] (-553.987) (-561.026) (-552.606) -- 0:00:42
310000 -- (-552.919) (-552.884) (-554.497) [-553.619] * (-553.301) (-555.654) [-554.891] (-557.588) -- 0:00:42
Average standard deviation of split frequencies: 0.014192
310500 -- (-555.196) (-552.697) [-552.144] (-553.286) * [-553.277] (-554.695) (-558.261) (-552.622) -- 0:00:42
311000 -- [-555.014] (-555.487) (-551.232) (-552.640) * (-552.256) (-555.275) [-557.876] (-553.715) -- 0:00:42
311500 -- (-552.702) (-553.318) [-551.621] (-552.321) * (-553.968) (-555.872) [-555.943] (-552.295) -- 0:00:41
312000 -- (-552.091) (-552.306) (-553.147) [-553.479] * [-555.807] (-554.585) (-559.771) (-553.743) -- 0:00:41
312500 -- (-552.853) [-556.294] (-551.735) (-554.242) * [-552.622] (-557.215) (-552.670) (-555.578) -- 0:00:41
313000 -- [-553.405] (-556.748) (-551.487) (-554.547) * (-552.563) (-558.363) [-552.204] (-555.017) -- 0:00:41
313500 -- (-553.210) (-552.633) (-552.512) [-551.904] * (-556.389) [-551.605] (-553.824) (-553.948) -- 0:00:41
314000 -- [-553.002] (-554.053) (-557.738) (-553.743) * (-555.594) (-551.713) [-554.246] (-554.957) -- 0:00:41
314500 -- [-552.944] (-552.682) (-553.639) (-552.999) * (-552.742) (-552.559) (-552.420) [-554.865] -- 0:00:41
315000 -- (-554.316) (-554.773) [-552.675] (-558.222) * (-552.211) [-553.712] (-551.695) (-554.906) -- 0:00:41
Average standard deviation of split frequencies: 0.014586
315500 -- [-552.261] (-552.161) (-551.660) (-552.523) * (-556.344) (-555.950) (-551.936) [-552.212] -- 0:00:41
316000 -- (-554.350) (-553.044) [-554.962] (-555.124) * [-551.975] (-554.899) (-552.749) (-551.778) -- 0:00:41
316500 -- (-554.137) (-552.041) [-557.571] (-556.914) * (-553.329) (-558.016) (-556.613) [-554.564] -- 0:00:41
317000 -- (-552.722) [-551.449] (-556.030) (-555.394) * [-552.684] (-554.419) (-553.564) (-553.093) -- 0:00:40
317500 -- (-555.013) [-552.481] (-554.386) (-557.075) * (-554.128) [-552.852] (-556.137) (-554.990) -- 0:00:40
318000 -- (-552.556) [-551.894] (-553.475) (-552.475) * (-553.825) (-556.911) (-555.437) [-557.942] -- 0:00:40
318500 -- (-554.755) (-552.402) (-553.569) [-552.017] * (-553.324) (-557.301) [-555.714] (-554.550) -- 0:00:40
319000 -- (-552.465) (-554.167) [-552.614] (-551.433) * (-552.953) (-553.569) (-552.196) [-552.450] -- 0:00:40
319500 -- [-553.397] (-555.749) (-551.510) (-555.711) * (-552.437) [-554.169] (-552.712) (-551.485) -- 0:00:40
320000 -- (-555.305) [-554.610] (-551.168) (-551.656) * (-556.142) (-552.315) [-553.090] (-555.269) -- 0:00:40
Average standard deviation of split frequencies: 0.013966
320500 -- [-552.554] (-552.740) (-552.217) (-553.293) * (-552.533) [-552.724] (-552.487) (-553.226) -- 0:00:40
321000 -- (-553.454) (-554.368) (-554.801) [-553.539] * (-553.550) (-559.338) [-555.317] (-556.295) -- 0:00:40
321500 -- (-553.235) (-555.129) [-552.757] (-552.441) * (-555.563) [-552.131] (-555.152) (-560.256) -- 0:00:40
322000 -- (-557.756) [-553.608] (-557.865) (-552.697) * [-552.453] (-552.177) (-555.116) (-556.149) -- 0:00:42
322500 -- (-553.181) [-554.578] (-558.993) (-552.731) * [-553.080] (-553.772) (-551.853) (-554.096) -- 0:00:42
323000 -- [-553.267] (-553.233) (-551.900) (-557.067) * [-551.186] (-555.375) (-553.663) (-554.803) -- 0:00:41
323500 -- (-560.038) (-552.812) [-552.035] (-551.850) * (-559.933) [-557.212] (-553.745) (-554.304) -- 0:00:41
324000 -- (-555.935) [-552.565] (-553.828) (-554.075) * (-555.086) (-552.956) (-554.573) [-554.989] -- 0:00:41
324500 -- (-553.918) (-552.384) (-554.463) [-554.327] * (-552.554) (-555.864) (-556.608) [-552.555] -- 0:00:41
325000 -- [-553.925] (-555.670) (-552.758) (-554.586) * (-554.476) (-552.595) (-553.160) [-551.619] -- 0:00:41
Average standard deviation of split frequencies: 0.014232
325500 -- (-553.144) (-553.710) (-553.110) [-554.582] * (-552.748) [-551.938] (-553.390) (-555.506) -- 0:00:41
326000 -- [-552.147] (-551.623) (-553.844) (-553.625) * (-553.463) (-555.236) [-553.872] (-551.675) -- 0:00:41
326500 -- (-554.865) (-552.740) (-551.771) [-555.361] * (-552.833) (-555.584) [-556.876] (-557.554) -- 0:00:41
327000 -- (-554.227) (-553.970) (-556.660) [-555.194] * [-552.951] (-555.861) (-553.140) (-552.049) -- 0:00:41
327500 -- (-551.815) [-552.431] (-554.542) (-553.042) * [-551.988] (-554.442) (-553.577) (-553.157) -- 0:00:41
328000 -- (-555.027) (-554.171) [-553.698] (-553.623) * [-552.785] (-552.946) (-553.646) (-553.589) -- 0:00:40
328500 -- (-553.035) (-554.838) (-553.772) [-555.570] * (-557.987) (-551.648) [-553.716] (-554.878) -- 0:00:40
329000 -- (-552.133) (-552.635) [-553.132] (-556.453) * (-551.846) [-551.659] (-552.923) (-552.462) -- 0:00:40
329500 -- (-557.068) [-553.260] (-552.351) (-552.352) * [-551.318] (-552.384) (-553.457) (-551.977) -- 0:00:40
330000 -- [-556.268] (-553.346) (-552.306) (-553.939) * [-554.839] (-557.121) (-555.705) (-554.475) -- 0:00:40
Average standard deviation of split frequencies: 0.013506
330500 -- (-552.042) [-553.381] (-551.428) (-554.692) * (-552.277) (-555.230) [-552.840] (-557.467) -- 0:00:40
331000 -- (-552.662) (-551.960) (-552.840) [-554.228] * (-553.088) (-554.191) [-553.684] (-552.465) -- 0:00:40
331500 -- (-552.906) (-555.151) (-553.156) [-556.924] * (-552.446) (-557.690) [-552.395] (-553.685) -- 0:00:40
332000 -- (-554.293) (-552.952) (-554.561) [-554.529] * [-552.684] (-553.883) (-553.472) (-556.313) -- 0:00:40
332500 -- (-552.489) (-555.866) (-553.178) [-551.911] * (-554.071) (-552.829) [-553.148] (-553.271) -- 0:00:40
333000 -- [-552.330] (-554.674) (-553.194) (-553.582) * [-552.957] (-552.044) (-555.543) (-559.626) -- 0:00:40
333500 -- (-553.533) (-552.978) [-552.707] (-552.849) * [-554.161] (-553.105) (-553.251) (-553.123) -- 0:00:39
334000 -- (-553.781) (-552.882) [-551.564] (-552.034) * (-555.147) (-552.213) (-553.125) [-551.602] -- 0:00:39
334500 -- (-551.667) (-554.653) [-552.040] (-552.569) * (-555.252) (-552.480) [-553.544] (-553.171) -- 0:00:39
335000 -- (-555.661) (-553.852) (-554.392) [-555.558] * (-554.253) (-556.363) (-559.154) [-556.037] -- 0:00:39
Average standard deviation of split frequencies: 0.014990
335500 -- [-555.315] (-552.355) (-552.086) (-555.713) * (-553.072) [-552.730] (-552.936) (-552.372) -- 0:00:39
336000 -- (-552.554) (-552.113) [-555.103] (-558.596) * (-556.942) (-556.325) [-560.816] (-554.634) -- 0:00:39
336500 -- (-555.353) (-554.943) [-553.846] (-556.594) * (-552.969) (-553.203) (-557.949) [-554.213] -- 0:00:39
337000 -- (-553.796) [-553.839] (-552.428) (-553.717) * (-556.552) (-551.167) (-556.172) [-552.179] -- 0:00:39
337500 -- (-553.802) (-555.660) [-552.523] (-554.085) * (-553.315) (-554.004) (-552.937) [-551.793] -- 0:00:39
338000 -- (-554.772) (-554.324) [-551.698] (-554.495) * (-552.407) (-558.546) (-554.346) [-551.906] -- 0:00:39
338500 -- (-554.204) (-558.154) [-551.694] (-555.244) * (-553.156) [-555.160] (-552.043) (-551.988) -- 0:00:39
339000 -- (-554.480) [-558.212] (-553.063) (-552.159) * [-551.964] (-554.590) (-556.381) (-552.609) -- 0:00:38
339500 -- (-553.707) (-554.415) (-553.379) [-553.430] * (-554.533) (-555.462) (-555.880) [-555.612] -- 0:00:40
340000 -- (-553.134) (-555.068) (-555.202) [-551.458] * (-562.319) [-553.261] (-556.576) (-555.156) -- 0:00:40
Average standard deviation of split frequencies: 0.014930
340500 -- (-555.766) (-554.201) (-553.510) [-552.155] * (-552.094) (-551.329) [-555.263] (-554.168) -- 0:00:40
341000 -- (-554.711) [-553.451] (-553.749) (-553.133) * (-551.865) [-553.211] (-559.943) (-555.327) -- 0:00:40
341500 -- (-552.074) [-552.027] (-551.708) (-555.138) * [-551.551] (-554.950) (-558.115) (-555.907) -- 0:00:40
342000 -- [-552.464] (-552.117) (-552.963) (-556.235) * (-554.361) (-554.707) [-559.362] (-554.847) -- 0:00:40
342500 -- (-557.925) (-555.400) [-554.120] (-551.776) * (-553.056) (-553.899) (-559.934) [-555.233] -- 0:00:40
343000 -- [-553.751] (-555.840) (-554.091) (-552.447) * (-553.848) (-556.069) (-556.600) [-553.010] -- 0:00:40
343500 -- [-552.076] (-554.916) (-553.155) (-555.005) * (-554.017) [-554.569] (-552.473) (-552.085) -- 0:00:40
344000 -- [-552.860] (-552.368) (-553.052) (-552.392) * [-553.021] (-551.512) (-556.336) (-553.751) -- 0:00:40
344500 -- (-552.654) [-552.417] (-554.966) (-554.483) * (-551.823) [-552.538] (-554.178) (-560.349) -- 0:00:39
345000 -- (-556.195) [-552.385] (-555.590) (-551.765) * (-552.873) (-553.377) [-553.125] (-556.457) -- 0:00:39
Average standard deviation of split frequencies: 0.015489
345500 -- (-551.900) (-553.773) (-552.089) [-552.936] * [-554.432] (-554.217) (-553.503) (-552.526) -- 0:00:39
346000 -- [-551.928] (-557.992) (-551.825) (-556.403) * (-556.214) (-553.680) (-552.357) [-556.617] -- 0:00:39
346500 -- (-552.080) [-558.429] (-553.954) (-553.179) * (-554.831) (-552.943) [-552.859] (-554.830) -- 0:00:39
347000 -- (-554.746) [-551.784] (-556.457) (-555.940) * (-558.408) (-552.944) (-554.487) [-553.864] -- 0:00:39
347500 -- (-552.798) [-553.645] (-556.369) (-552.189) * (-553.828) [-555.429] (-552.173) (-553.246) -- 0:00:39
348000 -- (-553.475) (-553.003) [-552.908] (-553.764) * (-555.408) (-555.070) (-553.264) [-552.443] -- 0:00:39
348500 -- (-552.808) (-552.985) (-553.196) [-551.592] * [-552.383] (-553.077) (-553.899) (-553.101) -- 0:00:39
349000 -- [-553.551] (-554.376) (-552.151) (-555.177) * (-553.521) (-554.549) (-554.788) [-554.295] -- 0:00:39
349500 -- (-552.525) [-553.256] (-554.765) (-553.251) * (-552.994) (-551.499) [-552.105] (-554.968) -- 0:00:39
350000 -- (-555.364) (-556.731) (-555.740) [-552.137] * (-552.284) [-555.829] (-556.249) (-553.244) -- 0:00:39
Average standard deviation of split frequencies: 0.016764
350500 -- [-557.172] (-560.285) (-553.390) (-553.739) * (-552.307) [-551.775] (-552.027) (-555.325) -- 0:00:38
351000 -- (-553.497) [-557.915] (-551.646) (-554.109) * (-551.488) (-551.658) [-553.833] (-553.705) -- 0:00:38
351500 -- [-553.440] (-553.721) (-554.292) (-557.818) * (-553.152) (-552.282) (-552.464) [-552.918] -- 0:00:38
352000 -- (-561.515) (-553.480) (-553.627) [-553.470] * (-551.621) [-553.784] (-554.621) (-552.444) -- 0:00:38
352500 -- (-553.280) (-553.579) (-556.037) [-552.161] * (-551.458) [-552.990] (-556.216) (-553.238) -- 0:00:38
353000 -- (-553.520) (-554.612) [-553.694] (-554.842) * (-551.682) (-554.153) (-552.688) [-551.861] -- 0:00:38
353500 -- [-552.325] (-555.493) (-553.970) (-551.585) * [-552.695] (-552.594) (-553.477) (-553.280) -- 0:00:38
354000 -- [-552.112] (-555.375) (-554.484) (-553.732) * (-553.783) (-552.205) [-557.018] (-555.463) -- 0:00:38
354500 -- (-554.751) (-551.750) [-552.183] (-553.260) * [-555.916] (-554.249) (-554.799) (-554.822) -- 0:00:38
355000 -- (-551.730) [-552.949] (-551.387) (-558.780) * (-553.439) (-553.336) (-555.071) [-556.079] -- 0:00:38
Average standard deviation of split frequencies: 0.016981
355500 -- [-551.965] (-555.028) (-554.530) (-551.969) * (-553.162) (-561.215) (-552.683) [-555.600] -- 0:00:38
356000 -- (-551.945) [-557.163] (-552.089) (-552.906) * (-552.441) (-552.532) (-552.416) [-554.908] -- 0:00:37
356500 -- (-552.110) (-552.375) (-552.348) [-555.531] * (-552.977) (-554.197) [-553.825] (-555.202) -- 0:00:39
357000 -- (-552.629) (-553.990) (-554.712) [-552.757] * (-551.951) (-554.816) (-554.686) [-554.746] -- 0:00:39
357500 -- [-557.724] (-552.680) (-552.501) (-552.958) * [-552.817] (-552.635) (-555.349) (-551.558) -- 0:00:39
358000 -- (-557.205) (-555.337) (-559.275) [-551.921] * (-554.201) (-552.094) (-557.402) [-555.069] -- 0:00:39
358500 -- (-552.534) [-552.804] (-557.880) (-557.546) * (-555.889) [-552.289] (-554.840) (-555.361) -- 0:00:39
359000 -- (-553.172) (-554.534) [-552.787] (-557.529) * (-552.088) (-552.300) [-556.556] (-560.212) -- 0:00:39
359500 -- (-554.812) (-553.915) [-557.179] (-551.950) * [-552.093] (-551.671) (-556.789) (-559.075) -- 0:00:39
360000 -- (-551.967) (-555.933) (-553.676) [-553.270] * [-556.524] (-555.262) (-553.727) (-555.475) -- 0:00:39
Average standard deviation of split frequencies: 0.017376
360500 -- (-554.978) [-553.850] (-552.601) (-552.395) * (-554.072) (-553.363) (-554.431) [-551.176] -- 0:00:39
361000 -- (-554.991) [-555.223] (-555.527) (-553.638) * (-554.669) (-557.565) (-559.660) [-551.646] -- 0:00:38
361500 -- [-553.115] (-554.813) (-557.205) (-555.031) * (-554.211) (-554.079) [-552.515] (-551.510) -- 0:00:38
362000 -- (-553.981) (-551.977) [-551.616] (-552.976) * (-556.236) (-553.625) (-553.013) [-553.006] -- 0:00:38
362500 -- (-553.878) [-552.759] (-554.444) (-555.966) * [-551.215] (-555.566) (-554.365) (-555.182) -- 0:00:38
363000 -- (-553.163) [-553.980] (-555.947) (-552.134) * (-553.962) (-553.729) [-552.831] (-551.506) -- 0:00:38
363500 -- (-553.546) (-556.287) (-553.726) [-552.815] * (-553.277) [-553.334] (-553.061) (-551.534) -- 0:00:38
364000 -- (-552.666) (-552.224) [-553.222] (-557.958) * [-552.775] (-553.706) (-553.601) (-554.662) -- 0:00:38
364500 -- (-552.666) (-553.177) [-552.274] (-552.782) * (-554.605) (-553.253) (-551.603) [-554.003] -- 0:00:38
365000 -- (-552.699) (-554.398) [-552.033] (-553.208) * [-552.357] (-551.804) (-552.378) (-552.660) -- 0:00:38
Average standard deviation of split frequencies: 0.016971
365500 -- [-551.978] (-553.769) (-554.887) (-554.647) * (-553.262) (-553.543) (-553.486) [-551.260] -- 0:00:38
366000 -- (-552.935) (-554.480) (-552.276) [-551.720] * (-553.668) (-555.814) [-555.819] (-554.932) -- 0:00:38
366500 -- (-554.777) [-553.004] (-555.261) (-552.036) * [-556.222] (-553.432) (-561.306) (-556.056) -- 0:00:38
367000 -- (-555.689) (-555.052) (-552.758) [-553.300] * (-552.066) [-553.757] (-554.179) (-553.967) -- 0:00:37
367500 -- (-553.745) [-553.647] (-553.431) (-554.691) * (-553.170) (-556.486) (-552.533) [-552.677] -- 0:00:37
368000 -- (-552.807) [-553.273] (-552.312) (-552.431) * (-554.859) (-554.673) [-555.759] (-554.490) -- 0:00:37
368500 -- (-556.724) [-551.610] (-554.849) (-553.706) * (-552.793) [-555.311] (-552.822) (-553.669) -- 0:00:37
369000 -- (-557.840) (-552.148) (-554.815) [-555.330] * (-556.686) (-552.900) [-554.361] (-553.493) -- 0:00:37
369500 -- [-554.091] (-554.044) (-552.941) (-552.459) * (-554.011) (-553.276) (-555.330) [-559.092] -- 0:00:37
370000 -- (-552.958) [-553.612] (-552.014) (-553.247) * [-553.580] (-554.762) (-553.046) (-554.379) -- 0:00:37
Average standard deviation of split frequencies: 0.016250
370500 -- (-552.399) (-555.822) (-553.659) [-553.036] * (-553.266) (-557.480) [-552.213] (-555.822) -- 0:00:37
371000 -- [-555.013] (-554.432) (-552.312) (-555.110) * (-553.553) (-552.151) (-553.261) [-552.997] -- 0:00:37
371500 -- (-551.990) (-554.126) [-554.584] (-553.806) * (-553.349) [-552.138] (-556.278) (-553.843) -- 0:00:37
372000 -- (-556.806) (-554.789) [-553.214] (-552.225) * (-552.084) (-551.824) (-553.574) [-554.689] -- 0:00:37
372500 -- [-553.300] (-551.567) (-553.380) (-555.413) * (-553.531) (-554.370) (-552.197) [-552.887] -- 0:00:37
373000 -- (-555.736) (-553.084) [-552.581] (-552.876) * (-554.769) (-555.100) [-552.788] (-551.950) -- 0:00:36
373500 -- (-558.029) (-553.523) (-553.053) [-551.944] * (-555.571) (-552.545) (-555.487) [-551.778] -- 0:00:38
374000 -- (-552.376) (-558.964) (-552.147) [-552.557] * [-554.817] (-553.856) (-554.544) (-554.243) -- 0:00:38
374500 -- (-554.697) [-551.339] (-551.816) (-557.493) * (-554.316) (-553.863) (-552.339) [-552.793] -- 0:00:38
375000 -- (-554.255) (-552.673) (-552.140) [-555.120] * [-552.957] (-556.166) (-558.141) (-552.635) -- 0:00:38
Average standard deviation of split frequencies: 0.016508
375500 -- [-551.549] (-551.950) (-555.310) (-554.040) * (-554.032) (-553.614) (-553.491) [-551.858] -- 0:00:38
376000 -- (-551.541) [-551.440] (-553.767) (-554.699) * [-551.637] (-554.281) (-553.564) (-553.772) -- 0:00:38
376500 -- (-553.779) [-552.913] (-552.100) (-552.029) * [-555.945] (-556.360) (-554.643) (-553.819) -- 0:00:38
377000 -- [-554.942] (-552.252) (-554.298) (-553.233) * (-555.024) (-552.507) (-555.421) [-553.518] -- 0:00:38
377500 -- (-557.733) [-556.926] (-553.620) (-557.342) * (-553.843) (-557.531) (-554.035) [-554.250] -- 0:00:37
378000 -- (-554.187) (-553.799) [-552.458] (-556.653) * (-554.373) (-552.119) [-553.258] (-557.253) -- 0:00:37
378500 -- (-555.348) (-556.932) (-554.265) [-554.026] * (-553.410) (-553.809) (-553.565) [-552.647] -- 0:00:37
379000 -- (-554.105) (-556.000) [-553.015] (-552.212) * [-553.374] (-558.267) (-554.474) (-552.412) -- 0:00:37
379500 -- [-556.129] (-554.013) (-552.594) (-551.758) * (-553.454) [-553.759] (-554.839) (-556.888) -- 0:00:37
380000 -- [-551.968] (-554.907) (-556.099) (-553.672) * [-551.815] (-553.253) (-556.288) (-553.764) -- 0:00:37
Average standard deviation of split frequencies: 0.016649
380500 -- (-555.718) (-552.075) (-553.163) [-552.661] * (-553.038) (-552.845) (-554.382) [-556.636] -- 0:00:37
381000 -- (-554.451) (-553.281) (-553.678) [-553.539] * (-552.107) (-556.243) [-555.063] (-557.064) -- 0:00:37
381500 -- [-553.037] (-559.600) (-553.513) (-560.492) * (-552.998) (-552.492) (-557.866) [-554.264] -- 0:00:37
382000 -- [-554.219] (-553.977) (-554.338) (-555.439) * (-553.055) [-552.211] (-553.932) (-557.123) -- 0:00:37
382500 -- (-554.526) [-552.775] (-554.332) (-553.019) * (-553.995) (-553.341) (-556.619) [-553.631] -- 0:00:37
383000 -- [-552.889] (-553.601) (-553.227) (-555.169) * (-553.213) (-553.062) [-552.401] (-551.880) -- 0:00:37
383500 -- (-556.953) (-558.729) [-555.515] (-556.799) * (-553.383) [-553.903] (-559.478) (-556.008) -- 0:00:36
384000 -- (-555.758) (-556.614) (-557.483) [-555.291] * [-552.277] (-554.189) (-555.816) (-555.900) -- 0:00:36
384500 -- (-551.816) (-554.725) (-558.017) [-551.556] * (-555.039) [-553.521] (-556.288) (-552.679) -- 0:00:36
385000 -- (-555.344) (-554.295) (-552.902) [-553.423] * [-552.177] (-552.575) (-551.932) (-552.489) -- 0:00:36
Average standard deviation of split frequencies: 0.016148
385500 -- (-552.998) (-552.080) [-551.385] (-553.421) * (-552.599) (-552.568) (-552.101) [-552.515] -- 0:00:36
386000 -- (-551.465) (-555.244) [-552.816] (-552.582) * (-552.034) (-553.994) [-556.705] (-552.224) -- 0:00:36
386500 -- (-552.173) (-556.923) (-555.197) [-551.153] * (-552.591) (-556.551) [-553.268] (-552.366) -- 0:00:36
387000 -- (-555.402) (-555.373) [-553.952] (-555.420) * (-552.727) (-551.535) [-553.235] (-555.438) -- 0:00:36
387500 -- [-552.551] (-555.888) (-557.437) (-553.333) * (-556.943) (-552.451) [-553.209] (-552.361) -- 0:00:36
388000 -- (-551.977) [-555.447] (-556.013) (-551.922) * (-557.858) (-551.761) (-556.271) [-552.781] -- 0:00:36
388500 -- (-551.713) (-552.848) (-553.182) [-554.243] * (-552.660) (-552.701) (-556.930) [-555.253] -- 0:00:36
389000 -- (-552.341) (-552.066) (-553.079) [-554.266] * (-551.676) [-555.968] (-554.334) (-555.780) -- 0:00:36
389500 -- (-555.192) (-561.645) [-556.714] (-552.722) * (-554.575) (-556.164) [-551.444] (-552.947) -- 0:00:36
390000 -- (-554.969) [-551.747] (-552.302) (-553.540) * (-556.514) (-557.546) (-552.593) [-552.349] -- 0:00:35
Average standard deviation of split frequencies: 0.015821
390500 -- (-552.670) (-553.903) (-551.473) [-552.031] * (-552.356) [-553.606] (-552.143) (-552.337) -- 0:00:35
391000 -- (-556.218) (-552.333) [-551.779] (-557.877) * (-552.450) (-551.700) (-552.580) [-551.367] -- 0:00:37
391500 -- (-553.737) (-554.775) (-554.270) [-554.384] * [-556.259] (-551.846) (-553.994) (-553.126) -- 0:00:37
392000 -- (-553.705) [-552.104] (-553.955) (-552.299) * (-555.270) (-554.792) [-553.129] (-552.472) -- 0:00:37
392500 -- (-556.418) [-552.157] (-552.569) (-555.923) * (-554.821) (-556.336) (-554.616) [-552.552] -- 0:00:37
393000 -- (-559.931) [-552.825] (-553.617) (-552.828) * (-559.044) (-558.647) [-554.036] (-555.170) -- 0:00:37
393500 -- (-554.349) [-551.910] (-555.260) (-554.288) * [-552.138] (-552.790) (-555.129) (-552.107) -- 0:00:36
394000 -- [-553.406] (-553.560) (-554.360) (-558.360) * (-552.834) (-555.573) (-554.185) [-552.402] -- 0:00:36
394500 -- [-552.045] (-555.192) (-553.337) (-553.046) * (-553.631) (-552.648) (-554.880) [-554.075] -- 0:00:36
395000 -- (-558.752) [-554.201] (-557.990) (-552.624) * (-552.457) (-552.757) (-556.938) [-552.770] -- 0:00:36
Average standard deviation of split frequencies: 0.015079
395500 -- (-556.152) [-555.036] (-559.605) (-553.145) * (-551.753) (-552.208) (-555.714) [-555.310] -- 0:00:36
396000 -- [-552.973] (-556.001) (-555.542) (-552.183) * [-552.081] (-554.927) (-553.343) (-552.838) -- 0:00:36
396500 -- (-555.749) (-553.230) (-551.841) [-554.624] * (-553.872) (-553.875) [-554.000] (-559.257) -- 0:00:36
397000 -- (-552.102) (-553.384) (-554.168) [-552.327] * (-552.156) (-556.741) [-557.606] (-557.632) -- 0:00:36
397500 -- (-552.413) [-553.135] (-552.168) (-553.882) * (-553.919) (-555.808) [-553.811] (-553.812) -- 0:00:36
398000 -- (-552.434) [-554.206] (-555.296) (-554.159) * (-553.199) [-555.092] (-551.246) (-552.656) -- 0:00:36
398500 -- [-552.412] (-555.273) (-553.878) (-553.841) * (-557.078) [-555.396] (-551.706) (-552.555) -- 0:00:36
399000 -- (-552.258) (-556.112) [-555.285] (-557.821) * [-552.818] (-552.378) (-552.148) (-552.953) -- 0:00:36
399500 -- (-552.677) (-553.549) (-553.387) [-556.724] * (-555.315) (-553.280) (-551.928) [-554.667] -- 0:00:36
400000 -- (-552.996) (-554.610) [-552.618] (-553.206) * (-554.871) [-551.357] (-553.715) (-554.048) -- 0:00:36
Average standard deviation of split frequencies: 0.015099
400500 -- (-551.713) (-556.117) [-553.664] (-553.409) * (-556.285) (-551.431) (-552.642) [-551.502] -- 0:00:35
401000 -- [-553.065] (-555.677) (-552.870) (-552.318) * [-555.331] (-552.185) (-555.564) (-553.295) -- 0:00:35
401500 -- (-554.169) (-556.403) (-556.434) [-556.201] * (-552.976) (-555.738) (-554.332) [-552.078] -- 0:00:35
402000 -- (-553.430) [-552.199] (-554.506) (-554.354) * [-553.138] (-551.893) (-555.419) (-553.305) -- 0:00:35
402500 -- (-553.818) (-554.863) (-552.223) [-552.530] * (-555.168) (-553.685) (-552.640) [-553.590] -- 0:00:35
403000 -- (-554.006) (-553.513) (-553.550) [-552.465] * [-555.074] (-556.709) (-552.060) (-554.138) -- 0:00:35
403500 -- (-553.007) (-558.188) (-552.675) [-551.537] * (-552.705) [-555.848] (-552.931) (-554.761) -- 0:00:35
404000 -- (-552.623) (-553.365) [-553.235] (-558.337) * (-555.471) [-556.157] (-555.018) (-552.932) -- 0:00:35
404500 -- (-552.462) (-553.450) [-553.651] (-555.600) * (-553.656) (-554.675) [-553.484] (-552.246) -- 0:00:35
405000 -- (-561.391) (-553.354) (-554.723) [-552.200] * (-555.247) (-553.080) (-552.715) [-552.217] -- 0:00:35
Average standard deviation of split frequencies: 0.014127
405500 -- [-551.741] (-553.709) (-554.388) (-551.857) * (-551.666) [-552.549] (-553.137) (-556.973) -- 0:00:35
406000 -- (-553.766) (-552.091) (-553.432) [-553.559] * (-553.339) (-555.697) (-553.701) [-555.992] -- 0:00:35
406500 -- (-553.427) [-552.673] (-551.702) (-553.620) * (-552.789) [-554.175] (-553.842) (-553.587) -- 0:00:35
407000 -- (-556.998) [-554.046] (-553.489) (-553.068) * (-552.297) (-554.591) (-551.692) [-556.234] -- 0:00:34
407500 -- (-557.534) [-555.869] (-557.809) (-553.744) * (-552.482) (-559.451) (-551.917) [-557.131] -- 0:00:34
408000 -- (-551.777) [-551.595] (-553.978) (-553.553) * (-553.928) (-553.973) [-553.393] (-557.453) -- 0:00:36
408500 -- (-555.718) (-553.700) [-555.978] (-551.868) * (-553.307) [-556.142] (-555.573) (-557.252) -- 0:00:36
409000 -- (-552.631) (-553.307) [-553.028] (-554.256) * [-555.963] (-557.503) (-554.349) (-554.385) -- 0:00:36
409500 -- (-551.738) (-552.669) [-552.166] (-553.172) * (-557.218) [-556.226] (-555.347) (-553.091) -- 0:00:36
410000 -- (-552.509) (-551.758) (-552.174) [-551.839] * (-552.597) (-554.719) [-554.643] (-554.171) -- 0:00:35
Average standard deviation of split frequencies: 0.014349
410500 -- (-558.374) (-552.124) [-553.063] (-552.186) * (-553.653) (-555.237) (-554.868) [-552.745] -- 0:00:35
411000 -- (-553.719) (-551.732) (-555.659) [-555.032] * (-554.255) (-555.042) [-552.339] (-551.792) -- 0:00:35
411500 -- (-552.798) [-554.093] (-552.181) (-553.017) * (-554.506) (-554.977) [-552.118] (-554.580) -- 0:00:35
412000 -- [-557.387] (-554.054) (-553.016) (-552.574) * (-556.266) [-552.737] (-556.037) (-552.884) -- 0:00:35
412500 -- (-557.688) (-553.837) [-551.719] (-551.741) * (-558.730) (-552.634) [-554.775] (-556.863) -- 0:00:35
413000 -- (-552.944) (-553.996) [-552.724] (-553.901) * (-553.513) [-551.767] (-552.796) (-553.238) -- 0:00:35
413500 -- (-553.653) (-553.518) (-553.963) [-553.839] * (-558.334) (-552.730) (-560.856) [-553.392] -- 0:00:35
414000 -- (-555.118) (-552.653) [-553.940] (-555.207) * (-552.530) (-555.057) (-557.577) [-552.281] -- 0:00:35
414500 -- (-560.776) [-553.187] (-553.918) (-552.905) * [-554.327] (-551.336) (-554.469) (-558.230) -- 0:00:35
415000 -- (-553.400) (-551.666) (-553.322) [-554.240] * [-551.662] (-552.857) (-553.404) (-555.336) -- 0:00:35
Average standard deviation of split frequencies: 0.013913
415500 -- [-553.129] (-552.635) (-551.619) (-553.348) * (-552.500) (-553.005) [-554.391] (-553.498) -- 0:00:35
416000 -- (-554.290) (-551.940) [-551.676] (-551.561) * (-553.259) (-554.408) [-552.587] (-552.667) -- 0:00:35
416500 -- (-554.936) (-556.064) (-554.927) [-552.190] * [-554.272] (-554.661) (-551.808) (-555.002) -- 0:00:35
417000 -- (-555.300) [-552.420] (-557.183) (-553.984) * (-552.918) (-557.380) [-551.743] (-558.838) -- 0:00:34
417500 -- [-551.795] (-554.260) (-555.604) (-552.295) * (-554.088) (-554.449) [-552.055] (-555.519) -- 0:00:34
418000 -- (-553.355) [-552.821] (-553.907) (-555.460) * (-553.865) (-553.373) [-553.201] (-552.399) -- 0:00:34
418500 -- (-551.509) [-554.740] (-552.711) (-551.309) * [-552.302] (-555.971) (-554.896) (-554.308) -- 0:00:34
419000 -- (-551.782) (-554.940) [-555.011] (-552.948) * (-554.320) (-556.333) [-554.296] (-556.931) -- 0:00:34
419500 -- [-555.112] (-553.249) (-556.741) (-553.173) * (-552.668) (-554.582) (-553.523) [-554.582] -- 0:00:34
420000 -- (-552.045) [-553.670] (-555.046) (-553.495) * (-552.801) [-553.450] (-553.983) (-555.579) -- 0:00:34
Average standard deviation of split frequencies: 0.013198
420500 -- [-551.719] (-555.067) (-552.097) (-553.111) * (-553.396) (-553.749) [-552.512] (-556.604) -- 0:00:34
421000 -- (-553.101) (-555.983) [-553.421] (-551.652) * (-554.672) (-551.276) (-554.703) [-552.988] -- 0:00:34
421500 -- (-553.812) (-552.662) (-553.684) [-553.281] * (-554.238) (-553.389) (-559.453) [-555.603] -- 0:00:34
422000 -- (-555.308) (-551.480) [-553.114] (-555.092) * [-551.586] (-556.201) (-556.440) (-556.494) -- 0:00:34
422500 -- (-552.446) (-553.638) [-553.927] (-557.766) * (-553.441) (-553.550) [-554.130] (-554.967) -- 0:00:34
423000 -- (-552.850) (-551.596) (-554.058) [-552.247] * (-560.173) (-552.313) [-554.282] (-552.000) -- 0:00:34
423500 -- [-553.127] (-556.965) (-556.779) (-557.571) * [-553.474] (-551.848) (-554.224) (-552.047) -- 0:00:34
424000 -- (-558.041) (-553.659) (-552.828) [-554.659] * (-552.445) (-552.989) (-553.238) [-551.840] -- 0:00:33
424500 -- (-553.860) (-554.977) (-553.073) [-554.561] * (-552.208) (-553.568) (-557.435) [-551.464] -- 0:00:33
425000 -- (-554.622) (-554.179) (-553.940) [-553.496] * (-554.722) (-552.682) (-555.019) [-552.048] -- 0:00:35
Average standard deviation of split frequencies: 0.012541
425500 -- (-555.576) [-553.486] (-553.767) (-553.843) * (-552.429) (-552.284) (-552.721) [-551.917] -- 0:00:35
426000 -- [-552.060] (-554.014) (-553.203) (-554.013) * (-553.530) (-556.700) [-552.138] (-555.085) -- 0:00:35
426500 -- [-560.960] (-554.116) (-554.881) (-553.313) * (-553.719) (-554.432) [-552.863] (-554.603) -- 0:00:34
427000 -- [-554.151] (-555.037) (-556.608) (-554.056) * (-551.452) (-552.179) [-552.321] (-553.521) -- 0:00:34
427500 -- [-552.942] (-554.053) (-554.024) (-552.230) * [-555.980] (-553.535) (-553.217) (-552.548) -- 0:00:34
428000 -- [-552.927] (-555.618) (-553.998) (-553.390) * (-554.367) (-556.246) [-551.969] (-553.259) -- 0:00:34
428500 -- (-552.346) (-551.856) (-557.014) [-555.112] * (-555.175) (-554.299) (-552.075) [-552.345] -- 0:00:34
429000 -- (-553.391) [-553.815] (-556.343) (-552.364) * (-552.851) (-551.866) (-552.409) [-553.331] -- 0:00:34
429500 -- (-554.090) (-555.550) [-554.054] (-552.048) * (-553.550) (-552.895) [-551.821] (-553.924) -- 0:00:34
430000 -- (-552.969) (-553.296) [-553.685] (-555.159) * (-553.745) (-552.380) (-552.083) [-553.456] -- 0:00:34
Average standard deviation of split frequencies: 0.011615
430500 -- [-553.097] (-556.018) (-551.510) (-557.438) * (-552.217) (-553.278) (-553.754) [-552.578] -- 0:00:34
431000 -- (-557.938) (-552.753) (-551.660) [-554.713] * (-555.263) [-555.137] (-557.654) (-555.466) -- 0:00:34
431500 -- (-556.658) [-555.638] (-552.810) (-552.346) * (-553.562) [-554.649] (-553.931) (-553.457) -- 0:00:34
432000 -- (-553.516) [-556.192] (-556.782) (-553.601) * [-552.042] (-552.207) (-554.283) (-554.895) -- 0:00:34
432500 -- [-551.229] (-556.769) (-552.314) (-552.819) * (-552.374) (-554.418) [-553.213] (-553.521) -- 0:00:34
433000 -- (-553.602) [-554.152] (-553.925) (-554.751) * (-551.784) (-553.834) [-553.518] (-552.832) -- 0:00:34
433500 -- [-553.199] (-557.892) (-554.889) (-552.488) * [-552.966] (-554.478) (-552.540) (-553.044) -- 0:00:33
434000 -- (-552.393) (-553.337) [-557.090] (-551.651) * (-552.723) (-557.613) [-552.401] (-554.822) -- 0:00:33
434500 -- (-555.303) (-552.116) [-552.484] (-551.651) * (-554.658) [-555.950] (-553.020) (-558.068) -- 0:00:33
435000 -- [-552.736] (-554.455) (-552.605) (-553.445) * (-553.510) (-557.798) [-551.992] (-555.082) -- 0:00:33
Average standard deviation of split frequencies: 0.011593
435500 -- [-552.170] (-560.468) (-553.297) (-552.357) * (-557.946) [-553.252] (-552.281) (-552.662) -- 0:00:33
436000 -- [-553.211] (-551.583) (-552.818) (-551.847) * (-553.788) [-552.945] (-553.307) (-552.088) -- 0:00:33
436500 -- [-554.573] (-551.128) (-552.174) (-552.436) * [-555.169] (-553.205) (-558.533) (-552.276) -- 0:00:33
437000 -- (-554.124) [-554.206] (-553.210) (-552.291) * (-554.656) (-554.942) (-559.080) [-553.309] -- 0:00:33
437500 -- (-556.321) [-552.773] (-553.082) (-554.728) * (-554.598) (-551.902) [-554.585] (-553.612) -- 0:00:33
438000 -- (-552.899) (-552.872) (-552.126) [-551.934] * (-553.081) [-552.986] (-554.274) (-554.238) -- 0:00:33
438500 -- (-552.693) [-554.404] (-560.878) (-552.962) * (-554.080) [-555.382] (-553.493) (-553.076) -- 0:00:33
439000 -- [-554.041] (-558.031) (-556.802) (-557.864) * (-553.575) [-554.481] (-553.386) (-555.087) -- 0:00:33
439500 -- (-557.118) [-553.919] (-555.343) (-554.560) * (-554.668) [-551.702] (-554.443) (-556.646) -- 0:00:33
440000 -- (-555.899) (-555.773) (-553.732) [-552.788] * (-552.942) (-552.117) (-553.704) [-551.421] -- 0:00:33
Average standard deviation of split frequencies: 0.011114
440500 -- (-554.563) [-552.720] (-551.892) (-554.242) * (-552.635) (-551.588) (-554.889) [-551.777] -- 0:00:33
441000 -- (-554.513) [-553.362] (-558.211) (-555.699) * (-557.586) [-553.796] (-551.908) (-553.123) -- 0:00:32
441500 -- [-552.780] (-553.144) (-553.317) (-555.526) * (-553.028) (-554.762) (-552.122) [-551.790] -- 0:00:32
442000 -- [-551.626] (-551.783) (-551.653) (-560.432) * [-553.403] (-554.484) (-553.538) (-554.809) -- 0:00:32
442500 -- (-554.132) (-552.622) [-552.397] (-557.753) * [-552.428] (-558.028) (-551.807) (-555.736) -- 0:00:34
443000 -- (-552.883) (-554.453) (-552.958) [-553.515] * (-554.030) (-552.448) (-552.264) [-553.349] -- 0:00:33
443500 -- [-553.648] (-558.293) (-560.410) (-552.997) * (-552.051) (-552.817) (-553.046) [-552.022] -- 0:00:33
444000 -- (-554.707) (-555.046) (-552.238) [-552.871] * [-555.083] (-556.731) (-553.492) (-552.712) -- 0:00:33
444500 -- (-555.309) (-552.892) [-553.139] (-554.998) * (-554.137) (-555.243) [-554.874] (-554.857) -- 0:00:33
445000 -- (-558.634) [-552.038] (-553.385) (-554.249) * (-553.729) (-553.474) (-553.251) [-553.312] -- 0:00:33
Average standard deviation of split frequencies: 0.010981
445500 -- (-557.435) [-554.093] (-554.533) (-554.249) * (-553.323) (-555.332) [-551.358] (-552.984) -- 0:00:33
446000 -- (-554.575) [-551.716] (-552.545) (-555.283) * (-552.419) (-553.480) [-551.910] (-551.784) -- 0:00:33
446500 -- (-554.466) (-551.231) (-552.976) [-553.230] * [-551.985] (-555.439) (-551.839) (-552.562) -- 0:00:33
447000 -- [-557.073] (-555.015) (-551.258) (-552.850) * (-558.297) (-554.175) [-553.219] (-556.098) -- 0:00:33
447500 -- [-552.259] (-552.572) (-551.914) (-555.954) * (-554.316) [-553.367] (-554.439) (-555.474) -- 0:00:33
448000 -- (-552.108) (-554.132) [-551.857] (-552.872) * (-556.657) (-552.590) (-558.234) [-554.170] -- 0:00:33
448500 -- (-554.816) (-554.984) [-555.463] (-551.693) * (-557.398) (-554.021) [-552.204] (-555.729) -- 0:00:33
449000 -- (-553.762) (-553.419) [-554.099] (-554.871) * (-554.112) (-552.859) (-551.553) [-551.976] -- 0:00:33
449500 -- (-551.818) [-554.716] (-557.217) (-554.876) * [-552.817] (-553.247) (-553.325) (-551.715) -- 0:00:33
450000 -- (-554.285) (-553.349) (-555.985) [-553.176] * (-554.691) (-551.936) (-553.923) [-552.101] -- 0:00:33
Average standard deviation of split frequencies: 0.011390
450500 -- (-553.183) (-551.976) (-554.447) [-552.570] * (-554.108) [-554.211] (-553.344) (-555.100) -- 0:00:32
451000 -- (-557.253) (-555.643) [-552.370] (-552.140) * [-553.000] (-551.238) (-555.496) (-555.851) -- 0:00:32
451500 -- [-551.505] (-557.168) (-552.623) (-551.999) * (-554.798) [-552.371] (-554.906) (-554.542) -- 0:00:32
452000 -- [-552.225] (-552.670) (-554.828) (-552.379) * (-553.395) [-555.646] (-552.660) (-556.242) -- 0:00:32
452500 -- (-552.356) (-551.992) (-554.441) [-552.431] * [-554.397] (-560.462) (-552.982) (-553.581) -- 0:00:32
453000 -- (-555.092) (-552.167) [-553.591] (-554.913) * (-551.571) [-561.266] (-551.965) (-557.292) -- 0:00:32
453500 -- (-552.423) (-552.512) [-553.294] (-555.414) * (-551.597) [-554.643] (-552.870) (-552.457) -- 0:00:32
454000 -- (-555.899) (-556.422) [-554.893] (-555.182) * (-552.948) [-551.722] (-553.449) (-554.627) -- 0:00:32
454500 -- (-555.913) [-558.310] (-552.246) (-553.054) * (-552.909) (-552.946) (-553.076) [-556.040] -- 0:00:32
455000 -- (-552.924) (-551.764) [-553.602] (-552.922) * (-552.357) (-552.667) [-551.974] (-556.213) -- 0:00:32
Average standard deviation of split frequencies: 0.011084
455500 -- (-553.231) (-552.302) [-552.360] (-551.854) * (-551.893) [-552.484] (-551.291) (-555.977) -- 0:00:32
456000 -- [-556.320] (-551.698) (-552.296) (-553.019) * (-554.204) (-553.569) (-551.945) [-552.981] -- 0:00:32
456500 -- (-551.391) [-551.733] (-552.021) (-554.647) * (-552.378) (-556.849) [-551.429] (-552.564) -- 0:00:32
457000 -- [-552.551] (-552.307) (-555.901) (-554.419) * (-553.133) (-555.894) (-554.835) [-552.768] -- 0:00:32
457500 -- (-553.051) (-553.333) (-553.572) [-552.291] * [-552.119] (-556.244) (-555.682) (-553.109) -- 0:00:32
458000 -- (-552.351) (-553.533) (-552.003) [-552.033] * (-553.151) (-559.472) (-555.571) [-553.811] -- 0:00:31
458500 -- (-551.642) (-552.539) [-556.742] (-552.011) * (-552.921) (-559.023) (-552.121) [-551.916] -- 0:00:31
459000 -- (-553.045) (-555.273) (-553.417) [-553.939] * (-553.534) [-555.232] (-552.336) (-552.995) -- 0:00:31
459500 -- [-552.455] (-557.454) (-554.845) (-554.535) * [-554.996] (-554.297) (-558.722) (-553.791) -- 0:00:32
460000 -- (-555.585) (-551.676) (-552.297) [-552.418] * (-557.933) [-552.316] (-555.091) (-551.551) -- 0:00:32
Average standard deviation of split frequencies: 0.011598
460500 -- (-556.244) (-553.698) (-557.739) [-552.236] * (-555.812) (-554.997) (-554.146) [-553.384] -- 0:00:32
461000 -- (-553.871) [-553.681] (-556.260) (-554.566) * (-554.658) (-554.198) [-554.111] (-552.933) -- 0:00:32
461500 -- [-552.565] (-559.946) (-553.290) (-553.088) * (-554.579) (-555.327) (-556.196) [-552.956] -- 0:00:32
462000 -- [-553.051] (-553.293) (-557.036) (-556.018) * (-554.705) (-557.183) (-554.789) [-553.577] -- 0:00:32
462500 -- (-554.987) [-553.636] (-557.578) (-553.298) * (-557.866) (-554.285) [-551.842] (-557.821) -- 0:00:32
463000 -- [-553.719] (-555.236) (-553.133) (-551.941) * (-554.462) [-556.435] (-553.385) (-554.214) -- 0:00:32
463500 -- [-554.076] (-553.877) (-552.902) (-551.581) * (-554.581) [-552.227] (-554.942) (-555.988) -- 0:00:32
464000 -- [-555.960] (-553.894) (-553.072) (-551.437) * (-552.269) [-553.498] (-552.083) (-558.961) -- 0:00:32
464500 -- (-553.836) (-552.331) (-553.596) [-553.063] * (-552.879) (-554.502) [-553.141] (-552.553) -- 0:00:32
465000 -- [-552.287] (-553.459) (-555.708) (-554.197) * (-551.616) [-554.972] (-554.490) (-553.171) -- 0:00:32
Average standard deviation of split frequencies: 0.011971
465500 -- (-553.366) (-551.485) [-552.923] (-553.330) * [-553.320] (-552.418) (-554.057) (-553.422) -- 0:00:32
466000 -- [-551.695] (-552.139) (-555.982) (-551.545) * [-553.682] (-554.729) (-556.715) (-552.706) -- 0:00:32
466500 -- (-553.877) [-552.561] (-553.623) (-554.296) * (-555.470) (-553.411) (-556.819) [-552.384] -- 0:00:32
467000 -- (-557.313) (-554.863) [-552.825] (-553.875) * (-553.811) [-552.647] (-554.873) (-556.328) -- 0:00:31
467500 -- (-555.472) [-552.012] (-556.362) (-553.773) * (-552.726) [-551.489] (-555.365) (-554.488) -- 0:00:31
468000 -- (-551.868) [-555.453] (-552.745) (-552.365) * (-555.256) (-553.876) (-556.898) [-553.364] -- 0:00:31
468500 -- (-553.068) (-552.319) (-551.810) [-552.841] * (-553.054) [-554.447] (-553.608) (-553.660) -- 0:00:31
469000 -- (-556.461) (-554.857) [-551.719] (-553.890) * (-553.308) (-554.020) (-554.873) [-553.987] -- 0:00:31
469500 -- [-554.290] (-553.813) (-552.771) (-556.566) * (-553.865) (-552.883) (-555.099) [-555.353] -- 0:00:31
470000 -- [-553.538] (-552.202) (-551.883) (-552.581) * (-554.047) (-555.042) (-556.252) [-553.585] -- 0:00:31
Average standard deviation of split frequencies: 0.012742
470500 -- [-553.084] (-552.679) (-552.034) (-554.901) * [-554.124] (-555.617) (-552.590) (-553.930) -- 0:00:31
471000 -- [-552.370] (-553.611) (-552.533) (-554.504) * (-554.084) [-551.399] (-556.029) (-554.630) -- 0:00:31
471500 -- (-552.368) (-561.016) (-551.747) [-553.109] * (-553.763) (-557.151) [-558.122] (-553.509) -- 0:00:31
472000 -- [-552.066] (-553.147) (-552.264) (-553.980) * (-552.583) (-554.360) [-553.971] (-554.454) -- 0:00:31
472500 -- (-555.021) (-552.576) (-553.723) [-555.983] * [-556.692] (-552.777) (-557.651) (-552.402) -- 0:00:31
473000 -- (-555.290) (-552.808) (-551.626) [-553.828] * (-556.873) [-553.727] (-554.831) (-556.932) -- 0:00:31
473500 -- (-553.622) (-551.293) (-551.961) [-553.342] * [-557.498] (-552.385) (-554.838) (-554.144) -- 0:00:31
474000 -- [-552.734] (-555.639) (-555.938) (-552.777) * (-552.675) (-553.910) [-554.213] (-553.046) -- 0:00:31
474500 -- (-554.530) (-551.992) (-554.567) [-553.308] * (-558.142) [-552.673] (-553.957) (-552.322) -- 0:00:31
475000 -- (-556.149) (-555.040) [-553.147] (-553.738) * (-556.795) (-552.421) [-553.276] (-553.041) -- 0:00:30
Average standard deviation of split frequencies: 0.012489
475500 -- (-554.340) (-553.235) [-556.074] (-552.141) * (-551.823) (-553.773) (-553.404) [-552.141] -- 0:00:30
476000 -- (-554.943) (-552.659) (-556.669) [-553.639] * (-553.117) (-556.466) [-551.682] (-553.436) -- 0:00:30
476500 -- (-552.375) (-554.403) (-554.248) [-553.960] * (-553.429) [-557.756] (-557.672) (-556.373) -- 0:00:30
477000 -- (-555.411) (-552.165) [-557.041] (-554.007) * (-551.924) (-555.986) (-556.470) [-553.842] -- 0:00:31
477500 -- (-555.358) (-553.438) [-554.623] (-554.081) * [-553.798] (-554.100) (-553.433) (-558.020) -- 0:00:31
478000 -- (-552.993) (-554.714) [-553.461] (-556.200) * [-554.211] (-552.545) (-554.734) (-553.439) -- 0:00:31
478500 -- (-554.074) (-552.863) (-551.964) [-553.779] * (-555.563) (-552.247) [-552.456] (-553.697) -- 0:00:31
479000 -- (-552.427) (-556.319) [-553.973] (-553.721) * [-554.558] (-555.487) (-554.819) (-554.065) -- 0:00:31
479500 -- (-553.554) (-554.134) [-551.390] (-554.056) * (-557.319) [-553.375] (-551.778) (-552.229) -- 0:00:31
480000 -- (-554.413) (-552.668) [-555.403] (-554.495) * (-553.822) [-551.430] (-557.865) (-553.253) -- 0:00:31
Average standard deviation of split frequencies: 0.012230
480500 -- (-558.002) (-555.163) (-555.896) [-552.207] * (-552.850) (-552.852) [-553.679] (-552.502) -- 0:00:31
481000 -- (-553.939) (-553.931) (-553.700) [-558.260] * [-551.676] (-552.975) (-557.061) (-553.632) -- 0:00:31
481500 -- [-554.525] (-554.061) (-553.202) (-556.719) * [-552.151] (-554.449) (-551.299) (-554.000) -- 0:00:31
482000 -- (-552.988) (-555.477) [-554.136] (-555.285) * (-552.951) (-553.274) (-554.337) [-552.884] -- 0:00:31
482500 -- (-552.635) (-553.475) (-554.186) [-553.597] * (-554.028) (-553.709) [-552.893] (-554.749) -- 0:00:31
483000 -- (-553.528) (-554.282) (-554.513) [-552.781] * (-552.077) [-554.697] (-552.698) (-553.608) -- 0:00:31
483500 -- [-552.785] (-555.571) (-554.665) (-552.145) * (-554.897) [-552.145] (-552.638) (-555.100) -- 0:00:30
484000 -- (-553.295) (-553.056) [-553.724] (-551.977) * (-555.596) (-553.789) [-552.610] (-554.747) -- 0:00:30
484500 -- (-551.572) [-552.813] (-552.894) (-553.847) * (-553.411) (-553.724) (-556.683) [-552.620] -- 0:00:30
485000 -- [-551.441] (-554.166) (-552.663) (-555.133) * (-551.569) (-552.515) (-553.538) [-553.612] -- 0:00:30
Average standard deviation of split frequencies: 0.012286
485500 -- (-553.265) (-555.621) [-553.871] (-552.066) * [-551.649] (-551.682) (-552.983) (-553.835) -- 0:00:30
486000 -- (-552.452) (-553.136) [-552.319] (-553.745) * (-555.751) (-552.914) (-551.710) [-551.988] -- 0:00:30
486500 -- [-552.790] (-553.196) (-553.841) (-555.082) * (-552.398) (-553.776) [-553.288] (-552.127) -- 0:00:30
487000 -- (-554.030) [-556.022] (-552.239) (-557.214) * (-552.211) (-554.609) (-560.896) [-556.055] -- 0:00:30
487500 -- (-553.654) (-556.436) (-555.935) [-553.697] * (-552.535) [-553.136] (-556.231) (-553.901) -- 0:00:30
488000 -- (-552.208) (-553.421) [-555.723] (-551.801) * (-552.842) (-552.897) (-556.984) [-553.616] -- 0:00:30
488500 -- (-555.699) [-555.406] (-555.768) (-552.339) * (-552.973) (-552.626) [-551.148] (-553.877) -- 0:00:30
489000 -- (-555.072) [-555.713] (-562.488) (-554.284) * (-552.200) (-552.393) [-553.377] (-551.762) -- 0:00:30
489500 -- (-552.890) (-551.396) (-553.983) [-552.262] * (-553.604) [-553.965] (-552.423) (-552.502) -- 0:00:30
490000 -- (-552.890) [-553.214] (-552.038) (-552.761) * (-555.826) (-552.599) (-551.537) [-551.456] -- 0:00:30
Average standard deviation of split frequencies: 0.011849
490500 -- [-558.354] (-553.480) (-552.070) (-554.903) * [-553.577] (-556.406) (-552.432) (-560.081) -- 0:00:30
491000 -- (-556.201) (-553.771) (-553.812) [-554.500] * (-553.737) (-554.336) [-552.405] (-555.166) -- 0:00:30
491500 -- (-555.684) [-553.342] (-555.034) (-551.758) * [-551.885] (-552.363) (-551.469) (-554.108) -- 0:00:30
492000 -- (-554.652) (-555.095) (-552.244) [-557.827] * (-553.346) [-552.122] (-554.209) (-552.680) -- 0:00:29
492500 -- (-552.622) [-553.162] (-551.785) (-553.784) * (-552.803) (-552.844) [-554.471] (-552.724) -- 0:00:29
493000 -- (-552.757) (-551.591) [-553.895] (-554.013) * [-553.766] (-551.758) (-553.833) (-553.316) -- 0:00:29
493500 -- (-556.075) [-553.990] (-553.550) (-553.191) * (-555.961) (-555.829) [-556.295] (-551.443) -- 0:00:29
494000 -- (-553.708) (-554.156) (-554.505) [-552.473] * (-556.747) [-557.054] (-552.840) (-553.334) -- 0:00:30
494500 -- (-555.119) [-552.593] (-553.704) (-557.023) * (-556.508) [-553.388] (-552.393) (-556.243) -- 0:00:30
495000 -- (-553.597) [-551.472] (-552.670) (-554.895) * [-552.841] (-554.114) (-552.301) (-551.849) -- 0:00:30
Average standard deviation of split frequencies: 0.012411
495500 -- (-552.635) [-552.542] (-552.794) (-555.079) * (-555.275) (-551.856) (-554.085) [-552.051] -- 0:00:30
496000 -- [-555.614] (-554.077) (-556.941) (-554.238) * (-556.249) (-555.054) [-551.901] (-551.932) -- 0:00:30
496500 -- (-553.893) [-555.020] (-556.588) (-554.719) * [-551.649] (-555.265) (-556.018) (-551.970) -- 0:00:30
497000 -- (-552.788) [-553.200] (-552.765) (-554.020) * (-551.869) [-553.610] (-557.338) (-553.213) -- 0:00:30
497500 -- (-555.446) [-553.748] (-553.632) (-556.849) * (-554.548) (-553.281) [-552.598] (-554.563) -- 0:00:30
498000 -- (-555.677) (-553.105) (-556.133) [-551.348] * [-554.046] (-558.191) (-554.107) (-553.120) -- 0:00:30
498500 -- (-556.256) (-552.833) (-557.205) [-553.148] * (-554.789) (-554.706) (-554.160) [-555.696] -- 0:00:30
499000 -- (-555.122) (-553.767) (-554.242) [-555.326] * [-553.380] (-552.147) (-552.241) (-556.285) -- 0:00:30
499500 -- (-553.973) (-557.571) [-552.990] (-552.637) * (-552.276) (-556.203) (-553.366) [-553.365] -- 0:00:30
500000 -- [-552.312] (-553.647) (-551.945) (-553.347) * [-554.032] (-552.916) (-551.489) (-554.705) -- 0:00:30
Average standard deviation of split frequencies: 0.012240
500500 -- (-552.076) (-553.048) [-553.702] (-552.914) * [-554.633] (-552.907) (-552.470) (-552.774) -- 0:00:29
501000 -- (-552.351) (-553.363) [-553.151] (-552.781) * [-551.781] (-551.618) (-552.312) (-551.780) -- 0:00:29
501500 -- (-552.409) (-554.212) [-552.568] (-555.096) * [-553.580] (-554.647) (-552.118) (-554.942) -- 0:00:29
502000 -- (-551.605) [-553.040] (-551.610) (-553.406) * (-551.933) [-554.039] (-552.782) (-553.763) -- 0:00:29
502500 -- (-556.222) (-552.714) (-558.743) [-554.827] * [-553.102] (-555.533) (-555.065) (-555.574) -- 0:00:29
503000 -- (-553.795) [-552.629] (-555.225) (-556.328) * [-557.603] (-552.970) (-553.427) (-554.905) -- 0:00:29
503500 -- [-553.049] (-553.451) (-556.197) (-552.615) * (-553.856) (-553.151) [-552.783] (-553.621) -- 0:00:29
504000 -- (-552.971) (-552.675) (-556.011) [-557.976] * (-552.923) (-554.617) (-553.256) [-552.348] -- 0:00:29
504500 -- (-553.626) (-553.212) [-553.201] (-554.575) * (-552.714) (-551.977) (-554.417) [-553.133] -- 0:00:29
505000 -- [-551.333] (-553.133) (-554.700) (-554.653) * [-552.934] (-554.768) (-551.941) (-553.572) -- 0:00:29
Average standard deviation of split frequencies: 0.012525
505500 -- (-551.925) (-553.830) (-551.943) [-553.064] * (-553.193) (-551.921) (-553.059) [-553.023] -- 0:00:29
506000 -- (-554.045) [-551.616] (-554.505) (-552.696) * (-560.929) (-552.560) [-553.090] (-558.422) -- 0:00:29
506500 -- [-552.832] (-555.141) (-553.340) (-557.013) * (-556.426) (-552.047) [-552.271] (-551.823) -- 0:00:29
507000 -- (-556.152) (-554.058) [-553.287] (-553.564) * (-555.421) [-552.600] (-553.206) (-552.437) -- 0:00:29
507500 -- (-557.073) [-552.194] (-553.445) (-551.356) * (-555.264) [-552.986] (-554.498) (-552.826) -- 0:00:29
508000 -- [-554.484] (-555.702) (-552.440) (-554.699) * (-553.534) (-554.522) (-554.529) [-553.081] -- 0:00:29
508500 -- [-553.068] (-555.981) (-553.922) (-551.571) * (-554.202) [-554.687] (-555.442) (-553.814) -- 0:00:28
509000 -- [-553.394] (-553.111) (-556.133) (-551.757) * (-556.230) (-551.989) (-556.703) [-552.526] -- 0:00:28
509500 -- (-552.963) [-552.562] (-554.958) (-554.414) * (-554.012) (-551.858) [-553.440] (-553.325) -- 0:00:28
510000 -- (-552.649) (-552.533) [-551.512] (-557.579) * (-551.625) (-553.991) (-556.190) [-553.474] -- 0:00:28
Average standard deviation of split frequencies: 0.012770
510500 -- (-552.519) [-552.526] (-555.840) (-552.829) * [-552.064] (-558.385) (-551.628) (-552.312) -- 0:00:28
511000 -- (-554.799) [-551.793] (-557.609) (-553.234) * (-553.721) (-551.651) [-553.326] (-552.053) -- 0:00:28
511500 -- (-557.203) [-556.339] (-556.555) (-553.934) * (-551.732) (-559.103) [-554.785] (-552.948) -- 0:00:29
512000 -- [-558.391] (-555.664) (-553.958) (-554.285) * (-552.423) [-553.694] (-552.548) (-557.887) -- 0:00:29
512500 -- (-554.667) (-554.733) (-553.952) [-554.544] * [-551.743] (-552.330) (-552.862) (-555.840) -- 0:00:29
513000 -- (-551.225) [-552.882] (-556.860) (-556.698) * (-553.963) (-552.596) (-555.531) [-552.139] -- 0:00:29
513500 -- (-551.639) (-552.219) (-560.992) [-552.034] * [-554.097] (-555.473) (-553.656) (-552.510) -- 0:00:29
514000 -- (-552.020) (-551.918) (-551.969) [-551.560] * [-556.485] (-555.149) (-554.202) (-552.329) -- 0:00:29
514500 -- (-552.528) [-552.404] (-557.523) (-552.190) * (-553.252) [-553.240] (-558.039) (-556.622) -- 0:00:29
515000 -- [-551.844] (-552.174) (-554.200) (-551.808) * (-552.121) (-555.233) [-554.215] (-556.940) -- 0:00:29
Average standard deviation of split frequencies: 0.012841
515500 -- (-551.721) (-553.916) (-552.798) [-551.863] * (-555.051) (-552.397) [-555.074] (-556.119) -- 0:00:29
516000 -- (-551.659) (-552.930) [-556.070] (-551.667) * (-556.299) [-554.342] (-551.845) (-552.607) -- 0:00:29
516500 -- [-553.173] (-555.569) (-556.141) (-552.941) * [-551.676] (-554.327) (-553.564) (-553.106) -- 0:00:29
517000 -- (-552.636) [-556.735] (-555.254) (-553.224) * (-552.317) (-555.350) (-556.016) [-551.905] -- 0:00:28
517500 -- (-554.136) [-555.035] (-558.287) (-555.332) * [-551.347] (-555.057) (-554.551) (-553.173) -- 0:00:28
518000 -- (-555.561) [-553.580] (-551.450) (-551.866) * [-552.244] (-558.025) (-552.345) (-554.496) -- 0:00:28
518500 -- (-557.082) (-552.124) (-553.357) [-554.476] * [-553.088] (-555.591) (-551.690) (-554.242) -- 0:00:28
519000 -- (-557.527) [-552.203] (-554.966) (-553.882) * (-553.089) [-555.218] (-558.535) (-554.493) -- 0:00:28
519500 -- (-553.764) (-552.779) [-554.322] (-552.805) * (-554.357) (-552.447) (-555.077) [-551.898] -- 0:00:28
520000 -- (-552.631) (-552.771) (-553.211) [-551.460] * (-553.393) (-552.456) (-552.651) [-551.880] -- 0:00:28
Average standard deviation of split frequencies: 0.012877
520500 -- (-552.795) (-555.168) [-552.629] (-554.725) * [-552.736] (-554.198) (-552.729) (-553.480) -- 0:00:28
521000 -- (-553.513) [-554.970] (-554.751) (-557.452) * [-552.839] (-559.007) (-555.883) (-553.843) -- 0:00:28
521500 -- (-555.216) (-559.420) [-553.813] (-551.631) * (-552.701) [-557.377] (-555.287) (-556.074) -- 0:00:28
522000 -- [-555.269] (-553.078) (-553.754) (-551.742) * (-553.094) (-560.283) [-554.310] (-561.539) -- 0:00:28
522500 -- (-553.092) (-552.633) [-552.981] (-552.212) * (-553.587) (-556.567) (-551.707) [-551.568] -- 0:00:28
523000 -- (-553.436) (-554.217) (-553.482) [-556.032] * [-552.193] (-556.493) (-553.228) (-554.291) -- 0:00:28
523500 -- (-555.640) (-554.826) [-552.102] (-554.380) * (-551.833) [-554.646] (-553.280) (-553.195) -- 0:00:28
524000 -- [-554.298] (-554.362) (-553.151) (-553.160) * [-554.660] (-552.835) (-552.294) (-554.875) -- 0:00:28
524500 -- (-555.351) [-553.837] (-553.357) (-552.354) * (-554.505) [-552.041] (-552.935) (-553.193) -- 0:00:28
525000 -- (-553.311) (-552.337) [-552.210] (-552.111) * (-555.031) (-552.662) [-552.755] (-552.269) -- 0:00:28
Average standard deviation of split frequencies: 0.012494
525500 -- (-553.718) [-551.762] (-552.494) (-551.340) * (-556.336) (-552.499) (-554.749) [-551.394] -- 0:00:27
526000 -- (-554.298) [-553.017] (-552.122) (-551.673) * (-556.308) [-552.409] (-553.197) (-552.425) -- 0:00:27
526500 -- [-553.272] (-556.639) (-555.821) (-552.024) * (-552.400) (-553.476) (-554.383) [-552.804] -- 0:00:27
527000 -- (-554.488) (-551.590) (-553.424) [-552.468] * (-552.922) (-554.067) [-554.252] (-553.521) -- 0:00:27
527500 -- (-555.492) (-557.493) (-556.623) [-552.771] * (-553.620) (-552.426) [-553.282] (-553.200) -- 0:00:27
528000 -- [-556.022] (-554.298) (-553.399) (-552.051) * (-554.316) [-552.570] (-553.112) (-551.337) -- 0:00:27
528500 -- (-552.086) [-553.592] (-554.281) (-551.995) * (-552.532) (-553.891) (-552.001) [-553.922] -- 0:00:28
529000 -- (-555.996) [-554.950] (-552.152) (-553.789) * (-555.444) (-553.512) (-554.470) [-554.099] -- 0:00:28
529500 -- (-555.409) [-554.700] (-551.914) (-555.275) * (-555.232) (-554.121) (-552.785) [-555.151] -- 0:00:28
530000 -- (-553.227) (-551.944) [-554.809] (-554.477) * [-551.808] (-554.147) (-556.893) (-553.163) -- 0:00:28
Average standard deviation of split frequencies: 0.012541
530500 -- (-553.606) (-555.304) (-555.542) [-552.268] * [-551.371] (-553.623) (-552.578) (-552.480) -- 0:00:28
531000 -- (-553.889) [-552.262] (-556.083) (-554.107) * [-557.118] (-551.866) (-552.685) (-556.246) -- 0:00:28
531500 -- (-554.041) [-553.807] (-557.005) (-553.396) * [-552.538] (-556.308) (-555.914) (-552.818) -- 0:00:28
532000 -- (-554.986) (-553.355) [-556.914] (-552.912) * (-552.555) (-554.800) (-553.023) [-553.809] -- 0:00:28
532500 -- (-552.419) (-555.098) (-554.761) [-553.030] * (-551.679) (-554.287) [-552.532] (-556.251) -- 0:00:28
533000 -- (-555.896) (-553.610) (-554.628) [-552.369] * (-552.083) [-553.316] (-557.029) (-552.601) -- 0:00:28
533500 -- (-559.243) [-553.295] (-554.716) (-554.684) * (-557.537) [-554.418] (-553.006) (-554.338) -- 0:00:27
534000 -- (-561.618) (-554.045) [-553.674] (-552.309) * (-554.381) [-553.495] (-553.995) (-555.607) -- 0:00:27
534500 -- [-555.082] (-553.224) (-555.776) (-551.975) * (-553.080) [-557.714] (-552.218) (-557.451) -- 0:00:27
535000 -- [-552.136] (-553.220) (-552.572) (-552.648) * (-552.228) (-552.142) [-551.824] (-552.022) -- 0:00:27
Average standard deviation of split frequencies: 0.012158
535500 -- [-552.549] (-555.369) (-552.879) (-555.117) * [-552.401] (-554.613) (-553.601) (-552.813) -- 0:00:27
536000 -- (-554.345) [-554.004] (-553.655) (-556.222) * (-552.935) [-554.842] (-557.521) (-552.079) -- 0:00:27
536500 -- (-552.579) (-553.593) (-554.604) [-552.136] * (-552.601) (-553.030) (-555.574) [-552.089] -- 0:00:27
537000 -- (-552.794) (-553.244) [-552.559] (-553.466) * [-553.604] (-553.239) (-553.422) (-552.089) -- 0:00:27
537500 -- [-551.806] (-554.078) (-554.121) (-552.530) * (-553.839) (-551.920) [-555.591] (-551.662) -- 0:00:27
538000 -- (-552.843) (-553.424) [-553.703] (-556.144) * (-552.979) (-554.459) (-554.467) [-553.587] -- 0:00:27
538500 -- (-552.733) (-554.505) [-555.093] (-554.434) * [-553.058] (-552.780) (-554.898) (-554.505) -- 0:00:27
539000 -- [-551.612] (-554.161) (-552.347) (-552.962) * (-556.391) (-551.724) [-554.934] (-554.030) -- 0:00:27
539500 -- (-552.015) (-553.537) (-552.723) [-551.422] * (-554.137) [-552.309] (-553.317) (-557.222) -- 0:00:27
540000 -- (-557.211) (-554.396) (-555.382) [-556.186] * (-552.619) (-552.062) (-553.407) [-552.194] -- 0:00:27
Average standard deviation of split frequencies: 0.012207
540500 -- (-556.364) (-554.848) (-553.997) [-552.741] * [-552.468] (-553.897) (-553.827) (-553.065) -- 0:00:27
541000 -- [-552.455] (-553.367) (-553.143) (-551.297) * (-555.465) (-551.659) [-553.341] (-551.624) -- 0:00:27
541500 -- [-554.360] (-554.465) (-554.988) (-555.834) * [-553.765] (-553.889) (-553.671) (-551.705) -- 0:00:27
542000 -- [-554.628] (-554.526) (-554.494) (-551.557) * [-553.464] (-553.061) (-555.413) (-554.361) -- 0:00:27
542500 -- (-556.535) [-553.161] (-554.423) (-551.723) * [-553.043] (-551.709) (-554.280) (-553.196) -- 0:00:26
543000 -- (-556.284) [-553.668] (-552.545) (-552.218) * (-553.343) (-555.589) (-554.301) [-554.084] -- 0:00:26
543500 -- (-553.887) (-551.489) (-552.430) [-556.971] * [-553.281] (-554.262) (-556.510) (-554.470) -- 0:00:26
544000 -- (-553.798) (-551.943) [-551.418] (-555.219) * [-554.696] (-557.885) (-553.770) (-555.498) -- 0:00:26
544500 -- (-552.705) (-553.659) [-552.521] (-555.126) * (-555.974) (-554.673) (-554.896) [-552.054] -- 0:00:26
545000 -- (-553.626) (-554.664) [-552.788] (-554.872) * (-558.363) (-558.154) [-552.143] (-555.209) -- 0:00:26
Average standard deviation of split frequencies: 0.012189
545500 -- (-551.780) [-552.315] (-552.927) (-555.113) * (-555.158) [-552.347] (-551.453) (-553.005) -- 0:00:27
546000 -- (-554.464) (-551.962) (-553.357) [-553.022] * (-551.938) [-555.734] (-551.647) (-559.412) -- 0:00:27
546500 -- [-554.094] (-552.086) (-554.360) (-552.854) * (-554.040) (-555.924) (-552.634) [-554.544] -- 0:00:27
547000 -- (-556.669) [-551.603] (-552.521) (-553.469) * (-553.528) [-551.908] (-552.335) (-555.780) -- 0:00:27
547500 -- (-554.034) (-554.185) (-555.047) [-553.459] * (-552.035) (-553.574) [-552.410] (-553.721) -- 0:00:27
548000 -- (-552.222) [-555.254] (-553.115) (-558.020) * (-553.617) (-553.173) [-552.559] (-552.453) -- 0:00:27
548500 -- [-551.677] (-556.317) (-552.995) (-553.043) * (-551.716) (-556.158) [-552.313] (-554.124) -- 0:00:27
549000 -- (-553.061) (-553.540) (-552.257) [-552.326] * (-552.351) (-552.553) [-555.244] (-554.448) -- 0:00:27
549500 -- (-557.517) [-553.736] (-552.291) (-554.319) * [-552.925] (-553.828) (-555.609) (-555.768) -- 0:00:27
550000 -- (-553.593) (-551.770) (-551.942) [-552.889] * (-554.523) (-551.220) [-553.170] (-554.822) -- 0:00:27
Average standard deviation of split frequencies: 0.013042
550500 -- (-553.453) [-551.912] (-553.054) (-552.274) * (-555.234) [-553.416] (-555.169) (-552.861) -- 0:00:26
551000 -- (-557.957) (-552.417) (-553.398) [-552.003] * (-556.706) [-552.447] (-558.053) (-552.596) -- 0:00:26
551500 -- [-554.840] (-553.730) (-553.856) (-553.431) * [-554.437] (-554.205) (-554.964) (-554.744) -- 0:00:26
552000 -- (-557.487) (-554.914) [-554.110] (-553.395) * [-555.973] (-551.305) (-554.414) (-556.733) -- 0:00:26
552500 -- (-552.157) (-553.567) [-552.465] (-553.697) * [-555.808] (-551.236) (-553.743) (-551.724) -- 0:00:26
553000 -- (-552.417) (-552.907) [-552.826] (-560.801) * (-553.662) (-554.831) (-552.130) [-553.957] -- 0:00:26
553500 -- (-554.553) (-552.106) (-557.679) [-552.273] * (-558.475) [-552.648] (-553.359) (-552.976) -- 0:00:26
554000 -- [-552.440] (-554.617) (-553.390) (-552.684) * (-553.290) (-557.752) (-558.323) [-552.438] -- 0:00:26
554500 -- (-555.750) (-552.981) (-552.153) [-553.992] * (-554.944) (-552.122) (-554.754) [-551.924] -- 0:00:26
555000 -- (-552.351) [-552.711] (-553.315) (-552.883) * (-552.199) [-552.365] (-551.647) (-553.164) -- 0:00:26
Average standard deviation of split frequencies: 0.013216
555500 -- (-552.595) (-560.674) [-551.669] (-551.491) * (-554.747) [-551.733] (-552.631) (-552.376) -- 0:00:26
556000 -- (-553.323) [-553.262] (-552.248) (-552.761) * (-555.545) (-553.351) [-552.034] (-552.974) -- 0:00:26
556500 -- (-559.552) (-559.317) [-551.631] (-556.521) * (-557.704) (-552.628) (-553.478) [-553.790] -- 0:00:26
557000 -- [-557.483] (-553.335) (-554.845) (-555.774) * [-553.485] (-553.765) (-553.689) (-556.375) -- 0:00:26
557500 -- (-560.426) [-552.753] (-552.801) (-555.671) * (-554.119) (-553.099) [-552.885] (-556.977) -- 0:00:26
558000 -- (-557.241) [-552.427] (-557.769) (-557.746) * (-553.177) [-552.183] (-553.553) (-553.847) -- 0:00:26
558500 -- (-558.085) (-554.730) (-551.847) [-555.284] * [-554.493] (-551.791) (-556.131) (-553.715) -- 0:00:26
559000 -- (-552.497) (-560.664) [-552.899] (-555.071) * (-552.481) [-553.552] (-551.631) (-557.162) -- 0:00:26
559500 -- (-553.879) (-555.320) (-554.097) [-552.501] * [-553.521] (-554.541) (-552.475) (-555.417) -- 0:00:25
560000 -- [-551.796] (-554.308) (-554.705) (-557.352) * [-558.101] (-555.991) (-559.148) (-551.771) -- 0:00:25
Average standard deviation of split frequencies: 0.012661
560500 -- (-552.249) (-551.834) (-555.355) [-553.525] * (-555.065) [-553.795] (-563.393) (-553.813) -- 0:00:25
561000 -- [-552.750] (-552.579) (-554.877) (-553.601) * (-559.121) [-552.953] (-554.548) (-552.169) -- 0:00:25
561500 -- (-553.076) [-551.646] (-555.265) (-553.971) * (-556.077) (-556.856) [-554.349] (-553.925) -- 0:00:25
562000 -- (-553.005) (-552.064) [-551.555] (-555.957) * [-555.766] (-554.562) (-554.537) (-553.829) -- 0:00:25
562500 -- [-554.317] (-555.760) (-552.973) (-552.786) * (-560.656) (-555.504) [-552.136] (-553.950) -- 0:00:26
563000 -- (-555.601) (-554.780) [-552.452] (-553.080) * (-554.231) [-553.650] (-552.921) (-553.385) -- 0:00:26
563500 -- [-557.289] (-551.925) (-552.568) (-560.702) * [-555.654] (-554.197) (-554.147) (-557.676) -- 0:00:26
564000 -- (-554.682) (-557.844) [-552.486] (-554.301) * (-552.703) [-554.458] (-553.423) (-552.992) -- 0:00:26
564500 -- (-553.078) [-553.343] (-553.747) (-552.437) * [-552.131] (-552.836) (-554.877) (-551.836) -- 0:00:26
565000 -- (-553.887) (-558.519) [-551.918] (-552.518) * (-554.594) (-551.786) (-552.189) [-551.802] -- 0:00:26
Average standard deviation of split frequencies: 0.011905
565500 -- (-552.836) (-555.923) [-552.068] (-552.697) * (-553.745) [-552.133] (-557.868) (-552.453) -- 0:00:26
566000 -- (-554.132) (-554.055) [-552.548] (-554.406) * [-552.224] (-552.780) (-551.692) (-552.561) -- 0:00:26
566500 -- (-552.573) [-555.971] (-553.481) (-554.327) * (-552.776) (-552.548) (-551.616) [-552.214] -- 0:00:26
567000 -- [-556.088] (-553.902) (-552.397) (-554.265) * (-552.110) [-552.149] (-555.424) (-552.158) -- 0:00:25
567500 -- [-552.324] (-553.860) (-553.264) (-556.002) * (-552.517) (-557.218) [-554.416] (-552.631) -- 0:00:25
568000 -- (-555.007) [-553.409] (-555.287) (-552.893) * (-557.941) [-555.006] (-551.738) (-552.910) -- 0:00:25
568500 -- (-556.171) [-555.223] (-552.430) (-551.765) * [-554.541] (-553.776) (-552.127) (-553.871) -- 0:00:25
569000 -- (-556.821) (-551.935) [-554.224] (-553.596) * (-554.976) [-551.712] (-551.273) (-554.722) -- 0:00:25
569500 -- (-553.279) (-552.893) (-553.116) [-556.378] * (-560.579) (-552.839) [-552.711] (-554.481) -- 0:00:25
570000 -- (-552.384) (-552.791) [-552.584] (-553.734) * (-554.087) (-558.086) [-551.616] (-554.040) -- 0:00:25
Average standard deviation of split frequencies: 0.012585
570500 -- (-553.530) [-552.801] (-554.824) (-553.492) * (-555.182) (-558.412) [-553.887] (-554.364) -- 0:00:25
571000 -- (-554.328) (-553.536) (-562.870) [-554.146] * (-551.491) (-555.917) [-554.822] (-553.477) -- 0:00:25
571500 -- (-553.978) (-552.939) [-551.794] (-559.409) * (-551.445) (-552.588) [-551.861] (-553.225) -- 0:00:25
572000 -- [-553.437] (-551.542) (-552.736) (-558.484) * [-552.659] (-553.303) (-559.517) (-554.415) -- 0:00:25
572500 -- [-552.514] (-555.855) (-553.053) (-552.224) * (-557.145) (-555.475) (-558.232) [-551.598] -- 0:00:25
573000 -- (-553.003) [-553.913] (-552.628) (-558.357) * (-553.895) (-554.013) [-553.228] (-551.686) -- 0:00:25
573500 -- (-552.957) (-552.478) [-557.527] (-552.029) * (-561.105) (-555.486) [-556.120] (-554.727) -- 0:00:25
574000 -- (-556.801) (-553.206) [-554.147] (-554.901) * (-554.753) (-552.201) [-552.198] (-555.780) -- 0:00:25
574500 -- (-552.985) [-553.154] (-555.667) (-553.928) * (-553.702) (-555.235) [-553.506] (-556.050) -- 0:00:25
575000 -- (-552.365) (-554.314) [-554.181] (-553.687) * (-552.138) [-556.401] (-555.546) (-553.822) -- 0:00:25
Average standard deviation of split frequencies: 0.012613
575500 -- (-553.797) [-552.907] (-553.130) (-552.892) * (-552.829) [-553.952] (-555.096) (-553.874) -- 0:00:25
576000 -- [-556.837] (-557.018) (-552.976) (-553.299) * (-553.689) (-553.152) (-553.975) [-552.298] -- 0:00:25
576500 -- (-554.488) [-551.529] (-553.577) (-552.982) * [-555.136] (-552.255) (-553.622) (-554.366) -- 0:00:24
577000 -- (-553.531) [-553.619] (-555.765) (-552.189) * (-552.351) (-555.184) (-553.721) [-557.478] -- 0:00:24
577500 -- [-552.579] (-556.626) (-555.213) (-553.198) * [-554.756] (-553.641) (-552.933) (-556.638) -- 0:00:24
578000 -- [-553.699] (-552.096) (-551.825) (-553.331) * [-555.118] (-553.028) (-554.075) (-555.485) -- 0:00:24
578500 -- (-557.658) (-552.948) [-553.523] (-553.400) * [-553.508] (-555.070) (-558.251) (-553.105) -- 0:00:24
579000 -- [-555.768] (-552.512) (-554.063) (-555.245) * [-557.084] (-555.046) (-552.067) (-555.329) -- 0:00:24
579500 -- (-552.355) (-553.804) (-553.840) [-553.128] * (-554.479) (-555.208) (-552.722) [-552.406] -- 0:00:25
580000 -- [-552.393] (-553.231) (-557.344) (-554.132) * (-557.773) (-552.208) (-552.115) [-553.065] -- 0:00:25
Average standard deviation of split frequencies: 0.012655
580500 -- (-553.046) [-552.122] (-556.523) (-555.821) * (-554.798) (-552.905) (-554.654) [-551.871] -- 0:00:25
581000 -- (-557.104) (-553.022) (-555.810) [-553.778] * (-551.371) (-553.811) [-554.034] (-551.873) -- 0:00:25
581500 -- (-552.626) (-552.363) [-552.945] (-554.244) * (-556.331) [-554.414] (-552.617) (-552.487) -- 0:00:25
582000 -- (-552.474) [-556.343] (-552.832) (-553.490) * [-553.704] (-553.309) (-554.996) (-551.345) -- 0:00:25
582500 -- (-554.712) (-552.668) (-553.555) [-553.344] * (-555.721) (-552.492) (-557.080) [-552.368] -- 0:00:25
583000 -- [-555.154] (-553.453) (-553.735) (-556.894) * [-552.273] (-553.595) (-557.340) (-554.119) -- 0:00:25
583500 -- (-552.512) (-554.293) [-553.768] (-557.287) * (-551.762) (-554.276) (-555.063) [-553.918] -- 0:00:24
584000 -- (-552.484) (-552.597) (-552.174) [-554.088] * [-553.441] (-552.913) (-553.832) (-556.551) -- 0:00:24
584500 -- (-558.152) [-551.640] (-552.672) (-554.110) * [-554.409] (-555.466) (-551.709) (-554.288) -- 0:00:24
585000 -- (-553.280) (-553.876) (-557.620) [-551.227] * (-553.874) (-552.293) [-553.848] (-552.126) -- 0:00:24
Average standard deviation of split frequencies: 0.012966
585500 -- (-552.614) (-553.576) (-551.258) [-553.622] * [-551.885] (-552.031) (-552.480) (-557.711) -- 0:00:24
586000 -- [-552.687] (-554.584) (-552.372) (-554.516) * [-553.141] (-553.157) (-555.124) (-558.952) -- 0:00:24
586500 -- (-552.854) [-553.662] (-554.761) (-554.105) * (-558.668) [-553.084] (-554.341) (-552.104) -- 0:00:24
587000 -- (-552.259) [-555.912] (-553.491) (-553.192) * (-552.754) (-551.374) [-551.726] (-552.199) -- 0:00:24
587500 -- (-551.611) (-554.836) [-552.526] (-553.656) * (-553.152) (-551.497) [-553.897] (-553.712) -- 0:00:24
588000 -- (-555.998) [-552.955] (-553.341) (-553.729) * [-553.183] (-553.101) (-552.390) (-552.457) -- 0:00:24
588500 -- [-552.902] (-554.417) (-554.283) (-557.035) * [-555.406] (-551.702) (-553.195) (-553.570) -- 0:00:24
589000 -- (-554.465) [-552.346] (-554.950) (-556.735) * (-553.831) (-552.840) [-554.176] (-552.775) -- 0:00:24
589500 -- [-554.348] (-558.720) (-553.685) (-555.865) * (-555.306) [-553.195] (-551.245) (-552.701) -- 0:00:24
590000 -- (-553.880) (-553.575) (-551.571) [-554.012] * (-552.250) [-556.611] (-552.083) (-553.789) -- 0:00:24
Average standard deviation of split frequencies: 0.013145
590500 -- (-555.573) (-555.353) [-552.792] (-552.796) * (-553.648) (-556.908) [-551.854] (-556.970) -- 0:00:24
591000 -- (-551.872) [-553.403] (-553.086) (-553.146) * (-555.785) (-553.711) (-556.211) [-557.631] -- 0:00:24
591500 -- (-552.794) [-556.767] (-556.556) (-553.451) * (-553.090) [-554.108] (-554.570) (-553.643) -- 0:00:24
592000 -- (-551.163) (-551.782) [-554.219] (-555.110) * (-553.527) [-552.277] (-552.461) (-551.451) -- 0:00:24
592500 -- [-551.851] (-555.416) (-556.497) (-552.892) * [-552.665] (-553.669) (-555.626) (-553.050) -- 0:00:24
593000 -- (-552.693) (-552.861) (-554.584) [-553.362] * (-553.431) (-554.755) (-552.970) [-551.975] -- 0:00:24
593500 -- (-556.973) [-552.262] (-552.325) (-552.747) * [-554.555] (-553.601) (-555.976) (-551.975) -- 0:00:23
594000 -- (-555.552) (-552.438) (-552.055) [-552.927] * [-554.966] (-553.049) (-555.914) (-554.022) -- 0:00:23
594500 -- (-556.217) (-551.864) (-558.807) [-552.176] * (-555.208) (-552.203) (-557.257) [-554.108] -- 0:00:23
595000 -- (-554.299) (-551.997) [-556.442] (-553.329) * (-552.377) (-552.977) (-552.007) [-555.661] -- 0:00:23
Average standard deviation of split frequencies: 0.012748
595500 -- (-551.737) (-551.801) (-552.055) [-552.062] * [-555.189] (-558.417) (-553.114) (-554.377) -- 0:00:23
596000 -- (-552.227) (-552.333) [-553.192] (-554.701) * (-555.807) (-558.663) (-554.570) [-552.948] -- 0:00:23
596500 -- (-556.634) (-552.249) (-552.149) [-553.132] * [-553.082] (-554.076) (-552.046) (-553.258) -- 0:00:24
597000 -- [-555.997] (-551.162) (-555.475) (-557.457) * [-553.494] (-553.592) (-551.736) (-559.402) -- 0:00:24
597500 -- (-553.584) (-553.049) (-553.889) [-553.684] * (-553.412) (-554.320) [-551.717] (-551.348) -- 0:00:24
598000 -- (-553.675) (-553.827) (-552.469) [-553.513] * (-552.905) [-553.785] (-553.423) (-551.330) -- 0:00:24
598500 -- (-553.924) [-551.849] (-552.950) (-551.565) * (-553.461) [-551.967] (-552.146) (-559.774) -- 0:00:24
599000 -- (-560.445) (-556.774) [-553.173] (-553.356) * (-553.989) [-551.759] (-554.401) (-553.540) -- 0:00:24
599500 -- (-556.044) [-552.102] (-555.399) (-554.161) * (-552.607) (-551.777) [-552.438] (-553.047) -- 0:00:24
600000 -- [-553.123] (-555.251) (-553.101) (-554.291) * (-555.205) (-552.227) (-551.962) [-551.763] -- 0:00:24
Average standard deviation of split frequencies: 0.013665
600500 -- [-552.394] (-558.915) (-553.749) (-555.508) * (-558.227) (-554.127) [-552.675] (-551.731) -- 0:00:23
601000 -- (-554.462) [-551.588] (-552.342) (-553.407) * (-554.420) (-553.072) (-556.795) [-552.165] -- 0:00:23
601500 -- [-560.016] (-551.622) (-551.302) (-558.534) * (-556.515) [-552.945] (-554.482) (-551.987) -- 0:00:23
602000 -- (-555.546) (-558.761) [-551.300] (-556.554) * [-553.539] (-552.855) (-553.740) (-557.987) -- 0:00:23
602500 -- (-555.956) [-554.562] (-552.713) (-553.597) * [-552.933] (-552.001) (-552.621) (-558.925) -- 0:00:23
603000 -- (-552.243) (-554.502) [-552.298] (-554.701) * [-553.190] (-553.685) (-552.060) (-553.564) -- 0:00:23
603500 -- (-552.622) [-553.975] (-553.846) (-553.299) * (-555.338) (-556.458) [-552.086] (-552.446) -- 0:00:23
604000 -- [-554.507] (-556.403) (-554.099) (-552.757) * (-553.693) (-552.004) [-552.886] (-552.419) -- 0:00:23
604500 -- (-555.487) (-551.920) [-553.501] (-552.750) * [-556.483] (-551.841) (-554.781) (-552.009) -- 0:00:23
605000 -- (-553.154) [-551.903] (-552.267) (-553.026) * (-553.308) (-555.422) (-553.914) [-553.930] -- 0:00:23
Average standard deviation of split frequencies: 0.013224
605500 -- [-556.258] (-551.593) (-554.581) (-553.290) * (-552.622) [-555.592] (-553.870) (-556.332) -- 0:00:23
606000 -- (-553.187) (-551.956) (-556.111) [-551.436] * (-556.283) [-553.398] (-552.908) (-554.452) -- 0:00:23
606500 -- [-552.918] (-551.125) (-552.579) (-554.333) * [-552.666] (-553.154) (-552.725) (-553.786) -- 0:00:23
607000 -- (-555.453) (-557.587) [-554.428] (-551.752) * (-552.713) (-556.166) (-552.903) [-552.097] -- 0:00:23
607500 -- (-551.734) (-552.863) [-554.741] (-552.117) * (-552.565) (-556.839) (-552.557) [-553.302] -- 0:00:23
608000 -- (-557.287) (-556.092) (-558.830) [-551.272] * [-551.852] (-555.221) (-551.763) (-552.978) -- 0:00:23
608500 -- (-553.627) (-555.731) (-553.712) [-551.272] * (-554.906) (-554.939) (-557.075) [-556.784] -- 0:00:23
609000 -- (-553.548) [-554.293] (-555.186) (-551.710) * (-555.428) (-557.452) (-552.245) [-552.904] -- 0:00:23
609500 -- [-553.527] (-556.208) (-552.487) (-552.567) * (-556.113) (-554.947) [-553.515] (-553.829) -- 0:00:23
610000 -- (-555.002) (-555.121) [-551.570] (-552.205) * [-558.941] (-552.228) (-557.394) (-554.261) -- 0:00:23
Average standard deviation of split frequencies: 0.013350
610500 -- (-553.147) [-551.485] (-554.833) (-555.466) * (-552.154) (-553.595) (-559.372) [-552.240] -- 0:00:22
611000 -- [-554.067] (-551.518) (-552.711) (-553.087) * [-551.463] (-552.801) (-554.650) (-553.918) -- 0:00:22
611500 -- (-553.135) (-554.931) (-557.845) [-552.350] * (-552.825) (-552.564) (-553.611) [-551.305] -- 0:00:22
612000 -- (-554.078) (-552.562) [-557.922] (-553.756) * (-553.494) (-552.503) (-554.153) [-551.917] -- 0:00:22
612500 -- (-557.873) [-551.905] (-554.279) (-553.413) * (-552.952) (-553.497) (-553.407) [-552.737] -- 0:00:22
613000 -- [-551.396] (-554.432) (-553.822) (-552.982) * [-554.109] (-555.577) (-552.589) (-553.375) -- 0:00:22
613500 -- [-555.083] (-554.637) (-552.059) (-552.596) * [-553.698] (-556.938) (-552.588) (-555.173) -- 0:00:23
614000 -- (-552.614) (-554.437) (-552.752) [-552.498] * (-553.236) [-553.762] (-557.180) (-552.701) -- 0:00:23
614500 -- (-554.062) [-554.687] (-554.292) (-552.563) * (-556.588) [-552.950] (-554.483) (-552.019) -- 0:00:23
615000 -- (-551.928) (-555.683) (-553.605) [-551.652] * (-553.189) (-553.340) (-553.038) [-552.595] -- 0:00:23
Average standard deviation of split frequencies: 0.012965
615500 -- [-551.812] (-553.117) (-553.605) (-552.853) * [-552.392] (-552.349) (-554.817) (-552.775) -- 0:00:23
616000 -- (-551.812) [-554.053] (-559.666) (-554.594) * (-552.424) (-552.129) (-558.931) [-553.692] -- 0:00:23
616500 -- [-556.133] (-553.625) (-555.572) (-552.270) * (-552.350) (-552.490) (-558.123) [-553.628] -- 0:00:23
617000 -- [-557.110] (-558.368) (-558.430) (-553.237) * (-552.439) [-552.684] (-553.385) (-553.079) -- 0:00:22
617500 -- (-553.782) [-552.926] (-557.386) (-552.404) * (-552.925) (-560.543) [-552.266] (-556.451) -- 0:00:22
618000 -- (-553.417) [-553.252] (-554.680) (-552.537) * (-554.788) (-557.828) (-553.427) [-551.399] -- 0:00:22
618500 -- (-551.962) [-551.726] (-552.620) (-558.939) * (-553.734) [-554.184] (-553.066) (-552.467) -- 0:00:22
619000 -- (-553.737) [-552.335] (-553.650) (-556.087) * (-556.489) [-552.044] (-551.674) (-552.754) -- 0:00:22
619500 -- (-557.534) (-557.703) (-552.626) [-555.406] * (-554.499) [-553.967] (-555.512) (-556.377) -- 0:00:22
620000 -- [-558.273] (-556.754) (-551.727) (-553.853) * (-552.730) (-552.676) [-558.790] (-555.805) -- 0:00:22
Average standard deviation of split frequencies: 0.013149
620500 -- (-556.010) (-552.120) (-553.856) [-554.180] * (-554.319) (-553.718) (-557.204) [-553.511] -- 0:00:22
621000 -- (-553.774) (-553.693) (-554.180) [-551.821] * (-552.619) (-551.784) [-553.726] (-553.263) -- 0:00:22
621500 -- [-552.966] (-553.079) (-553.741) (-555.140) * (-553.279) [-552.177] (-553.277) (-552.886) -- 0:00:22
622000 -- (-551.691) [-553.156] (-553.837) (-553.154) * (-558.707) (-555.094) (-552.771) [-552.175] -- 0:00:22
622500 -- (-552.851) [-555.591] (-554.053) (-553.112) * (-556.037) [-555.893] (-552.421) (-553.207) -- 0:00:22
623000 -- [-554.883] (-552.673) (-551.589) (-553.407) * (-552.364) (-551.682) (-555.600) [-551.521] -- 0:00:22
623500 -- [-553.736] (-552.025) (-553.081) (-553.182) * (-551.949) (-551.517) [-553.993] (-551.607) -- 0:00:22
624000 -- (-552.132) [-552.719] (-553.921) (-556.071) * [-552.111] (-552.807) (-552.503) (-552.394) -- 0:00:22
624500 -- [-552.213] (-554.723) (-553.981) (-552.568) * (-552.873) (-551.739) (-554.085) [-553.346] -- 0:00:22
625000 -- (-552.210) (-557.747) [-555.694] (-551.698) * (-552.808) [-555.479] (-551.707) (-552.950) -- 0:00:22
Average standard deviation of split frequencies: 0.012896
625500 -- (-553.189) (-559.461) [-552.663] (-552.885) * (-557.900) (-551.517) [-552.394] (-553.887) -- 0:00:22
626000 -- (-553.494) [-554.235] (-556.870) (-553.835) * (-553.751) (-551.767) (-554.004) [-555.459] -- 0:00:22
626500 -- [-552.220] (-555.373) (-553.789) (-552.684) * (-552.809) (-551.619) [-553.696] (-554.984) -- 0:00:22
627000 -- (-555.774) (-552.396) (-553.450) [-555.707] * (-552.851) (-551.496) (-552.594) [-557.462] -- 0:00:22
627500 -- (-552.607) [-554.648] (-554.095) (-553.306) * [-552.224] (-552.072) (-559.778) (-552.416) -- 0:00:21
628000 -- (-553.040) (-558.620) (-558.003) [-554.737] * (-552.546) (-555.523) [-552.171] (-555.336) -- 0:00:21
628500 -- [-552.453] (-556.092) (-553.512) (-551.974) * (-553.887) (-551.819) (-555.108) [-552.977] -- 0:00:21
629000 -- (-552.392) (-554.451) [-552.367] (-556.977) * (-551.673) (-554.131) (-553.660) [-554.282] -- 0:00:21
629500 -- (-553.752) (-552.869) [-552.087] (-558.767) * (-556.755) (-551.238) (-559.022) [-552.005] -- 0:00:21
630000 -- (-552.097) (-552.357) [-553.848] (-556.678) * [-552.932] (-554.013) (-556.335) (-554.469) -- 0:00:21
Average standard deviation of split frequencies: 0.012987
630500 -- (-551.627) (-553.216) [-553.215] (-553.827) * [-551.679] (-556.021) (-557.622) (-553.229) -- 0:00:22
631000 -- (-551.870) (-554.490) [-551.607] (-553.991) * (-553.605) (-552.673) (-556.796) [-554.975] -- 0:00:22
631500 -- (-552.275) (-555.175) [-554.986] (-552.767) * (-552.578) (-553.040) [-553.295] (-551.834) -- 0:00:22
632000 -- [-552.924] (-556.461) (-552.541) (-554.453) * (-552.446) (-552.730) [-554.009] (-553.238) -- 0:00:22
632500 -- [-553.713] (-553.316) (-553.082) (-554.153) * (-555.002) [-557.671] (-551.596) (-556.889) -- 0:00:22
633000 -- (-553.843) (-555.694) (-555.443) [-555.347] * (-554.126) (-552.679) [-557.467] (-553.660) -- 0:00:22
633500 -- (-554.179) (-553.924) (-554.435) [-552.885] * (-554.503) (-552.721) (-552.436) [-553.144] -- 0:00:21
634000 -- [-553.216] (-554.696) (-556.216) (-557.613) * (-553.008) [-553.141] (-554.982) (-553.348) -- 0:00:21
634500 -- (-552.797) (-552.831) [-552.570] (-556.500) * (-552.008) [-553.021] (-553.477) (-555.643) -- 0:00:21
635000 -- (-553.712) (-555.292) [-551.301] (-553.601) * (-552.258) [-553.655] (-553.315) (-553.531) -- 0:00:21
Average standard deviation of split frequencies: 0.012739
635500 -- (-555.383) (-554.139) [-551.964] (-552.608) * (-556.983) (-554.818) (-557.216) [-551.665] -- 0:00:21
636000 -- (-558.512) (-554.798) (-554.013) [-551.590] * [-552.832] (-553.032) (-554.371) (-552.371) -- 0:00:21
636500 -- (-559.070) [-551.567] (-555.210) (-552.511) * (-555.650) (-561.249) (-553.441) [-553.719] -- 0:00:21
637000 -- (-554.270) (-551.623) [-553.323] (-552.467) * (-552.642) (-555.136) (-552.730) [-551.997] -- 0:00:21
637500 -- (-553.175) (-551.983) (-556.922) [-552.323] * (-552.768) (-555.516) (-552.011) [-552.594] -- 0:00:21
638000 -- (-553.995) [-552.075] (-552.852) (-559.428) * [-552.165] (-554.499) (-553.736) (-554.643) -- 0:00:21
638500 -- [-552.280] (-553.069) (-554.632) (-552.477) * [-553.839] (-557.747) (-554.585) (-559.526) -- 0:00:21
639000 -- (-553.273) (-551.724) (-553.522) [-551.848] * (-552.373) (-555.402) (-554.916) [-553.115] -- 0:00:21
639500 -- [-553.481] (-557.230) (-551.740) (-552.644) * (-552.340) (-551.520) [-551.818] (-552.632) -- 0:00:21
640000 -- [-553.129] (-552.780) (-553.031) (-552.341) * (-553.862) [-551.408] (-552.619) (-555.342) -- 0:00:21
Average standard deviation of split frequencies: 0.012003
640500 -- [-551.999] (-553.963) (-554.312) (-553.856) * (-552.821) (-552.791) (-552.745) [-553.729] -- 0:00:21
641000 -- (-553.275) (-554.121) [-552.546] (-554.917) * (-551.589) (-555.048) [-553.609] (-554.711) -- 0:00:21
641500 -- [-555.201] (-552.218) (-551.922) (-556.277) * (-559.299) (-553.708) [-554.486] (-554.268) -- 0:00:21
642000 -- (-553.297) (-563.146) [-552.473] (-552.931) * [-552.599] (-556.141) (-554.472) (-554.624) -- 0:00:21
642500 -- (-551.692) (-553.679) (-552.082) [-553.334] * (-554.272) (-552.733) (-552.889) [-552.425] -- 0:00:21
643000 -- (-555.625) (-551.669) (-553.101) [-554.702] * (-551.847) [-552.312] (-552.902) (-554.743) -- 0:00:21
643500 -- (-558.645) [-552.448] (-553.794) (-555.666) * (-552.634) (-555.338) (-552.180) [-554.153] -- 0:00:21
644000 -- (-553.871) (-554.489) [-552.883] (-555.014) * (-555.155) [-552.735] (-554.530) (-554.783) -- 0:00:21
644500 -- (-551.962) (-553.441) [-552.287] (-555.527) * (-553.813) (-555.348) (-555.405) [-552.174] -- 0:00:20
645000 -- (-555.586) (-553.498) [-551.875] (-554.014) * (-553.017) (-552.129) [-551.678] (-553.454) -- 0:00:20
Average standard deviation of split frequencies: 0.011721
645500 -- (-552.838) (-554.810) [-556.407] (-553.642) * [-553.926] (-551.858) (-553.234) (-552.912) -- 0:00:20
646000 -- (-553.047) [-553.496] (-553.420) (-554.642) * (-552.633) [-553.083] (-554.103) (-555.801) -- 0:00:20
646500 -- (-552.643) (-551.902) (-553.576) [-553.419] * (-558.681) (-556.866) (-553.534) [-556.004] -- 0:00:20
647000 -- (-553.306) [-551.914] (-554.683) (-551.832) * [-552.288] (-555.139) (-555.275) (-555.038) -- 0:00:20
647500 -- (-552.193) (-551.736) (-553.346) [-552.910] * (-553.465) (-552.080) (-555.482) [-553.339] -- 0:00:20
648000 -- (-554.856) (-553.201) (-552.173) [-552.611] * (-553.996) [-552.111] (-554.321) (-552.710) -- 0:00:21
648500 -- (-552.202) (-553.099) (-551.869) [-553.086] * [-556.772] (-552.664) (-557.540) (-554.210) -- 0:00:21
649000 -- (-555.302) (-553.097) (-554.361) [-556.062] * (-554.000) [-554.272] (-564.862) (-553.892) -- 0:00:21
649500 -- [-554.027] (-554.417) (-553.662) (-553.191) * (-555.679) [-553.010] (-561.734) (-554.262) -- 0:00:21
650000 -- (-553.112) (-553.704) (-551.847) [-553.289] * (-551.685) [-552.188] (-558.540) (-551.811) -- 0:00:21
Average standard deviation of split frequencies: 0.011728
650500 -- (-558.529) (-555.559) [-554.994] (-555.224) * [-552.222] (-554.913) (-554.639) (-551.939) -- 0:00:20
651000 -- (-557.912) (-556.729) (-553.967) [-555.148] * (-551.616) (-552.057) (-554.994) [-552.604] -- 0:00:20
651500 -- (-552.428) (-555.917) (-554.388) [-552.758] * (-554.811) [-552.747] (-554.664) (-553.491) -- 0:00:20
652000 -- (-555.663) (-554.203) [-554.555] (-561.286) * (-553.389) (-553.874) (-555.897) [-553.386] -- 0:00:20
652500 -- (-554.507) [-551.294] (-554.575) (-555.651) * (-553.679) (-557.427) (-552.730) [-552.960] -- 0:00:20
653000 -- (-552.434) (-552.459) [-551.894] (-558.666) * (-554.674) (-552.558) [-555.666] (-552.462) -- 0:00:20
653500 -- (-554.511) (-553.285) (-552.071) [-551.882] * (-552.885) [-551.321] (-558.721) (-553.380) -- 0:00:20
654000 -- [-551.644] (-556.055) (-555.537) (-553.194) * (-552.351) [-553.139] (-558.542) (-553.911) -- 0:00:20
654500 -- (-553.025) [-561.493] (-553.117) (-552.963) * (-554.709) [-553.325] (-552.025) (-553.234) -- 0:00:20
655000 -- (-554.419) (-552.885) (-554.068) [-553.117] * (-553.719) [-551.245] (-552.123) (-554.745) -- 0:00:20
Average standard deviation of split frequencies: 0.011543
655500 -- (-552.478) (-552.594) [-553.079] (-555.175) * (-556.152) (-552.969) (-552.907) [-557.489] -- 0:00:20
656000 -- (-552.428) (-552.620) [-552.833] (-554.360) * [-556.305] (-551.735) (-556.022) (-555.895) -- 0:00:20
656500 -- [-551.809] (-552.821) (-552.829) (-557.723) * [-552.612] (-553.732) (-552.346) (-552.699) -- 0:00:20
657000 -- (-552.832) (-552.202) (-551.731) [-554.951] * (-552.642) (-553.020) (-553.769) [-553.624] -- 0:00:20
657500 -- (-553.376) [-556.035] (-553.006) (-553.890) * (-556.797) (-555.572) [-552.571] (-553.913) -- 0:00:20
658000 -- (-555.980) (-554.127) [-553.137] (-552.971) * (-551.404) [-555.687] (-552.175) (-553.953) -- 0:00:20
658500 -- (-553.237) (-554.597) [-551.889] (-553.015) * (-553.625) (-554.381) [-553.585] (-557.123) -- 0:00:20
659000 -- (-554.046) (-555.562) (-553.856) [-555.131] * (-553.315) [-553.470] (-554.428) (-555.305) -- 0:00:20
659500 -- [-552.263] (-553.850) (-554.785) (-552.240) * (-551.390) (-551.314) (-551.912) [-558.254] -- 0:00:20
660000 -- (-557.814) [-553.786] (-553.794) (-555.316) * (-552.171) [-553.883] (-554.781) (-553.204) -- 0:00:20
Average standard deviation of split frequencies: 0.011639
660500 -- (-559.770) (-553.888) [-555.338] (-553.608) * (-552.821) (-554.560) [-553.220] (-553.915) -- 0:00:20
661000 -- [-551.458] (-555.573) (-558.382) (-553.758) * [-553.888] (-553.835) (-552.017) (-553.137) -- 0:00:20
661500 -- (-553.957) (-552.548) (-556.577) [-551.780] * (-552.455) (-552.860) [-551.602] (-554.162) -- 0:00:19
662000 -- [-552.218] (-552.474) (-556.818) (-555.244) * [-556.665] (-552.921) (-552.703) (-555.628) -- 0:00:19
662500 -- [-553.483] (-552.218) (-551.776) (-554.217) * (-554.052) [-552.494] (-553.090) (-552.309) -- 0:00:19
663000 -- [-558.321] (-551.408) (-553.777) (-553.074) * (-553.701) (-552.550) [-553.869] (-551.745) -- 0:00:19
663500 -- [-553.202] (-552.940) (-552.310) (-553.674) * [-553.221] (-552.700) (-553.083) (-553.624) -- 0:00:19
664000 -- [-553.348] (-553.968) (-554.099) (-555.244) * (-551.982) (-553.261) [-555.291] (-553.972) -- 0:00:19
664500 -- [-555.379] (-554.391) (-553.110) (-553.835) * [-552.412] (-555.460) (-553.497) (-556.051) -- 0:00:19
665000 -- [-552.140] (-553.511) (-551.839) (-556.813) * (-553.572) (-558.791) [-554.521] (-556.137) -- 0:00:20
Average standard deviation of split frequencies: 0.011325
665500 -- (-552.242) [-555.496] (-552.331) (-555.826) * (-552.387) [-551.944] (-553.623) (-554.189) -- 0:00:20
666000 -- (-552.324) (-552.018) [-553.262] (-557.200) * [-552.460] (-551.410) (-552.821) (-551.842) -- 0:00:20
666500 -- (-553.329) [-554.958] (-554.859) (-552.756) * (-553.354) [-553.019] (-551.880) (-552.571) -- 0:00:20
667000 -- (-552.176) (-559.815) [-554.106] (-555.466) * (-556.874) [-554.511] (-553.999) (-558.383) -- 0:00:19
667500 -- (-552.204) [-552.833] (-554.924) (-552.907) * (-552.156) (-555.068) (-556.956) [-552.302] -- 0:00:19
668000 -- (-553.018) (-552.014) (-551.621) [-552.913] * (-553.597) [-552.856] (-554.214) (-552.495) -- 0:00:19
668500 -- (-552.042) [-552.931] (-552.266) (-556.871) * (-559.604) (-553.696) (-553.000) [-553.398] -- 0:00:19
669000 -- [-552.438] (-552.720) (-556.083) (-555.086) * (-551.792) [-552.263] (-552.227) (-555.105) -- 0:00:19
669500 -- [-554.072] (-552.995) (-551.817) (-552.923) * (-554.035) [-552.190] (-552.888) (-557.305) -- 0:00:19
670000 -- [-551.878] (-553.720) (-552.957) (-554.980) * (-554.794) (-551.685) [-551.685] (-552.077) -- 0:00:19
Average standard deviation of split frequencies: 0.011290
670500 -- (-553.796) [-554.633] (-552.402) (-552.302) * [-553.306] (-553.505) (-555.555) (-554.897) -- 0:00:19
671000 -- (-556.675) (-555.329) (-556.634) [-554.471] * (-552.798) (-555.286) (-553.433) [-556.052] -- 0:00:19
671500 -- (-556.450) (-553.410) [-554.096] (-555.637) * (-553.619) (-553.228) [-554.526] (-557.637) -- 0:00:19
672000 -- (-554.650) [-552.629] (-553.647) (-555.261) * (-552.515) [-552.479] (-551.532) (-559.564) -- 0:00:19
672500 -- (-551.750) (-552.894) (-553.497) [-551.675] * (-553.340) [-554.398] (-554.019) (-551.695) -- 0:00:19
673000 -- (-556.597) (-553.457) [-552.375] (-554.382) * (-552.184) (-552.425) (-554.554) [-552.565] -- 0:00:19
673500 -- (-553.462) (-553.892) (-553.529) [-552.601] * (-552.542) [-552.667] (-555.530) (-554.831) -- 0:00:19
674000 -- (-552.712) (-558.054) (-553.601) [-553.686] * (-555.482) [-553.852] (-557.051) (-553.409) -- 0:00:19
674500 -- (-554.163) [-552.941] (-552.533) (-553.152) * (-554.187) [-553.021] (-552.576) (-555.226) -- 0:00:19
675000 -- (-554.992) (-551.815) [-553.576] (-552.656) * (-556.087) (-556.492) (-554.749) [-554.441] -- 0:00:19
Average standard deviation of split frequencies: 0.010809
675500 -- (-554.947) [-552.204] (-555.933) (-554.247) * (-552.573) (-552.440) (-552.596) [-553.497] -- 0:00:19
676000 -- (-554.791) (-556.462) [-552.225] (-558.710) * (-554.199) (-553.320) (-553.247) [-551.574] -- 0:00:19
676500 -- (-553.270) (-554.259) (-552.848) [-552.872] * [-553.267] (-553.303) (-552.953) (-554.570) -- 0:00:19
677000 -- (-552.602) [-553.899] (-553.620) (-552.192) * (-558.698) (-558.598) (-553.585) [-553.953] -- 0:00:19
677500 -- (-554.367) (-554.125) (-552.275) [-555.005] * [-552.018] (-557.264) (-554.830) (-553.653) -- 0:00:19
678000 -- (-554.222) (-557.057) [-558.258] (-556.264) * (-554.515) (-554.052) (-552.132) [-552.416] -- 0:00:18
678500 -- (-552.198) [-558.077] (-558.761) (-554.208) * (-553.721) [-552.767] (-553.009) (-554.575) -- 0:00:18
679000 -- (-553.759) (-560.286) [-553.794] (-557.198) * (-551.989) (-554.414) [-556.626] (-552.530) -- 0:00:18
679500 -- (-552.882) (-563.329) (-552.306) [-555.242] * [-551.561] (-551.374) (-557.149) (-555.139) -- 0:00:18
680000 -- (-553.554) (-554.283) (-553.419) [-553.558] * (-551.471) [-551.955] (-552.958) (-554.787) -- 0:00:18
Average standard deviation of split frequencies: 0.010821
680500 -- (-555.725) (-552.452) (-553.300) [-552.807] * [-554.326] (-552.016) (-552.690) (-553.605) -- 0:00:18
681000 -- (-553.259) (-552.551) [-554.253] (-552.679) * (-553.974) [-552.082] (-554.471) (-556.780) -- 0:00:18
681500 -- (-555.077) (-555.933) (-555.774) [-551.965] * (-553.600) [-552.852] (-558.308) (-552.644) -- 0:00:18
682000 -- (-552.224) (-552.708) (-553.163) [-551.776] * (-553.253) [-553.936] (-558.024) (-552.215) -- 0:00:19
682500 -- [-552.230] (-555.433) (-554.198) (-553.086) * [-552.101] (-555.770) (-554.613) (-555.556) -- 0:00:19
683000 -- [-554.173] (-551.511) (-552.664) (-554.398) * (-551.858) (-558.842) (-554.652) [-557.155] -- 0:00:19
683500 -- (-552.253) (-558.850) (-551.832) [-555.105] * (-558.356) [-555.656] (-552.673) (-551.603) -- 0:00:18
684000 -- (-552.286) (-553.225) (-553.193) [-555.030] * [-553.717] (-556.282) (-555.267) (-555.709) -- 0:00:18
684500 -- (-552.250) (-553.335) [-551.401] (-555.178) * (-552.059) (-555.649) [-555.526] (-553.017) -- 0:00:18
685000 -- (-551.296) (-553.252) (-552.574) [-551.635] * (-553.780) (-555.646) [-553.154] (-553.243) -- 0:00:18
Average standard deviation of split frequencies: 0.010823
685500 -- (-552.467) [-555.333] (-553.006) (-555.226) * (-553.859) (-552.139) [-555.147] (-551.822) -- 0:00:18
686000 -- (-552.409) (-555.612) (-553.601) [-554.316] * (-552.429) (-554.729) [-553.030] (-553.338) -- 0:00:18
686500 -- (-558.230) [-556.118] (-551.413) (-551.803) * (-552.631) [-558.609] (-552.894) (-551.877) -- 0:00:18
687000 -- (-555.203) (-552.584) [-552.842] (-551.819) * (-554.410) (-552.297) [-551.738] (-552.060) -- 0:00:18
687500 -- (-556.408) (-558.040) (-554.413) [-551.676] * (-555.040) (-552.625) [-556.069] (-554.384) -- 0:00:18
688000 -- (-555.599) (-556.215) (-551.737) [-553.933] * [-551.796] (-551.961) (-557.370) (-553.553) -- 0:00:18
688500 -- (-552.801) (-552.382) (-551.875) [-552.897] * (-552.841) [-552.152] (-555.088) (-553.072) -- 0:00:18
689000 -- [-551.228] (-552.429) (-555.836) (-552.338) * (-552.494) [-552.226] (-553.343) (-552.009) -- 0:00:18
689500 -- (-552.786) [-552.728] (-554.568) (-554.388) * (-555.033) [-554.075] (-553.200) (-553.201) -- 0:00:18
690000 -- (-552.303) [-553.306] (-560.056) (-554.536) * (-555.517) (-554.520) (-553.105) [-555.107] -- 0:00:18
Average standard deviation of split frequencies: 0.010707
690500 -- (-553.331) [-554.562] (-554.485) (-553.302) * (-553.046) [-553.003] (-555.831) (-554.173) -- 0:00:18
691000 -- (-555.029) [-556.543] (-555.260) (-552.266) * [-552.141] (-555.076) (-555.654) (-553.556) -- 0:00:18
691500 -- (-558.450) (-555.470) (-554.827) [-555.004] * (-554.969) [-553.873] (-557.380) (-555.570) -- 0:00:18
692000 -- (-556.983) (-555.122) [-555.879] (-554.822) * (-554.230) (-553.879) (-555.852) [-554.562] -- 0:00:18
692500 -- (-552.580) (-551.836) [-551.691] (-553.824) * (-552.423) (-553.221) [-554.511] (-553.544) -- 0:00:18
693000 -- [-551.987] (-552.763) (-554.985) (-555.150) * (-554.490) (-555.886) [-553.556] (-553.833) -- 0:00:18
693500 -- (-556.283) [-552.795] (-553.313) (-556.351) * [-552.884] (-551.610) (-552.411) (-554.590) -- 0:00:18
694000 -- [-557.848] (-552.822) (-555.313) (-555.060) * (-554.236) (-553.288) (-552.566) [-553.340] -- 0:00:18
694500 -- (-553.320) (-552.947) (-554.614) [-552.558] * (-554.384) (-551.741) [-553.614] (-553.476) -- 0:00:18
695000 -- (-551.282) (-555.912) (-553.588) [-552.709] * (-553.257) (-552.198) [-553.148] (-552.165) -- 0:00:17
Average standard deviation of split frequencies: 0.010498
695500 -- (-552.364) (-552.169) [-556.313] (-557.416) * (-552.569) [-552.148] (-552.507) (-552.381) -- 0:00:17
696000 -- (-557.581) (-554.509) (-552.247) [-554.140] * (-552.957) [-551.662] (-554.056) (-552.998) -- 0:00:17
696500 -- (-557.184) (-556.967) (-552.955) [-552.594] * [-551.577] (-551.894) (-554.562) (-555.673) -- 0:00:17
697000 -- (-556.589) (-554.307) (-553.570) [-552.049] * (-555.383) [-551.576] (-552.572) (-556.094) -- 0:00:17
697500 -- (-552.425) [-552.908] (-552.385) (-552.901) * [-553.115] (-553.162) (-555.360) (-554.673) -- 0:00:17
698000 -- (-555.351) (-551.879) (-552.254) [-552.004] * (-554.622) [-554.409] (-558.567) (-556.017) -- 0:00:17
698500 -- (-554.369) (-552.725) [-556.178] (-557.965) * (-554.830) (-555.180) (-552.502) [-552.541] -- 0:00:17
699000 -- [-553.607] (-556.001) (-552.977) (-553.931) * (-554.614) (-553.964) (-555.321) [-552.827] -- 0:00:17
699500 -- [-556.108] (-554.256) (-552.015) (-553.844) * [-554.428] (-555.249) (-554.264) (-551.610) -- 0:00:18
700000 -- (-554.996) (-551.343) (-554.751) [-551.523] * (-555.759) (-553.803) [-559.722] (-555.688) -- 0:00:18
Average standard deviation of split frequencies: 0.010765
700500 -- (-555.637) [-556.702] (-552.460) (-556.032) * (-558.000) (-555.668) (-559.829) [-552.050] -- 0:00:17
701000 -- [-552.490] (-552.254) (-552.972) (-553.162) * (-559.164) (-553.693) (-551.718) [-552.275] -- 0:00:17
701500 -- [-551.957] (-552.776) (-553.607) (-553.380) * (-552.681) [-554.487] (-553.908) (-551.962) -- 0:00:17
702000 -- [-555.150] (-552.417) (-557.827) (-555.029) * (-552.506) [-554.036] (-555.611) (-553.794) -- 0:00:17
702500 -- (-552.883) (-552.872) [-553.557] (-553.101) * (-554.134) [-552.301] (-557.935) (-552.094) -- 0:00:17
703000 -- (-554.023) (-552.356) (-552.829) [-552.278] * (-554.842) [-554.076] (-555.384) (-553.724) -- 0:00:17
703500 -- (-551.596) [-556.082] (-552.498) (-554.262) * (-555.162) (-553.768) [-556.561] (-555.321) -- 0:00:17
704000 -- (-555.789) (-556.199) [-556.563] (-553.638) * [-553.137] (-555.150) (-556.398) (-554.470) -- 0:00:17
704500 -- (-555.484) (-554.858) (-552.319) [-553.108] * (-552.762) (-551.772) [-552.388] (-556.685) -- 0:00:17
705000 -- (-551.840) (-552.088) (-557.336) [-552.151] * (-552.113) (-553.979) [-553.056] (-554.365) -- 0:00:17
Average standard deviation of split frequencies: 0.010934
705500 -- (-552.372) [-551.544] (-552.541) (-552.430) * (-553.066) [-555.001] (-553.952) (-557.803) -- 0:00:17
706000 -- (-555.940) (-553.665) [-551.403] (-553.240) * [-555.605] (-552.904) (-553.672) (-551.744) -- 0:00:17
706500 -- [-551.901] (-555.149) (-552.054) (-553.268) * (-553.947) (-555.795) [-554.194] (-554.951) -- 0:00:17
707000 -- (-551.336) (-555.128) (-558.312) [-552.876] * [-551.791] (-555.305) (-552.034) (-553.195) -- 0:00:17
707500 -- (-552.886) [-551.693] (-553.593) (-554.910) * [-552.324] (-551.486) (-553.756) (-554.298) -- 0:00:17
708000 -- (-552.493) (-553.161) (-552.405) [-555.383] * [-555.343] (-553.859) (-553.925) (-556.445) -- 0:00:17
708500 -- (-552.491) (-551.887) [-552.352] (-553.509) * (-555.141) (-553.737) (-553.542) [-554.626] -- 0:00:17
709000 -- (-553.489) [-554.828] (-553.280) (-554.875) * (-552.049) (-555.156) (-553.836) [-551.608] -- 0:00:17
709500 -- (-554.694) (-553.383) (-553.875) [-552.543] * (-553.684) (-554.672) (-552.905) [-551.795] -- 0:00:17
710000 -- [-554.170] (-554.462) (-555.028) (-552.336) * (-552.143) (-552.741) [-552.814] (-551.802) -- 0:00:17
Average standard deviation of split frequencies: 0.010986
710500 -- (-552.824) (-553.602) [-553.716] (-555.031) * (-555.246) (-553.515) (-552.982) [-551.887] -- 0:00:17
711000 -- (-553.604) (-556.918) [-553.379] (-552.210) * (-555.749) (-556.641) (-552.901) [-553.350] -- 0:00:17
711500 -- (-554.954) (-552.972) [-552.933] (-553.955) * [-554.498] (-553.451) (-553.632) (-552.889) -- 0:00:17
712000 -- (-556.270) (-553.935) (-553.665) [-556.169] * [-554.707] (-552.397) (-553.800) (-554.706) -- 0:00:16
712500 -- (-553.558) (-556.255) (-551.578) [-552.015] * (-553.119) (-554.028) [-552.809] (-552.939) -- 0:00:16
713000 -- (-555.717) (-555.845) [-551.372] (-554.819) * (-551.985) (-552.120) [-553.476] (-556.860) -- 0:00:16
713500 -- (-553.034) (-556.506) (-552.560) [-552.846] * (-552.414) (-551.654) (-556.855) [-553.071] -- 0:00:16
714000 -- (-557.063) (-563.169) [-555.230] (-551.912) * (-554.285) [-552.727] (-554.636) (-552.051) -- 0:00:16
714500 -- (-554.664) [-552.983] (-552.718) (-553.905) * (-556.038) (-556.809) (-553.315) [-553.028] -- 0:00:16
715000 -- [-555.415] (-554.151) (-553.917) (-554.637) * (-552.078) (-555.833) [-554.119] (-554.255) -- 0:00:16
Average standard deviation of split frequencies: 0.011193
715500 -- (-552.641) (-555.069) (-552.102) [-552.451] * (-554.275) (-555.814) [-556.354] (-554.103) -- 0:00:16
716000 -- (-554.746) (-553.899) (-554.970) [-553.063] * (-551.938) (-555.986) (-555.695) [-552.393] -- 0:00:17
716500 -- (-553.958) [-553.090] (-553.746) (-552.485) * [-552.202] (-554.397) (-553.287) (-555.469) -- 0:00:17
717000 -- (-552.483) (-552.587) (-553.183) [-555.504] * (-553.569) (-553.431) [-554.532] (-555.346) -- 0:00:16
717500 -- [-552.998] (-551.866) (-553.607) (-552.110) * (-555.270) (-554.612) (-552.429) [-552.280] -- 0:00:16
718000 -- (-552.019) (-554.229) [-551.814] (-555.314) * (-551.787) [-554.058] (-552.050) (-552.715) -- 0:00:16
718500 -- (-552.183) (-551.932) (-558.452) [-551.573] * (-551.408) [-563.119] (-551.659) (-552.806) -- 0:00:16
719000 -- [-553.074] (-551.877) (-554.659) (-552.582) * (-553.347) (-557.435) (-553.774) [-553.241] -- 0:00:16
719500 -- [-552.527] (-551.761) (-552.666) (-554.941) * (-554.273) (-560.376) (-551.525) [-554.948] -- 0:00:16
720000 -- (-554.202) [-554.216] (-552.324) (-554.182) * (-552.984) (-553.256) (-552.598) [-554.445] -- 0:00:16
Average standard deviation of split frequencies: 0.011038
720500 -- [-552.711] (-555.491) (-551.983) (-553.916) * (-553.513) (-552.583) (-554.663) [-554.782] -- 0:00:16
721000 -- (-553.013) (-552.680) [-553.853] (-554.242) * (-554.346) (-553.833) (-552.715) [-555.410] -- 0:00:16
721500 -- (-555.587) (-555.545) [-552.562] (-555.819) * [-551.578] (-552.352) (-554.618) (-556.660) -- 0:00:16
722000 -- (-554.508) (-554.045) [-552.175] (-552.137) * (-552.561) [-552.212] (-554.299) (-557.953) -- 0:00:16
722500 -- (-553.417) (-554.535) [-552.153] (-559.095) * (-553.779) (-556.432) [-552.512] (-553.454) -- 0:00:16
723000 -- (-552.316) (-554.098) [-552.508] (-554.635) * [-554.674] (-553.177) (-553.342) (-557.161) -- 0:00:16
723500 -- (-555.550) [-552.768] (-553.541) (-552.292) * [-556.123] (-552.771) (-553.852) (-553.479) -- 0:00:16
724000 -- (-555.196) (-553.350) (-553.092) [-554.248] * (-552.687) (-554.778) [-553.034] (-552.327) -- 0:00:16
724500 -- (-555.846) (-551.862) [-551.489] (-552.614) * [-552.870] (-553.334) (-552.833) (-555.606) -- 0:00:16
725000 -- (-551.423) (-552.881) [-552.782] (-551.946) * (-555.166) [-551.714] (-552.903) (-557.562) -- 0:00:16
Average standard deviation of split frequencies: 0.011282
725500 -- (-552.056) (-555.100) [-552.999] (-554.713) * (-554.454) (-553.208) [-552.704] (-557.205) -- 0:00:16
726000 -- (-551.517) (-552.938) [-551.687] (-552.791) * [-555.097] (-552.878) (-552.934) (-555.605) -- 0:00:16
726500 -- [-553.597] (-552.840) (-551.873) (-556.260) * [-553.282] (-552.949) (-553.213) (-556.833) -- 0:00:16
727000 -- (-552.044) (-554.010) [-552.491] (-554.576) * (-551.836) (-554.202) [-551.915] (-558.272) -- 0:00:16
727500 -- (-554.223) [-553.610] (-554.503) (-559.429) * [-554.049] (-555.095) (-552.107) (-556.836) -- 0:00:16
728000 -- [-553.992] (-555.178) (-551.598) (-553.073) * (-554.037) (-552.065) [-555.088] (-557.245) -- 0:00:16
728500 -- [-554.429] (-553.612) (-554.529) (-552.689) * [-555.023] (-554.912) (-552.529) (-553.895) -- 0:00:16
729000 -- [-551.972] (-554.939) (-554.669) (-553.341) * [-555.297] (-552.032) (-553.153) (-553.907) -- 0:00:15
729500 -- (-553.855) [-552.526] (-552.052) (-552.168) * (-556.286) (-554.776) [-552.365] (-554.851) -- 0:00:15
730000 -- (-551.472) (-552.475) (-553.337) [-555.347] * (-552.541) (-552.219) (-551.979) [-556.040] -- 0:00:15
Average standard deviation of split frequencies: 0.011226
730500 -- (-552.756) (-554.226) [-553.190] (-555.189) * [-552.901] (-553.412) (-551.458) (-554.355) -- 0:00:15
731000 -- (-553.676) (-552.501) [-555.095] (-553.224) * (-553.261) (-552.916) [-553.534] (-552.778) -- 0:00:15
731500 -- (-554.475) (-552.894) [-556.178] (-553.079) * (-554.256) [-554.149] (-555.686) (-555.511) -- 0:00:15
732000 -- [-552.081] (-554.121) (-555.533) (-557.904) * (-555.458) (-552.625) (-552.145) [-556.761] -- 0:00:15
732500 -- (-555.059) (-556.787) [-552.020] (-553.452) * (-551.909) [-552.786] (-553.689) (-552.457) -- 0:00:15
733000 -- [-552.227] (-552.848) (-553.155) (-552.446) * (-553.181) [-553.469] (-552.145) (-555.471) -- 0:00:15
733500 -- (-557.275) (-553.034) [-552.839] (-556.632) * [-553.528] (-555.475) (-553.482) (-555.455) -- 0:00:15
734000 -- (-555.356) [-552.229] (-551.845) (-552.501) * (-560.220) (-552.277) [-553.795] (-556.761) -- 0:00:15
734500 -- [-551.888] (-552.465) (-551.800) (-552.021) * (-553.382) (-551.230) [-552.509] (-555.071) -- 0:00:15
735000 -- [-552.186] (-555.875) (-553.407) (-552.434) * (-553.573) [-551.255] (-555.762) (-553.237) -- 0:00:15
Average standard deviation of split frequencies: 0.010974
735500 -- [-552.377] (-556.694) (-552.729) (-552.540) * [-553.623] (-553.369) (-559.940) (-552.813) -- 0:00:15
736000 -- (-554.645) [-554.517] (-556.879) (-553.833) * [-556.554] (-552.299) (-554.618) (-554.692) -- 0:00:15
736500 -- (-554.628) [-551.309] (-555.494) (-553.250) * (-561.291) [-552.969] (-552.023) (-554.213) -- 0:00:15
737000 -- (-554.577) (-551.389) [-552.514] (-552.112) * [-552.628] (-554.999) (-554.456) (-558.935) -- 0:00:15
737500 -- (-558.452) (-556.644) [-555.397] (-556.405) * [-552.628] (-557.503) (-558.289) (-553.735) -- 0:00:15
738000 -- [-554.702] (-556.798) (-553.723) (-556.063) * (-551.683) [-556.127] (-555.195) (-554.288) -- 0:00:15
738500 -- (-559.453) (-553.673) [-555.796] (-552.432) * (-557.369) (-554.366) (-554.426) [-552.783] -- 0:00:15
739000 -- [-554.531] (-559.909) (-552.057) (-552.395) * (-552.525) (-552.027) (-556.299) [-553.444] -- 0:00:15
739500 -- [-552.182] (-555.581) (-552.339) (-555.634) * [-551.429] (-552.072) (-553.107) (-553.921) -- 0:00:15
740000 -- (-552.214) (-554.034) (-553.584) [-552.300] * (-554.833) (-553.262) (-553.076) [-552.324] -- 0:00:15
Average standard deviation of split frequencies: 0.011541
740500 -- (-555.453) [-552.607] (-554.602) (-551.705) * (-556.725) (-553.963) [-551.835] (-554.669) -- 0:00:15
741000 -- (-554.894) (-553.118) (-553.199) [-551.934] * [-553.242] (-555.621) (-553.353) (-553.488) -- 0:00:15
741500 -- [-551.690] (-552.750) (-558.070) (-556.637) * (-554.072) (-555.903) [-555.282] (-552.253) -- 0:00:15
742000 -- [-555.408] (-551.807) (-559.321) (-558.562) * [-555.681] (-553.189) (-552.690) (-553.266) -- 0:00:15
742500 -- (-556.728) (-555.036) (-553.228) [-552.444] * [-554.084] (-552.305) (-552.634) (-554.375) -- 0:00:15
743000 -- [-557.491] (-556.352) (-552.875) (-551.794) * [-551.642] (-553.067) (-551.641) (-555.727) -- 0:00:15
743500 -- [-555.945] (-556.767) (-551.985) (-553.381) * (-553.010) [-552.436] (-553.639) (-554.942) -- 0:00:15
744000 -- (-558.182) [-553.493] (-557.280) (-551.607) * (-553.579) (-552.426) (-553.978) [-553.870] -- 0:00:15
744500 -- [-555.194] (-552.878) (-552.777) (-553.266) * (-554.515) [-552.325] (-552.201) (-556.815) -- 0:00:15
745000 -- (-552.465) [-554.012] (-553.194) (-556.006) * (-555.598) (-553.325) (-554.142) [-553.927] -- 0:00:15
Average standard deviation of split frequencies: 0.011669
745500 -- (-551.685) (-552.226) [-554.847] (-555.450) * (-553.633) [-553.508] (-551.339) (-552.782) -- 0:00:15
746000 -- [-552.715] (-551.768) (-554.024) (-552.197) * (-552.515) (-556.589) [-554.643] (-553.129) -- 0:00:14
746500 -- [-551.960] (-551.867) (-552.470) (-551.794) * (-551.403) [-552.504] (-554.300) (-556.815) -- 0:00:14
747000 -- (-552.735) (-553.620) (-551.831) [-555.335] * (-554.362) (-552.322) [-554.835] (-556.508) -- 0:00:14
747500 -- (-555.356) [-552.338] (-552.782) (-556.158) * (-552.742) [-551.638] (-558.656) (-551.747) -- 0:00:14
748000 -- (-554.127) (-551.968) (-554.874) [-556.831] * [-554.804] (-556.013) (-555.274) (-556.716) -- 0:00:14
748500 -- (-554.518) (-554.171) (-552.472) [-553.912] * [-556.095] (-556.031) (-553.504) (-553.705) -- 0:00:14
749000 -- (-552.192) [-554.291] (-552.598) (-557.585) * (-561.263) [-553.824] (-554.937) (-555.593) -- 0:00:14
749500 -- (-552.046) (-551.971) (-552.243) [-553.305] * (-555.711) (-559.310) (-551.270) [-557.340] -- 0:00:14
750000 -- [-551.444] (-552.374) (-554.353) (-552.115) * (-556.278) (-560.181) (-553.176) [-556.116] -- 0:00:14
Average standard deviation of split frequencies: 0.011764
750500 -- [-554.411] (-552.535) (-552.850) (-553.219) * (-555.066) (-562.164) [-552.518] (-553.050) -- 0:00:14
751000 -- (-551.915) (-551.807) [-552.142] (-552.913) * (-552.649) (-558.175) [-552.495] (-558.614) -- 0:00:14
751500 -- [-552.622] (-553.244) (-556.129) (-552.878) * [-551.627] (-555.866) (-552.969) (-554.502) -- 0:00:14
752000 -- (-553.516) (-551.805) (-556.299) [-558.191] * (-553.232) [-556.375] (-553.918) (-552.463) -- 0:00:14
752500 -- (-551.522) (-554.163) [-555.007] (-551.404) * [-553.661] (-552.815) (-551.873) (-552.332) -- 0:00:14
753000 -- (-554.239) (-557.758) (-559.826) [-552.807] * [-553.226] (-552.878) (-552.418) (-552.084) -- 0:00:14
753500 -- (-554.075) [-555.945] (-554.080) (-554.823) * (-556.362) (-553.944) (-552.794) [-556.742] -- 0:00:14
754000 -- (-553.404) (-555.507) [-551.700] (-554.135) * (-555.096) (-551.917) [-552.933] (-554.700) -- 0:00:14
754500 -- (-553.860) (-553.102) (-554.876) [-555.386] * (-555.613) (-552.861) [-552.870] (-553.208) -- 0:00:14
755000 -- [-553.920] (-552.784) (-552.261) (-555.158) * (-553.043) (-554.416) [-551.729] (-556.097) -- 0:00:14
Average standard deviation of split frequencies: 0.011265
755500 -- (-553.068) [-552.464] (-551.683) (-554.623) * (-553.183) (-556.136) [-554.900] (-552.670) -- 0:00:14
756000 -- (-551.865) (-553.754) (-551.553) [-552.388] * (-553.380) (-557.011) [-552.598] (-555.005) -- 0:00:14
756500 -- [-551.967] (-553.504) (-551.811) (-552.045) * (-551.632) (-557.640) (-553.174) [-553.618] -- 0:00:14
757000 -- (-553.408) (-552.487) (-553.291) [-556.217] * (-551.588) [-553.359] (-551.712) (-554.654) -- 0:00:14
757500 -- [-552.638] (-553.681) (-553.300) (-553.487) * (-552.034) (-554.766) [-553.211] (-553.034) -- 0:00:14
758000 -- (-554.532) (-551.834) [-552.866] (-553.514) * (-551.688) (-553.369) (-554.177) [-553.261] -- 0:00:14
758500 -- [-554.742] (-555.981) (-554.819) (-553.001) * (-555.447) (-551.737) (-552.966) [-554.668] -- 0:00:14
759000 -- [-553.559] (-553.459) (-551.221) (-553.563) * (-552.057) [-553.895] (-554.820) (-553.724) -- 0:00:14
759500 -- (-552.658) (-553.660) [-553.858] (-553.434) * [-551.853] (-556.156) (-556.046) (-553.943) -- 0:00:14
760000 -- [-552.979] (-552.549) (-553.026) (-557.183) * [-552.635] (-555.908) (-554.382) (-552.972) -- 0:00:14
Average standard deviation of split frequencies: 0.011486
760500 -- (-556.155) (-554.519) (-552.551) [-555.152] * (-555.906) [-552.860] (-557.015) (-554.778) -- 0:00:14
761000 -- (-557.139) (-555.151) [-552.362] (-551.729) * (-554.647) (-552.874) [-552.552] (-555.243) -- 0:00:14
761500 -- (-556.626) (-553.596) [-552.137] (-555.907) * (-553.875) (-552.534) [-553.796] (-556.793) -- 0:00:14
762000 -- (-553.836) [-554.717] (-553.749) (-556.475) * (-553.454) (-554.066) [-554.733] (-559.759) -- 0:00:14
762500 -- [-552.142] (-557.059) (-553.010) (-556.027) * (-553.785) [-551.644] (-552.366) (-553.743) -- 0:00:14
763000 -- (-552.576) (-556.713) [-551.725] (-553.335) * [-553.595] (-552.454) (-551.934) (-553.378) -- 0:00:13
763500 -- (-553.548) (-557.535) (-556.952) [-552.977] * [-555.785] (-554.094) (-552.489) (-553.261) -- 0:00:13
764000 -- (-552.215) (-552.412) (-553.410) [-555.314] * (-551.761) [-556.123] (-554.221) (-552.309) -- 0:00:13
764500 -- (-553.306) (-554.444) (-559.472) [-551.761] * (-552.038) [-556.263] (-554.623) (-554.358) -- 0:00:13
765000 -- (-552.604) [-552.887] (-553.359) (-551.477) * (-554.026) (-555.615) [-552.082] (-554.661) -- 0:00:13
Average standard deviation of split frequencies: 0.011652
765500 -- (-553.760) (-554.873) [-554.421] (-556.842) * [-553.813] (-552.869) (-552.460) (-555.088) -- 0:00:13
766000 -- (-555.055) [-553.832] (-555.561) (-559.789) * [-554.178] (-553.145) (-552.870) (-554.167) -- 0:00:13
766500 -- (-556.414) [-555.285] (-558.569) (-557.062) * (-553.441) [-555.992] (-556.327) (-552.440) -- 0:00:13
767000 -- [-553.707] (-556.102) (-556.833) (-552.157) * (-553.228) (-554.997) (-557.513) [-553.756] -- 0:00:13
767500 -- (-554.375) (-552.393) [-557.886] (-552.154) * [-552.379] (-553.156) (-553.336) (-553.970) -- 0:00:13
768000 -- (-553.912) [-552.393] (-555.389) (-553.071) * (-554.741) [-553.036] (-553.504) (-552.634) -- 0:00:13
768500 -- [-553.687] (-552.466) (-554.232) (-558.710) * (-553.874) (-555.665) (-553.408) [-552.633] -- 0:00:13
769000 -- (-551.885) (-553.617) (-552.463) [-555.397] * (-553.126) (-551.475) [-557.623] (-552.858) -- 0:00:13
769500 -- (-556.768) (-552.538) (-552.778) [-553.442] * (-552.047) (-559.723) [-552.636] (-558.009) -- 0:00:13
770000 -- [-552.050] (-552.129) (-553.257) (-551.211) * (-552.716) [-555.154] (-557.457) (-553.899) -- 0:00:13
Average standard deviation of split frequencies: 0.011907
770500 -- (-555.374) [-552.960] (-557.424) (-554.272) * (-551.521) (-553.992) (-554.368) [-553.806] -- 0:00:13
771000 -- (-554.251) [-554.622] (-553.790) (-552.538) * (-552.708) [-553.332] (-552.669) (-554.368) -- 0:00:13
771500 -- (-555.443) (-553.814) (-553.375) [-552.340] * (-552.479) (-555.084) (-551.931) [-551.196] -- 0:00:13
772000 -- (-552.027) (-555.397) [-552.294] (-553.231) * (-553.532) [-553.225] (-552.097) (-553.777) -- 0:00:13
772500 -- (-552.677) (-555.085) [-553.866] (-554.265) * (-554.011) [-552.946] (-552.893) (-553.512) -- 0:00:13
773000 -- (-553.691) (-555.314) [-555.988] (-554.545) * (-555.376) (-555.644) (-554.069) [-552.591] -- 0:00:13
773500 -- (-552.491) (-552.388) [-551.583] (-555.838) * (-553.888) (-551.854) (-551.706) [-554.028] -- 0:00:13
774000 -- (-552.533) [-555.823] (-553.039) (-552.775) * (-552.542) (-554.920) (-551.330) [-552.652] -- 0:00:13
774500 -- [-552.983] (-554.509) (-557.750) (-553.805) * [-551.470] (-552.386) (-551.705) (-553.675) -- 0:00:13
775000 -- (-555.395) (-556.595) [-553.058] (-552.770) * (-552.613) (-552.458) (-554.631) [-552.728] -- 0:00:13
Average standard deviation of split frequencies: 0.011826
775500 -- (-554.123) [-553.782] (-554.703) (-553.258) * (-554.217) (-558.205) [-554.497] (-553.137) -- 0:00:13
776000 -- (-553.461) (-553.034) [-553.073] (-553.077) * (-554.501) (-555.948) [-551.568] (-552.503) -- 0:00:13
776500 -- [-551.474] (-553.523) (-553.769) (-551.340) * [-554.454] (-555.725) (-552.633) (-554.012) -- 0:00:13
777000 -- (-552.211) [-556.526] (-551.875) (-552.156) * (-555.274) [-553.685] (-553.740) (-551.648) -- 0:00:13
777500 -- (-555.331) (-557.854) (-556.305) [-555.353] * (-553.950) (-553.398) [-552.834] (-553.386) -- 0:00:13
778000 -- (-556.826) (-553.923) [-553.398] (-552.480) * (-552.455) (-553.639) (-553.649) [-556.711] -- 0:00:13
778500 -- (-553.796) (-554.758) (-552.194) [-552.725] * (-554.476) (-553.514) (-554.390) [-554.436] -- 0:00:13
779000 -- (-552.079) [-556.567] (-553.897) (-555.328) * (-553.914) (-552.106) [-555.309] (-554.646) -- 0:00:13
779500 -- (-551.517) (-554.479) [-551.367] (-553.607) * (-555.200) (-551.706) [-554.214] (-553.667) -- 0:00:13
780000 -- (-552.143) (-555.628) (-551.360) [-554.144] * (-553.145) [-551.702] (-554.338) (-556.145) -- 0:00:12
Average standard deviation of split frequencies: 0.011352
780500 -- [-554.334] (-555.998) (-552.061) (-555.487) * (-556.248) (-551.673) [-552.883] (-554.263) -- 0:00:12
781000 -- (-555.222) (-551.800) (-554.826) [-554.695] * (-554.538) (-552.954) (-554.342) [-554.898] -- 0:00:12
781500 -- (-553.714) (-552.164) [-555.769] (-553.194) * (-553.084) (-558.724) (-553.469) [-553.502] -- 0:00:12
782000 -- (-554.100) (-555.880) (-553.768) [-554.662] * [-551.873] (-553.468) (-552.838) (-552.310) -- 0:00:12
782500 -- (-553.050) (-552.641) (-553.888) [-551.586] * (-551.898) (-554.929) (-554.263) [-551.524] -- 0:00:12
783000 -- (-554.279) (-552.869) (-554.604) [-552.101] * (-557.426) [-556.619] (-554.810) (-553.255) -- 0:00:12
783500 -- [-552.546] (-553.980) (-553.955) (-553.538) * (-553.944) (-552.595) [-554.806] (-553.632) -- 0:00:12
784000 -- (-554.540) (-554.360) [-553.122] (-554.029) * (-554.309) (-553.999) [-552.254] (-553.606) -- 0:00:12
784500 -- (-554.139) [-552.278] (-553.764) (-554.325) * (-557.426) (-553.735) (-553.241) [-555.940] -- 0:00:12
785000 -- (-553.833) (-552.143) [-555.385] (-553.266) * (-556.316) (-554.607) [-557.181] (-553.910) -- 0:00:12
Average standard deviation of split frequencies: 0.010796
785500 -- (-553.987) [-551.752] (-551.707) (-553.088) * (-554.444) [-553.187] (-553.818) (-554.024) -- 0:00:12
786000 -- (-552.401) (-552.518) [-554.365] (-552.555) * [-552.144] (-554.858) (-554.946) (-552.928) -- 0:00:12
786500 -- (-559.467) (-555.263) [-552.813] (-555.086) * (-553.639) [-555.748] (-552.377) (-559.450) -- 0:00:12
787000 -- (-554.657) (-552.450) (-554.764) [-554.562] * (-554.858) (-555.416) (-552.570) [-553.898] -- 0:00:12
787500 -- (-556.231) (-553.711) (-553.781) [-558.780] * (-552.511) [-553.787] (-553.718) (-551.991) -- 0:00:12
788000 -- (-556.230) (-553.701) (-554.490) [-556.682] * [-552.123] (-555.268) (-553.862) (-552.856) -- 0:00:12
788500 -- [-553.885] (-554.095) (-554.914) (-565.516) * (-551.722) [-553.166] (-553.159) (-553.607) -- 0:00:12
789000 -- [-555.575] (-553.949) (-557.096) (-552.971) * (-555.520) (-551.858) (-556.734) [-552.444] -- 0:00:12
789500 -- [-554.698] (-554.522) (-560.291) (-553.154) * (-553.903) [-553.770] (-553.158) (-553.749) -- 0:00:12
790000 -- (-552.762) (-553.359) [-556.441] (-556.795) * [-557.511] (-554.021) (-554.778) (-556.969) -- 0:00:12
Average standard deviation of split frequencies: 0.010295
790500 -- (-553.176) (-558.740) [-552.444] (-554.809) * (-552.703) [-551.548] (-552.496) (-553.750) -- 0:00:12
791000 -- (-553.969) (-554.430) [-553.164] (-552.852) * (-554.190) (-551.888) [-553.240] (-557.211) -- 0:00:12
791500 -- (-553.058) (-554.067) (-554.035) [-551.913] * (-553.019) [-552.890] (-552.790) (-553.484) -- 0:00:12
792000 -- (-552.856) [-555.516] (-554.091) (-554.709) * (-556.579) (-551.515) (-554.352) [-553.019] -- 0:00:12
792500 -- (-552.285) (-554.047) (-554.354) [-553.167] * [-552.985] (-551.773) (-557.352) (-553.648) -- 0:00:12
793000 -- [-554.350] (-554.877) (-553.363) (-552.629) * (-552.005) (-552.340) [-553.526] (-554.695) -- 0:00:12
793500 -- [-552.042] (-554.426) (-551.825) (-553.319) * [-554.386] (-552.082) (-554.898) (-553.282) -- 0:00:12
794000 -- (-557.364) (-553.719) (-552.414) [-552.788] * (-552.085) (-551.521) (-553.923) [-552.622] -- 0:00:12
794500 -- (-553.692) (-552.802) (-553.728) [-553.074] * (-554.582) [-552.955] (-557.015) (-556.331) -- 0:00:12
795000 -- [-556.335] (-557.040) (-554.673) (-552.607) * (-557.725) (-552.567) (-552.440) [-553.266] -- 0:00:12
Average standard deviation of split frequencies: 0.010541
795500 -- [-553.014] (-554.000) (-552.285) (-553.363) * (-555.702) (-554.606) [-552.350] (-553.453) -- 0:00:12
796000 -- (-552.918) (-554.503) (-553.101) [-551.887] * (-552.631) (-553.980) [-552.214] (-552.922) -- 0:00:12
796500 -- [-553.202] (-555.558) (-552.894) (-555.629) * [-555.259] (-552.704) (-551.939) (-554.493) -- 0:00:12
797000 -- (-552.713) [-555.155] (-552.316) (-555.599) * (-552.501) [-551.915] (-555.782) (-555.338) -- 0:00:11
797500 -- (-553.406) [-553.500] (-552.374) (-554.778) * (-552.204) (-553.313) [-552.534] (-554.533) -- 0:00:11
798000 -- [-553.793] (-553.076) (-553.441) (-554.776) * (-556.308) [-553.547] (-554.458) (-554.776) -- 0:00:11
798500 -- (-555.540) (-555.012) [-553.147] (-554.687) * (-552.737) (-552.608) [-554.856] (-552.221) -- 0:00:11
799000 -- (-554.390) (-553.321) (-558.486) [-552.143] * [-551.328] (-552.405) (-556.966) (-552.546) -- 0:00:11
799500 -- [-554.141] (-557.131) (-555.471) (-555.090) * [-552.110] (-552.121) (-553.415) (-554.283) -- 0:00:11
800000 -- (-554.487) (-553.226) (-554.676) [-555.319] * (-555.716) (-552.341) (-552.526) [-552.460] -- 0:00:11
Average standard deviation of split frequencies: 0.010637
800500 -- (-555.295) (-552.042) (-555.265) [-553.341] * (-556.895) [-554.272] (-554.582) (-556.772) -- 0:00:11
801000 -- (-552.784) (-553.193) [-552.532] (-553.890) * (-554.003) (-551.302) (-551.754) [-557.502] -- 0:00:11
801500 -- (-555.236) (-553.299) (-554.118) [-554.042] * [-552.486] (-555.299) (-553.950) (-553.352) -- 0:00:11
802000 -- (-555.429) (-552.972) [-553.121] (-553.284) * (-552.629) [-555.294] (-553.423) (-553.165) -- 0:00:11
802500 -- (-555.487) [-552.388] (-555.202) (-554.148) * (-552.301) [-553.972] (-556.518) (-552.733) -- 0:00:11
803000 -- (-560.356) [-553.304] (-552.256) (-556.229) * (-552.583) (-552.846) (-554.535) [-552.399] -- 0:00:11
803500 -- [-555.726] (-553.900) (-554.051) (-557.409) * [-552.933] (-555.353) (-552.286) (-551.711) -- 0:00:11
804000 -- (-555.755) (-556.723) (-555.647) [-555.655] * [-553.720] (-552.722) (-552.243) (-552.645) -- 0:00:11
804500 -- (-552.997) (-553.235) [-556.550] (-556.022) * (-552.854) (-553.699) (-552.933) [-554.567] -- 0:00:11
805000 -- (-554.058) (-553.995) (-555.066) [-558.659] * [-551.690] (-552.994) (-553.618) (-552.202) -- 0:00:11
Average standard deviation of split frequencies: 0.010099
805500 -- [-554.498] (-552.090) (-552.722) (-553.020) * (-552.950) [-555.437] (-552.477) (-553.075) -- 0:00:11
806000 -- (-552.532) (-551.885) [-553.753] (-551.754) * [-554.712] (-556.900) (-552.461) (-551.753) -- 0:00:11
806500 -- (-553.579) (-551.774) [-551.803] (-553.838) * (-558.447) [-559.170] (-554.804) (-553.136) -- 0:00:11
807000 -- [-553.326] (-555.168) (-552.551) (-552.846) * (-557.517) (-553.904) (-554.472) [-554.697] -- 0:00:11
807500 -- (-552.890) (-553.147) [-553.201] (-555.803) * (-553.797) (-552.443) [-552.782] (-558.458) -- 0:00:11
808000 -- (-555.248) [-551.206] (-557.380) (-555.618) * (-558.987) (-553.811) (-555.429) [-553.473] -- 0:00:11
808500 -- [-555.800] (-556.064) (-553.756) (-553.747) * (-557.088) (-553.564) (-554.298) [-552.220] -- 0:00:11
809000 -- (-554.999) [-553.185] (-554.591) (-553.551) * (-556.709) [-554.643] (-552.748) (-552.773) -- 0:00:11
809500 -- (-556.168) [-553.324] (-552.824) (-553.975) * (-555.452) (-556.389) (-554.423) [-551.603] -- 0:00:11
810000 -- (-553.542) (-551.505) (-552.419) [-552.442] * (-552.413) (-557.484) [-552.126] (-552.554) -- 0:00:11
Average standard deviation of split frequencies: 0.010157
810500 -- (-553.309) (-552.960) [-552.977] (-556.045) * (-552.444) (-555.647) [-552.571] (-554.705) -- 0:00:11
811000 -- (-552.744) [-552.723] (-551.881) (-557.178) * (-554.797) (-552.644) (-552.962) [-552.901] -- 0:00:11
811500 -- (-554.654) (-553.678) (-554.373) [-552.815] * (-556.919) [-554.120] (-552.194) (-553.371) -- 0:00:11
812000 -- (-553.721) (-552.273) [-554.766] (-555.185) * (-552.152) (-553.245) [-552.666] (-552.312) -- 0:00:11
812500 -- (-551.667) [-553.925] (-553.262) (-553.899) * (-554.129) (-559.916) (-554.106) [-552.433] -- 0:00:11
813000 -- [-552.623] (-554.152) (-552.610) (-553.817) * (-556.367) [-554.694] (-555.473) (-554.073) -- 0:00:11
813500 -- [-553.615] (-558.438) (-552.159) (-552.405) * [-553.147] (-552.943) (-554.200) (-553.065) -- 0:00:11
814000 -- [-551.305] (-552.543) (-554.808) (-553.259) * [-554.073] (-555.377) (-554.696) (-552.452) -- 0:00:10
814500 -- (-553.309) (-552.388) (-557.399) [-552.394] * (-553.046) [-553.817] (-552.362) (-551.942) -- 0:00:10
815000 -- (-556.772) (-553.325) [-551.531] (-552.302) * (-551.700) (-552.102) [-553.201] (-555.300) -- 0:00:10
Average standard deviation of split frequencies: 0.010013
815500 -- (-552.728) [-553.049] (-552.787) (-552.436) * (-556.328) (-551.938) [-552.640] (-554.671) -- 0:00:10
816000 -- (-552.053) (-554.079) (-552.490) [-556.914] * (-555.205) (-553.080) [-552.253] (-553.298) -- 0:00:10
816500 -- [-551.705] (-553.367) (-552.798) (-553.811) * [-553.185] (-552.076) (-552.224) (-552.267) -- 0:00:10
817000 -- (-552.770) (-554.234) (-551.789) [-552.266] * (-555.464) (-553.932) (-554.960) [-556.642] -- 0:00:10
817500 -- [-552.270] (-554.470) (-551.814) (-553.657) * (-555.370) (-554.310) [-552.214] (-553.084) -- 0:00:10
818000 -- (-555.315) (-557.261) (-551.334) [-553.364] * (-554.492) (-556.916) (-552.140) [-553.652] -- 0:00:10
818500 -- (-552.967) (-555.892) (-553.701) [-555.229] * (-555.589) (-554.517) (-553.439) [-551.867] -- 0:00:10
819000 -- (-554.791) [-553.184] (-552.791) (-551.700) * (-555.162) [-554.232] (-555.699) (-552.389) -- 0:00:10
819500 -- (-552.618) (-554.027) (-553.078) [-553.799] * (-552.633) (-556.346) [-553.418] (-555.428) -- 0:00:10
820000 -- (-555.332) [-552.853] (-553.983) (-552.179) * (-555.489) [-552.500] (-552.450) (-554.427) -- 0:00:10
Average standard deviation of split frequencies: 0.009612
820500 -- (-554.278) (-551.701) [-552.592] (-552.251) * (-553.903) (-552.765) [-551.680] (-555.679) -- 0:00:10
821000 -- (-552.819) (-553.021) [-554.293] (-553.113) * (-553.057) [-553.965] (-551.855) (-552.720) -- 0:00:10
821500 -- (-553.574) [-554.307] (-554.575) (-553.272) * (-552.815) (-553.580) [-551.745] (-553.109) -- 0:00:10
822000 -- (-554.252) [-552.440] (-553.496) (-558.645) * (-552.878) (-553.774) (-551.145) [-552.798] -- 0:00:10
822500 -- (-554.098) [-561.410] (-553.322) (-554.795) * (-553.260) [-552.748] (-552.107) (-552.694) -- 0:00:10
823000 -- [-551.685] (-555.430) (-552.509) (-552.810) * [-557.019] (-554.418) (-552.842) (-552.008) -- 0:00:10
823500 -- (-558.845) (-553.404) [-553.220] (-554.430) * (-552.087) (-556.721) [-551.184] (-552.882) -- 0:00:10
824000 -- (-556.971) [-555.846] (-554.548) (-554.140) * (-552.139) [-553.796] (-554.321) (-552.294) -- 0:00:10
824500 -- (-553.101) (-554.303) [-551.925] (-555.789) * (-552.878) [-552.492] (-551.701) (-552.274) -- 0:00:10
825000 -- (-555.243) (-553.636) (-553.509) [-555.549] * (-552.206) [-554.315] (-552.613) (-553.492) -- 0:00:10
Average standard deviation of split frequencies: 0.009664
825500 -- [-552.922] (-553.501) (-554.444) (-556.605) * (-552.237) (-556.693) (-552.230) [-551.972] -- 0:00:10
826000 -- [-553.882] (-554.097) (-556.391) (-555.924) * (-551.693) [-553.224] (-552.104) (-553.577) -- 0:00:10
826500 -- [-555.077] (-558.413) (-555.540) (-552.751) * (-556.045) (-555.084) (-553.736) [-555.374] -- 0:00:10
827000 -- (-553.195) (-558.079) (-557.454) [-554.834] * (-551.691) (-554.337) [-553.142] (-554.477) -- 0:00:10
827500 -- (-553.998) (-554.758) [-554.289] (-552.782) * (-551.972) (-554.863) (-552.221) [-553.988] -- 0:00:10
828000 -- [-552.980] (-552.806) (-552.310) (-552.450) * (-551.695) (-553.314) [-552.337] (-553.157) -- 0:00:10
828500 -- (-553.520) (-553.293) (-555.102) [-553.402] * (-557.756) (-554.221) (-551.569) [-555.494] -- 0:00:10
829000 -- (-553.342) [-552.985] (-553.690) (-552.381) * (-552.926) (-552.263) (-552.175) [-552.301] -- 0:00:10
829500 -- [-559.097] (-552.269) (-552.694) (-552.521) * (-554.652) (-554.435) (-554.359) [-552.458] -- 0:00:10
830000 -- [-558.139] (-552.221) (-552.535) (-552.345) * [-557.173] (-552.150) (-554.621) (-552.190) -- 0:00:10
Average standard deviation of split frequencies: 0.009912
830500 -- [-552.653] (-555.784) (-556.492) (-559.613) * (-555.775) (-556.852) (-554.476) [-552.394] -- 0:00:10
831000 -- (-558.447) [-554.728] (-557.832) (-558.274) * (-552.165) (-559.256) (-553.641) [-552.559] -- 0:00:09
831500 -- (-555.917) [-554.383] (-552.151) (-552.326) * (-552.242) [-553.027] (-554.506) (-555.863) -- 0:00:09
832000 -- [-555.105] (-554.339) (-554.340) (-552.770) * (-552.650) [-552.623] (-553.638) (-552.688) -- 0:00:09
832500 -- (-554.633) (-556.080) [-552.134] (-552.684) * [-557.193] (-553.600) (-552.908) (-556.720) -- 0:00:09
833000 -- (-553.555) (-551.778) (-554.390) [-555.272] * [-554.148] (-554.157) (-553.696) (-555.038) -- 0:00:09
833500 -- (-551.751) [-552.614] (-556.543) (-554.824) * (-553.644) (-553.968) (-557.190) [-554.851] -- 0:00:09
834000 -- (-554.224) (-551.786) (-552.475) [-553.429] * [-553.880] (-552.817) (-554.041) (-557.329) -- 0:00:09
834500 -- [-553.844] (-553.809) (-553.563) (-558.092) * (-552.472) (-555.079) [-557.966] (-557.121) -- 0:00:09
835000 -- [-552.452] (-553.700) (-553.793) (-551.848) * [-555.206] (-554.505) (-553.487) (-552.689) -- 0:00:09
Average standard deviation of split frequencies: 0.010375
835500 -- [-555.066] (-554.038) (-553.448) (-551.982) * [-552.814] (-553.329) (-552.242) (-553.110) -- 0:00:09
836000 -- (-555.551) (-554.533) (-559.090) [-551.808] * (-553.579) [-555.924] (-551.654) (-556.085) -- 0:00:09
836500 -- (-555.159) (-554.821) (-552.031) [-553.512] * (-552.992) (-553.016) (-552.099) [-557.515] -- 0:00:09
837000 -- (-556.637) (-554.268) [-551.848] (-552.799) * [-556.966] (-554.306) (-553.442) (-553.017) -- 0:00:09
837500 -- [-554.721] (-552.402) (-552.864) (-554.743) * (-554.093) (-552.092) [-552.730] (-553.174) -- 0:00:09
838000 -- (-554.003) (-554.123) [-554.117] (-556.382) * (-553.895) [-552.089] (-552.948) (-554.998) -- 0:00:09
838500 -- (-554.393) (-557.752) [-551.697] (-556.654) * [-554.485] (-553.956) (-554.093) (-554.138) -- 0:00:09
839000 -- (-552.854) (-556.155) [-552.639] (-551.837) * (-554.082) (-555.110) (-555.180) [-556.109] -- 0:00:09
839500 -- (-553.422) [-554.244] (-552.287) (-557.243) * [-552.294] (-552.103) (-552.237) (-556.817) -- 0:00:09
840000 -- [-555.659] (-554.397) (-552.657) (-551.787) * (-556.074) (-556.330) [-553.345] (-553.119) -- 0:00:09
Average standard deviation of split frequencies: 0.010243
840500 -- (-558.842) (-553.127) [-555.499] (-553.518) * (-553.323) [-552.959] (-556.713) (-552.127) -- 0:00:09
841000 -- (-558.349) [-555.100] (-551.967) (-555.820) * (-554.127) [-552.208] (-556.560) (-556.126) -- 0:00:09
841500 -- (-556.945) (-553.013) [-554.014] (-555.600) * (-552.995) (-552.372) (-556.804) [-552.375] -- 0:00:09
842000 -- (-552.433) (-553.331) [-553.228] (-554.119) * [-553.952] (-553.638) (-559.463) (-554.201) -- 0:00:09
842500 -- (-554.665) (-555.795) [-553.427] (-552.173) * [-553.086] (-551.477) (-556.910) (-556.744) -- 0:00:09
843000 -- [-553.464] (-551.829) (-553.483) (-553.384) * (-553.728) (-553.616) [-555.549] (-557.063) -- 0:00:09
843500 -- (-555.439) [-552.952] (-552.939) (-552.046) * (-556.755) [-552.569] (-553.167) (-556.846) -- 0:00:09
844000 -- (-557.536) (-551.897) (-552.660) [-552.997] * [-551.340] (-551.763) (-553.972) (-556.124) -- 0:00:09
844500 -- (-554.350) [-551.390] (-555.497) (-555.725) * (-552.032) [-551.684] (-554.229) (-556.256) -- 0:00:09
845000 -- (-554.104) [-553.619] (-553.774) (-553.043) * (-553.294) (-552.862) [-558.842] (-556.034) -- 0:00:09
Average standard deviation of split frequencies: 0.010253
845500 -- (-552.507) (-552.717) (-554.211) [-552.915] * [-553.843] (-552.739) (-552.763) (-554.240) -- 0:00:09
846000 -- (-552.131) (-553.439) [-553.876] (-551.999) * [-552.700] (-551.676) (-553.426) (-554.738) -- 0:00:09
846500 -- (-553.745) [-551.629] (-553.221) (-553.921) * (-551.152) [-554.912] (-562.717) (-554.614) -- 0:00:09
847000 -- (-552.869) (-552.176) (-552.859) [-553.007] * (-555.363) (-554.227) [-553.716] (-557.866) -- 0:00:09
847500 -- (-559.118) (-552.288) [-556.309] (-552.353) * (-554.997) [-557.681] (-551.847) (-554.291) -- 0:00:08
848000 -- (-554.562) (-553.291) [-555.076] (-553.337) * (-556.365) [-553.312] (-553.676) (-555.550) -- 0:00:08
848500 -- (-555.515) [-554.035] (-552.646) (-554.095) * (-555.375) (-554.101) (-555.172) [-555.982] -- 0:00:08
849000 -- (-552.687) [-553.892] (-556.347) (-554.390) * (-553.795) [-559.078] (-554.336) (-556.699) -- 0:00:08
849500 -- [-551.671] (-551.983) (-556.131) (-554.204) * [-553.960] (-557.445) (-552.296) (-556.954) -- 0:00:08
850000 -- (-553.081) (-553.668) [-553.189] (-552.377) * (-554.138) (-554.436) [-551.931] (-556.737) -- 0:00:08
Average standard deviation of split frequencies: 0.010492
850500 -- (-556.845) (-555.577) [-553.125] (-554.027) * (-553.438) [-552.467] (-551.855) (-555.967) -- 0:00:08
851000 -- (-552.465) (-554.746) (-552.697) [-552.252] * (-554.389) (-551.966) (-552.524) [-552.758] -- 0:00:08
851500 -- (-556.256) (-553.623) [-552.725] (-553.055) * (-553.941) [-553.609] (-551.234) (-553.490) -- 0:00:08
852000 -- (-554.651) [-554.140] (-555.526) (-556.070) * (-555.210) (-552.377) [-553.972] (-555.077) -- 0:00:08
852500 -- (-554.698) (-552.496) (-552.411) [-557.117] * (-553.726) (-551.364) (-552.207) [-554.344] -- 0:00:08
853000 -- (-554.888) (-552.252) [-552.043] (-556.453) * (-556.184) (-553.152) [-552.707] (-552.909) -- 0:00:08
853500 -- (-552.406) (-554.901) [-556.478] (-553.236) * (-553.614) (-553.122) [-554.654] (-554.060) -- 0:00:08
854000 -- (-558.360) (-552.504) (-553.909) [-554.231] * (-557.829) (-552.060) (-555.687) [-552.689] -- 0:00:08
854500 -- (-556.248) (-554.730) (-554.643) [-553.927] * (-552.120) (-554.342) (-552.266) [-554.554] -- 0:00:08
855000 -- (-554.033) [-554.229] (-556.937) (-552.814) * (-553.349) (-558.101) [-552.520] (-551.926) -- 0:00:08
Average standard deviation of split frequencies: 0.010096
855500 -- [-553.085] (-560.710) (-554.444) (-554.676) * (-554.990) (-554.433) [-552.711] (-553.021) -- 0:00:08
856000 -- (-551.941) (-555.850) (-555.129) [-552.664] * (-552.504) (-554.439) [-552.249] (-554.035) -- 0:00:08
856500 -- [-552.115] (-556.203) (-553.725) (-551.155) * (-552.089) (-556.112) [-553.627] (-552.669) -- 0:00:08
857000 -- (-553.113) (-557.286) [-554.614] (-552.527) * (-552.619) [-555.586] (-557.051) (-555.345) -- 0:00:08
857500 -- (-553.245) (-558.577) [-553.336] (-554.108) * [-553.116] (-553.078) (-553.680) (-553.947) -- 0:00:08
858000 -- (-552.836) [-556.194] (-552.362) (-557.489) * (-558.784) [-553.116] (-553.699) (-553.641) -- 0:00:08
858500 -- (-555.721) (-555.303) [-551.778] (-555.877) * (-559.070) [-553.948] (-555.030) (-557.300) -- 0:00:08
859000 -- [-553.399] (-555.135) (-556.278) (-555.371) * (-554.045) [-553.593] (-555.499) (-555.484) -- 0:00:08
859500 -- (-554.209) [-555.866] (-552.808) (-552.957) * (-551.641) (-556.457) [-555.057] (-554.781) -- 0:00:08
860000 -- [-552.782] (-553.640) (-552.651) (-556.447) * (-556.821) (-554.630) (-554.696) [-552.206] -- 0:00:08
Average standard deviation of split frequencies: 0.009640
860500 -- (-554.475) (-554.033) [-557.299] (-556.758) * (-559.395) [-555.645] (-555.977) (-553.151) -- 0:00:08
861000 -- (-556.050) (-559.381) [-553.614] (-553.844) * (-555.408) (-554.132) (-551.955) [-557.032] -- 0:00:08
861500 -- (-555.029) (-561.652) [-553.708] (-553.456) * [-552.217] (-553.208) (-554.243) (-553.615) -- 0:00:08
862000 -- (-553.863) [-551.506] (-553.319) (-551.359) * (-553.146) (-551.947) (-556.653) [-552.433] -- 0:00:08
862500 -- (-553.420) (-553.093) [-552.356] (-553.312) * (-552.770) (-552.211) [-554.220] (-551.582) -- 0:00:08
863000 -- (-554.569) [-552.151] (-555.400) (-553.255) * (-556.468) (-553.288) (-553.716) [-553.157] -- 0:00:08
863500 -- (-552.662) (-555.852) (-552.508) [-553.141] * (-552.741) (-553.857) [-552.582] (-556.294) -- 0:00:08
864000 -- (-554.464) (-557.080) (-552.121) [-553.180] * (-554.010) (-554.360) [-555.663] (-554.677) -- 0:00:08
864500 -- (-551.981) [-552.810] (-551.631) (-554.037) * (-555.859) (-552.051) (-553.024) [-551.768] -- 0:00:07
865000 -- (-556.574) [-553.551] (-551.833) (-554.000) * (-553.161) [-552.542] (-552.424) (-555.158) -- 0:00:07
Average standard deviation of split frequencies: 0.009290
865500 -- (-555.477) (-553.546) [-551.559] (-556.444) * (-555.204) [-553.501] (-553.557) (-553.616) -- 0:00:07
866000 -- (-556.044) (-552.725) (-553.040) [-553.673] * (-555.442) [-552.788] (-554.811) (-552.888) -- 0:00:07
866500 -- (-552.399) [-554.957] (-553.616) (-556.020) * (-553.171) (-551.608) [-551.957] (-554.601) -- 0:00:07
867000 -- [-553.859] (-552.841) (-554.101) (-554.313) * (-551.429) (-551.867) (-554.054) [-555.712] -- 0:00:07
867500 -- (-553.362) (-554.156) (-559.567) [-552.017] * (-555.913) [-551.954] (-553.299) (-553.515) -- 0:00:07
868000 -- [-554.754] (-559.969) (-552.781) (-555.801) * [-554.432] (-553.410) (-553.299) (-553.365) -- 0:00:07
868500 -- [-553.129] (-555.440) (-553.636) (-553.902) * [-553.847] (-553.061) (-552.691) (-552.188) -- 0:00:07
869000 -- (-552.381) (-552.929) (-551.583) [-554.705] * (-555.860) (-553.232) (-553.392) [-561.837] -- 0:00:07
869500 -- (-553.423) (-552.851) (-552.787) [-552.812] * (-554.467) [-554.928] (-552.741) (-560.662) -- 0:00:07
870000 -- (-554.993) [-553.384] (-553.645) (-553.882) * (-554.624) [-552.633] (-552.490) (-553.172) -- 0:00:07
Average standard deviation of split frequencies: 0.008988
870500 -- (-553.968) (-552.880) [-555.356] (-553.757) * (-553.562) (-551.632) [-556.808] (-556.141) -- 0:00:07
871000 -- (-555.361) (-553.630) (-551.526) [-551.582] * (-551.595) (-554.150) (-555.551) [-552.454] -- 0:00:07
871500 -- (-553.134) [-552.303] (-552.939) (-551.587) * (-551.510) (-551.770) (-557.071) [-553.155] -- 0:00:07
872000 -- (-555.374) [-551.732] (-551.639) (-554.452) * [-556.089] (-551.422) (-558.260) (-553.594) -- 0:00:07
872500 -- [-553.849] (-553.714) (-553.789) (-554.499) * [-553.865] (-551.372) (-554.999) (-553.064) -- 0:00:07
873000 -- (-554.490) (-552.626) [-552.767] (-553.645) * (-554.286) (-552.139) [-553.996] (-553.165) -- 0:00:07
873500 -- (-553.109) [-551.568] (-551.560) (-555.312) * (-552.920) (-552.052) (-552.414) [-553.045] -- 0:00:07
874000 -- (-552.364) (-552.541) [-556.067] (-554.820) * (-551.761) (-553.430) [-552.476] (-553.137) -- 0:00:07
874500 -- (-552.003) (-553.159) [-552.963] (-553.599) * (-552.500) (-552.122) [-553.280] (-554.823) -- 0:00:07
875000 -- (-552.056) [-560.058] (-552.623) (-553.036) * (-556.280) (-552.314) [-551.924] (-554.467) -- 0:00:07
Average standard deviation of split frequencies: 0.009041
875500 -- (-552.395) [-553.463] (-551.803) (-552.586) * (-551.790) [-553.648] (-553.037) (-554.126) -- 0:00:07
876000 -- (-556.541) (-553.945) (-554.540) [-553.781] * (-552.884) (-553.872) (-554.016) [-557.253] -- 0:00:07
876500 -- (-555.332) (-554.832) (-553.133) [-554.716] * (-552.194) (-555.325) (-551.625) [-553.837] -- 0:00:07
877000 -- (-557.689) (-553.241) (-554.009) [-553.204] * (-552.521) [-554.185] (-553.406) (-554.306) -- 0:00:07
877500 -- (-555.248) [-551.938] (-553.787) (-555.697) * (-554.162) [-553.276] (-551.343) (-551.915) -- 0:00:07
878000 -- (-557.779) (-552.834) (-552.837) [-553.636] * [-554.277] (-556.947) (-553.917) (-552.275) -- 0:00:07
878500 -- (-554.503) (-552.057) [-551.708] (-560.251) * [-552.377] (-554.027) (-553.947) (-554.227) -- 0:00:07
879000 -- (-552.798) [-555.690] (-553.737) (-554.292) * (-552.803) (-552.750) [-555.153] (-553.666) -- 0:00:07
879500 -- (-551.960) (-556.721) [-555.045] (-552.766) * [-552.991] (-554.204) (-554.045) (-555.284) -- 0:00:07
880000 -- (-556.789) (-554.181) (-553.163) [-552.652] * (-552.469) (-555.286) (-553.037) [-554.029] -- 0:00:07
Average standard deviation of split frequencies: 0.008779
880500 -- (-556.698) (-553.444) [-554.480] (-551.834) * (-552.520) [-552.454] (-552.479) (-554.182) -- 0:00:07
881000 -- (-552.918) (-551.554) [-552.411] (-553.247) * (-552.082) (-552.777) (-552.971) [-553.266] -- 0:00:07
881500 -- (-554.175) [-552.357] (-552.119) (-552.741) * [-553.214] (-552.060) (-556.545) (-552.265) -- 0:00:06
882000 -- (-555.133) (-553.835) (-554.034) [-552.155] * [-552.141] (-557.240) (-556.315) (-556.512) -- 0:00:06
882500 -- (-555.532) [-553.763] (-554.412) (-555.313) * (-556.016) (-553.092) [-551.804] (-555.428) -- 0:00:06
883000 -- (-555.508) [-554.275] (-553.523) (-553.231) * (-554.327) [-554.215] (-551.406) (-553.832) -- 0:00:06
883500 -- (-556.411) [-553.450] (-554.256) (-553.052) * (-552.894) (-553.017) (-551.927) [-553.091] -- 0:00:06
884000 -- (-552.665) (-556.372) (-552.823) [-555.496] * [-552.684] (-553.475) (-551.982) (-552.009) -- 0:00:06
884500 -- [-553.192] (-554.701) (-553.469) (-556.368) * (-552.702) (-554.070) [-552.886] (-554.317) -- 0:00:06
885000 -- (-555.746) (-554.797) [-553.489] (-553.624) * [-552.498] (-552.593) (-552.598) (-560.154) -- 0:00:06
Average standard deviation of split frequencies: 0.008939
885500 -- (-556.294) (-559.779) [-552.930] (-554.955) * (-551.725) (-553.127) (-554.846) [-552.891] -- 0:00:06
886000 -- [-552.631] (-554.309) (-555.302) (-557.523) * (-552.580) (-553.930) (-552.087) [-552.318] -- 0:00:06
886500 -- (-553.141) (-554.430) [-555.838] (-557.063) * (-553.394) (-553.744) [-553.087] (-553.435) -- 0:00:06
887000 -- (-552.745) (-556.431) (-553.512) [-556.393] * (-553.152) [-553.238] (-555.380) (-552.752) -- 0:00:06
887500 -- (-551.842) (-553.933) (-560.699) [-554.884] * [-551.729] (-551.727) (-555.240) (-554.853) -- 0:00:06
888000 -- (-553.602) (-553.562) (-555.859) [-554.595] * (-552.360) (-554.206) (-554.225) [-552.827] -- 0:00:06
888500 -- [-554.261] (-554.393) (-554.439) (-553.005) * (-552.129) (-554.420) [-554.215] (-556.083) -- 0:00:06
889000 -- (-554.067) (-552.570) (-555.240) [-552.202] * [-553.683] (-554.807) (-554.595) (-556.981) -- 0:00:06
889500 -- (-553.906) (-552.662) [-553.332] (-551.951) * (-552.368) (-556.663) (-556.431) [-555.736] -- 0:00:06
890000 -- [-551.669] (-552.133) (-552.637) (-551.508) * (-553.176) [-553.745] (-554.435) (-556.828) -- 0:00:06
Average standard deviation of split frequencies: 0.008998
890500 -- (-551.702) (-554.158) (-554.302) [-552.156] * (-554.716) [-554.345] (-554.454) (-553.304) -- 0:00:06
891000 -- [-552.348] (-551.843) (-556.039) (-554.927) * (-554.841) (-552.877) [-556.297] (-553.362) -- 0:00:06
891500 -- (-551.858) (-560.225) (-553.544) [-555.420] * [-553.972] (-555.769) (-554.204) (-553.636) -- 0:00:06
892000 -- [-557.666] (-557.634) (-554.356) (-555.356) * (-552.759) [-553.960] (-555.491) (-554.715) -- 0:00:06
892500 -- (-552.490) (-556.975) (-552.999) [-556.025] * (-553.983) (-554.769) (-553.212) [-553.330] -- 0:00:06
893000 -- (-552.357) [-553.597] (-557.184) (-553.746) * (-555.186) (-552.931) [-552.740] (-555.107) -- 0:00:06
893500 -- (-552.804) (-558.048) (-556.409) [-553.027] * [-553.374] (-553.605) (-551.794) (-552.807) -- 0:00:06
894000 -- [-554.258] (-555.865) (-558.061) (-555.268) * (-553.791) (-551.715) (-551.664) [-552.208] -- 0:00:06
894500 -- [-552.233] (-555.156) (-554.808) (-555.955) * (-555.921) [-553.201] (-551.603) (-552.778) -- 0:00:06
895000 -- (-552.997) (-555.463) (-552.362) [-552.081] * (-552.021) (-554.466) (-553.465) [-552.627] -- 0:00:06
Average standard deviation of split frequencies: 0.008734
895500 -- (-554.426) (-553.963) [-552.018] (-556.962) * (-553.506) [-553.208] (-554.256) (-552.629) -- 0:00:06
896000 -- (-554.498) (-555.106) (-556.582) [-552.667] * (-552.151) (-554.790) (-555.173) [-552.347] -- 0:00:06
896500 -- [-555.380] (-555.363) (-554.495) (-560.487) * [-552.009] (-553.336) (-552.805) (-552.568) -- 0:00:06
897000 -- [-554.928] (-554.028) (-558.090) (-554.111) * (-555.540) [-553.146] (-553.943) (-555.074) -- 0:00:06
897500 -- (-554.857) [-555.316] (-559.486) (-551.753) * (-553.740) [-551.334] (-553.349) (-555.503) -- 0:00:06
898000 -- (-556.025) (-553.672) [-552.958] (-553.761) * (-552.140) (-551.610) [-552.914] (-553.389) -- 0:00:06
898500 -- (-552.723) (-552.221) [-553.287] (-556.030) * [-553.733] (-554.236) (-552.727) (-553.201) -- 0:00:05
899000 -- (-553.137) [-554.106] (-551.905) (-557.139) * (-555.958) (-557.858) (-552.161) [-554.133] -- 0:00:05
899500 -- (-554.809) (-555.082) (-553.615) [-555.534] * (-553.462) [-551.997] (-552.348) (-555.253) -- 0:00:05
900000 -- [-552.992] (-554.117) (-556.522) (-552.749) * (-558.884) (-553.024) [-551.984] (-554.224) -- 0:00:05
Average standard deviation of split frequencies: 0.008130
900500 -- (-551.804) (-555.104) (-552.282) [-555.303] * (-558.021) (-553.270) [-552.312] (-553.912) -- 0:00:05
901000 -- (-552.800) (-559.500) (-555.668) [-552.250] * (-551.512) (-554.095) (-552.528) [-553.841] -- 0:00:05
901500 -- (-556.484) (-552.407) [-552.112] (-555.446) * [-552.144] (-553.380) (-551.770) (-553.313) -- 0:00:05
902000 -- (-560.818) (-553.131) (-557.594) [-552.530] * (-556.935) (-551.984) (-553.573) [-555.820] -- 0:00:05
902500 -- [-559.898] (-556.426) (-554.013) (-552.182) * (-553.441) [-552.322] (-555.444) (-553.882) -- 0:00:05
903000 -- (-561.374) [-553.849] (-554.163) (-555.899) * (-554.789) [-552.502] (-560.387) (-553.884) -- 0:00:05
903500 -- (-554.622) (-551.739) [-553.088] (-555.674) * (-556.750) (-552.577) (-551.861) [-553.308] -- 0:00:05
904000 -- [-553.494] (-554.500) (-558.281) (-553.583) * (-553.930) [-552.477] (-551.927) (-553.503) -- 0:00:05
904500 -- (-554.267) (-554.741) [-554.156] (-554.892) * (-554.401) [-557.796] (-553.629) (-552.350) -- 0:00:05
905000 -- [-553.515] (-552.698) (-553.348) (-552.678) * (-553.055) [-557.024] (-555.923) (-551.786) -- 0:00:05
Average standard deviation of split frequencies: 0.007805
905500 -- [-552.695] (-552.902) (-552.350) (-558.150) * [-554.370] (-558.241) (-555.963) (-555.967) -- 0:00:05
906000 -- [-553.414] (-554.143) (-551.522) (-553.622) * (-554.178) [-551.446] (-555.116) (-554.182) -- 0:00:05
906500 -- (-551.191) [-552.389] (-553.584) (-557.499) * (-556.845) [-552.659] (-552.174) (-552.890) -- 0:00:05
907000 -- (-551.161) [-554.661] (-554.429) (-552.751) * [-552.334] (-552.406) (-552.022) (-554.209) -- 0:00:05
907500 -- (-552.959) (-554.046) (-554.338) [-552.554] * (-552.508) (-553.861) [-552.417] (-554.632) -- 0:00:05
908000 -- [-553.379] (-556.204) (-557.107) (-551.310) * (-554.364) (-554.081) [-552.093] (-555.716) -- 0:00:05
908500 -- (-555.086) (-552.296) [-553.409] (-552.815) * (-554.584) [-553.810] (-551.716) (-552.521) -- 0:00:05
909000 -- (-554.067) (-552.479) [-552.633] (-555.178) * [-551.324] (-553.412) (-553.660) (-553.346) -- 0:00:05
909500 -- (-555.226) [-554.349] (-553.999) (-552.314) * (-551.580) [-553.883] (-552.659) (-555.487) -- 0:00:05
910000 -- [-553.274] (-553.720) (-553.567) (-553.315) * (-557.022) (-554.335) [-555.578] (-554.904) -- 0:00:05
Average standard deviation of split frequencies: 0.008351
910500 -- [-552.895] (-551.498) (-552.214) (-553.078) * (-557.303) (-555.353) (-552.328) [-554.786] -- 0:00:05
911000 -- [-552.244] (-554.964) (-551.712) (-554.768) * (-555.611) (-555.904) (-552.310) [-552.521] -- 0:00:05
911500 -- (-552.450) (-553.062) [-552.239] (-556.975) * (-553.645) [-556.250] (-554.166) (-555.188) -- 0:00:05
912000 -- (-555.413) [-553.238] (-553.738) (-551.847) * (-555.006) [-555.754] (-553.947) (-552.838) -- 0:00:05
912500 -- (-552.927) (-555.219) (-554.640) [-552.129] * (-556.621) [-552.351] (-556.955) (-553.792) -- 0:00:05
913000 -- (-553.792) [-556.624] (-553.391) (-552.372) * (-551.688) (-552.725) [-555.853] (-551.834) -- 0:00:05
913500 -- (-556.649) (-555.558) (-555.026) [-552.987] * (-554.064) (-553.465) (-556.381) [-553.423] -- 0:00:05
914000 -- (-552.248) (-554.349) (-555.014) [-552.956] * (-553.301) (-555.918) (-554.533) [-552.765] -- 0:00:05
914500 -- (-553.208) (-556.118) (-553.438) [-552.436] * (-552.906) [-553.419] (-559.079) (-553.792) -- 0:00:05
915000 -- [-551.797] (-557.669) (-554.574) (-555.816) * [-552.353] (-558.529) (-551.851) (-552.872) -- 0:00:05
Average standard deviation of split frequencies: 0.007925
915500 -- (-551.878) (-553.985) (-552.727) [-552.800] * [-553.024] (-554.373) (-552.329) (-554.826) -- 0:00:04
916000 -- (-552.080) (-554.171) [-552.417] (-555.906) * (-555.326) (-553.881) (-552.554) [-553.381] -- 0:00:04
916500 -- [-553.449] (-559.545) (-551.876) (-555.433) * (-555.637) (-554.893) (-555.069) [-553.198] -- 0:00:04
917000 -- (-553.190) [-553.334] (-556.051) (-554.349) * (-560.030) [-552.287] (-556.551) (-555.676) -- 0:00:04
917500 -- (-553.285) (-551.773) [-552.134] (-553.003) * (-552.628) [-551.701] (-552.247) (-557.564) -- 0:00:04
918000 -- [-554.567] (-552.738) (-553.066) (-552.988) * (-551.651) (-552.087) [-551.965] (-554.318) -- 0:00:04
918500 -- (-552.750) [-552.297] (-553.134) (-556.686) * [-551.812] (-554.248) (-553.739) (-552.855) -- 0:00:04
919000 -- (-551.799) (-554.118) [-555.281] (-552.930) * (-551.948) (-556.696) (-560.831) [-553.233] -- 0:00:04
919500 -- (-553.627) [-553.168] (-554.896) (-552.393) * (-551.792) [-553.942] (-552.522) (-555.073) -- 0:00:04
920000 -- (-555.773) (-552.476) (-554.305) [-551.960] * (-552.336) [-552.089] (-553.044) (-552.648) -- 0:00:04
Average standard deviation of split frequencies: 0.007988
920500 -- [-554.037] (-553.772) (-552.739) (-555.087) * (-554.154) [-552.096] (-553.893) (-555.489) -- 0:00:04
921000 -- (-553.199) (-553.513) [-555.463] (-551.509) * (-552.201) [-554.165] (-558.569) (-553.496) -- 0:00:04
921500 -- (-552.630) (-553.701) (-554.400) [-553.513] * [-553.431] (-553.389) (-554.200) (-551.733) -- 0:00:04
922000 -- [-552.567] (-554.923) (-554.249) (-553.038) * (-552.182) (-556.448) (-553.520) [-556.135] -- 0:00:04
922500 -- (-556.524) (-552.002) (-553.735) [-556.210] * (-552.712) (-559.647) (-552.205) [-554.033] -- 0:00:04
923000 -- (-552.884) (-551.920) (-555.553) [-556.424] * [-553.788] (-554.034) (-552.446) (-555.331) -- 0:00:04
923500 -- [-551.884] (-552.226) (-552.936) (-559.798) * (-551.749) (-553.730) [-552.176] (-552.311) -- 0:00:04
924000 -- (-556.906) (-551.964) (-553.578) [-553.972] * (-554.149) (-555.733) (-552.470) [-552.582] -- 0:00:04
924500 -- [-560.773] (-551.581) (-553.255) (-553.700) * (-554.947) (-554.092) [-552.041] (-554.114) -- 0:00:04
925000 -- (-558.327) (-554.423) [-552.443] (-555.736) * (-554.817) (-555.861) (-553.289) [-552.119] -- 0:00:04
Average standard deviation of split frequencies: 0.007840
925500 -- (-553.941) (-552.157) [-552.435] (-555.782) * (-555.077) (-557.544) [-554.517] (-555.789) -- 0:00:04
926000 -- [-554.904] (-551.450) (-553.781) (-552.405) * (-554.402) (-555.293) (-553.004) [-555.425] -- 0:00:04
926500 -- (-552.315) (-552.776) (-552.008) [-554.398] * (-554.669) (-557.863) [-551.485] (-552.543) -- 0:00:04
927000 -- (-555.337) (-552.719) (-552.512) [-557.156] * (-554.483) (-553.778) (-553.255) [-553.707] -- 0:00:04
927500 -- (-553.599) (-552.668) [-554.264] (-555.770) * (-553.577) (-554.768) [-556.050] (-552.874) -- 0:00:04
928000 -- (-554.246) [-552.066] (-556.228) (-551.583) * (-552.477) (-553.955) (-553.026) [-553.287] -- 0:00:04
928500 -- (-553.203) (-551.553) (-557.493) [-552.853] * (-552.341) (-551.820) [-553.165] (-552.945) -- 0:00:04
929000 -- (-552.567) [-554.321] (-554.087) (-553.880) * [-552.849] (-553.443) (-555.331) (-556.424) -- 0:00:04
929500 -- (-554.090) [-552.222] (-558.828) (-552.263) * [-552.542] (-552.730) (-553.808) (-552.975) -- 0:00:04
930000 -- (-556.419) (-554.068) [-554.474] (-555.018) * (-553.354) (-554.553) [-558.065] (-552.702) -- 0:00:04
Average standard deviation of split frequencies: 0.007902
930500 -- (-551.649) (-554.704) [-552.809] (-552.919) * (-554.806) [-551.672] (-555.050) (-555.879) -- 0:00:04
931000 -- (-553.992) [-556.475] (-551.967) (-554.955) * (-555.456) (-552.592) (-552.671) [-553.307] -- 0:00:04
931500 -- (-552.302) (-554.789) (-551.749) [-553.834] * (-551.675) (-554.020) (-553.782) [-552.149] -- 0:00:04
932000 -- [-554.352] (-552.226) (-555.121) (-556.023) * (-552.764) (-554.270) [-554.638] (-552.277) -- 0:00:04
932500 -- (-551.399) (-553.428) [-553.934] (-553.759) * [-558.031] (-553.053) (-554.137) (-553.943) -- 0:00:03
933000 -- [-553.163] (-552.289) (-557.063) (-551.640) * (-552.924) [-551.894] (-555.614) (-552.598) -- 0:00:03
933500 -- (-553.578) (-554.580) (-557.289) [-551.747] * (-553.701) (-553.622) (-555.608) [-552.537] -- 0:00:03
934000 -- (-552.023) (-553.470) [-552.890] (-555.309) * (-551.795) (-554.354) [-555.608] (-556.752) -- 0:00:03
934500 -- [-551.824] (-553.352) (-553.178) (-554.535) * (-552.007) (-553.250) [-553.794] (-554.740) -- 0:00:03
935000 -- (-552.710) [-555.516] (-553.767) (-554.658) * (-553.711) (-555.891) (-552.455) [-551.898] -- 0:00:03
Average standard deviation of split frequencies: 0.007790
935500 -- (-557.940) [-553.994] (-554.591) (-552.702) * (-554.379) (-555.788) (-553.901) [-551.854] -- 0:00:03
936000 -- [-553.116] (-553.250) (-555.699) (-551.774) * (-556.861) (-553.944) [-552.951] (-554.007) -- 0:00:03
936500 -- [-552.204] (-553.357) (-552.918) (-556.779) * [-555.109] (-551.758) (-551.981) (-555.503) -- 0:00:03
937000 -- [-552.757] (-553.422) (-553.039) (-552.722) * (-554.573) (-551.503) (-551.953) [-551.998] -- 0:00:03
937500 -- [-555.407] (-551.865) (-554.805) (-553.804) * [-552.970] (-553.698) (-554.479) (-553.774) -- 0:00:03
938000 -- [-551.962] (-552.531) (-554.044) (-552.424) * (-554.759) (-552.391) (-551.896) [-553.374] -- 0:00:03
938500 -- (-551.513) (-556.295) [-553.512] (-552.504) * (-553.693) (-553.326) [-551.838] (-554.634) -- 0:00:03
939000 -- (-552.582) (-552.967) [-553.985] (-553.354) * (-551.674) (-552.652) [-553.304] (-552.197) -- 0:00:03
939500 -- (-556.556) (-555.890) [-554.413] (-554.947) * (-553.253) [-554.652] (-552.548) (-553.129) -- 0:00:03
940000 -- (-557.004) (-555.664) [-553.028] (-551.792) * (-552.654) (-554.550) [-551.831] (-551.872) -- 0:00:03
Average standard deviation of split frequencies: 0.007885
940500 -- (-551.645) (-560.415) [-552.039] (-552.654) * (-552.624) (-556.902) (-553.649) [-553.653] -- 0:00:03
941000 -- [-551.680] (-552.620) (-553.893) (-553.417) * [-552.667] (-554.258) (-552.800) (-556.552) -- 0:00:03
941500 -- [-554.266] (-552.753) (-554.695) (-554.223) * (-553.248) (-552.951) [-553.326] (-553.627) -- 0:00:03
942000 -- (-553.192) [-551.678] (-552.991) (-552.755) * (-551.878) (-553.203) [-552.203] (-551.923) -- 0:00:03
942500 -- [-553.989] (-553.233) (-554.399) (-556.197) * (-554.202) [-552.851] (-555.176) (-552.700) -- 0:00:03
943000 -- (-551.893) (-551.755) [-552.488] (-553.752) * [-552.132] (-553.700) (-554.660) (-553.152) -- 0:00:03
943500 -- (-556.126) [-551.816] (-553.663) (-552.577) * (-553.536) (-557.353) (-554.301) [-551.596] -- 0:00:03
944000 -- (-553.106) [-551.598] (-553.435) (-557.246) * [-553.066] (-555.655) (-554.762) (-553.573) -- 0:00:03
944500 -- [-553.512] (-551.657) (-556.100) (-553.270) * (-557.224) (-555.895) [-554.253] (-555.844) -- 0:00:03
945000 -- (-555.779) [-552.439] (-554.583) (-557.468) * (-555.690) (-555.059) [-552.459] (-552.021) -- 0:00:03
Average standard deviation of split frequencies: 0.007940
945500 -- (-558.403) [-552.543] (-554.531) (-558.723) * (-553.057) [-556.767] (-551.967) (-551.594) -- 0:00:03
946000 -- (-556.879) (-552.985) [-552.569] (-555.686) * (-551.559) (-558.851) [-555.314] (-551.908) -- 0:00:03
946500 -- (-557.211) (-554.105) (-552.799) [-552.348] * (-551.832) [-553.042] (-553.977) (-552.787) -- 0:00:03
947000 -- [-555.754] (-553.505) (-556.181) (-552.304) * (-552.366) (-554.563) [-553.602] (-554.508) -- 0:00:03
947500 -- (-553.308) (-559.844) [-554.230] (-552.915) * (-551.721) (-555.472) (-553.869) [-554.666] -- 0:00:03
948000 -- (-553.062) (-555.975) (-553.049) [-554.743] * (-552.232) [-553.949] (-553.246) (-553.239) -- 0:00:03
948500 -- (-551.802) [-553.443] (-552.811) (-555.526) * (-553.518) (-554.643) [-554.881] (-555.462) -- 0:00:03
949000 -- (-554.409) [-552.078] (-553.303) (-554.899) * (-553.212) (-551.198) [-552.225] (-554.946) -- 0:00:03
949500 -- (-556.250) (-552.384) (-554.498) [-553.432] * [-553.917] (-554.735) (-551.363) (-558.812) -- 0:00:02
950000 -- (-557.619) [-552.425] (-553.201) (-554.350) * (-556.306) (-553.907) (-552.759) [-557.628] -- 0:00:02
Average standard deviation of split frequencies: 0.007769
950500 -- (-553.383) (-551.821) [-553.200] (-554.376) * (-556.042) [-557.182] (-554.795) (-557.545) -- 0:00:02
951000 -- [-552.213] (-552.376) (-554.540) (-554.704) * (-554.483) (-554.694) (-555.993) [-555.660] -- 0:00:02
951500 -- (-552.292) (-552.941) (-553.587) [-552.092] * (-552.781) [-552.492] (-554.014) (-554.665) -- 0:00:02
952000 -- (-553.646) (-553.440) (-552.860) [-556.283] * (-553.242) [-552.896] (-552.177) (-552.619) -- 0:00:02
952500 -- (-553.854) (-553.060) [-552.910] (-556.644) * (-552.838) [-552.604] (-553.124) (-554.594) -- 0:00:02
953000 -- [-554.652] (-554.259) (-552.107) (-556.698) * [-552.264] (-553.609) (-554.609) (-555.291) -- 0:00:02
953500 -- (-555.794) (-556.046) [-553.757] (-555.325) * (-552.810) (-556.317) (-551.454) [-555.419] -- 0:00:02
954000 -- (-552.651) (-559.316) (-552.998) [-556.655] * [-551.816] (-553.967) (-552.194) (-552.915) -- 0:00:02
954500 -- (-552.207) (-557.194) [-551.722] (-552.769) * [-551.825] (-552.455) (-553.572) (-551.792) -- 0:00:02
955000 -- (-552.010) (-560.060) (-551.499) [-555.198] * [-551.836] (-552.936) (-555.221) (-553.469) -- 0:00:02
Average standard deviation of split frequencies: 0.007922
955500 -- [-555.466] (-553.619) (-553.731) (-555.349) * (-557.807) [-552.179] (-557.378) (-553.528) -- 0:00:02
956000 -- [-553.937] (-552.880) (-555.417) (-552.845) * (-554.062) (-554.137) (-557.551) [-553.864] -- 0:00:02
956500 -- (-559.988) [-553.082] (-553.366) (-553.017) * [-552.267] (-552.887) (-556.534) (-554.596) -- 0:00:02
957000 -- (-553.918) [-553.115] (-552.217) (-551.815) * (-553.400) (-553.296) [-552.281] (-553.738) -- 0:00:02
957500 -- (-555.056) (-554.920) (-553.387) [-551.726] * (-552.793) (-554.309) (-553.257) [-551.790] -- 0:00:02
958000 -- (-553.648) (-552.093) (-552.272) [-555.385] * (-552.752) [-553.262] (-553.086) (-552.305) -- 0:00:02
958500 -- (-554.080) (-557.427) (-552.573) [-552.958] * (-551.659) (-555.408) [-552.852] (-552.270) -- 0:00:02
959000 -- (-551.976) (-554.866) [-551.874] (-554.638) * (-552.765) [-556.410] (-555.133) (-555.155) -- 0:00:02
959500 -- (-554.689) [-554.242] (-552.237) (-552.141) * [-555.394] (-554.277) (-552.996) (-556.611) -- 0:00:02
960000 -- (-552.173) [-552.076] (-553.160) (-555.733) * (-554.017) (-554.714) (-552.853) [-552.618] -- 0:00:02
Average standard deviation of split frequencies: 0.008146
960500 -- (-553.896) [-552.342] (-555.316) (-553.236) * [-551.262] (-551.602) (-552.974) (-553.666) -- 0:00:02
961000 -- (-560.184) (-557.112) (-555.723) [-551.872] * [-551.327] (-553.350) (-555.474) (-554.762) -- 0:00:02
961500 -- (-564.819) (-554.540) [-552.890] (-552.296) * [-555.775] (-554.447) (-553.867) (-551.342) -- 0:00:02
962000 -- (-563.471) [-553.204] (-553.178) (-552.296) * (-556.011) (-557.789) (-552.831) [-555.014] -- 0:00:02
962500 -- (-562.045) (-553.794) [-551.705] (-552.304) * (-553.564) (-555.367) [-552.392] (-553.516) -- 0:00:02
963000 -- (-556.407) (-551.887) [-556.829] (-553.452) * (-552.746) (-559.098) [-551.319] (-554.490) -- 0:00:02
963500 -- (-553.885) [-551.776] (-551.753) (-552.377) * (-553.221) (-553.143) [-552.531] (-555.914) -- 0:00:02
964000 -- (-554.790) (-554.586) [-552.807] (-551.993) * (-554.915) (-553.893) [-552.221] (-555.015) -- 0:00:02
964500 -- [-557.149] (-556.263) (-551.928) (-553.392) * [-557.407] (-553.491) (-551.887) (-555.350) -- 0:00:02
965000 -- (-557.790) (-552.990) [-552.448] (-552.943) * (-553.751) (-553.257) (-552.052) [-555.999] -- 0:00:02
Average standard deviation of split frequencies: 0.008166
965500 -- [-553.312] (-552.068) (-554.155) (-552.024) * (-555.404) (-551.944) [-552.857] (-555.384) -- 0:00:02
966000 -- (-555.860) [-553.348] (-552.384) (-553.715) * (-553.744) [-551.962] (-557.110) (-552.399) -- 0:00:02
966500 -- [-554.565] (-553.523) (-553.142) (-553.931) * (-554.535) [-553.951] (-554.440) (-553.064) -- 0:00:01
967000 -- [-554.868] (-553.959) (-553.882) (-553.490) * (-554.341) (-553.712) [-553.608] (-552.078) -- 0:00:01
967500 -- (-556.971) (-554.879) (-556.969) [-553.143] * (-552.929) (-553.602) (-553.565) [-553.370] -- 0:00:01
968000 -- [-555.072] (-553.849) (-555.252) (-553.261) * (-552.895) (-557.183) [-553.235] (-553.506) -- 0:00:01
968500 -- (-557.263) [-555.663] (-553.189) (-556.435) * (-552.578) [-552.777] (-552.530) (-554.919) -- 0:00:01
969000 -- (-552.799) (-553.094) (-554.517) [-555.024] * (-552.283) (-552.149) [-552.717] (-552.939) -- 0:00:01
969500 -- [-553.979] (-551.642) (-553.643) (-553.979) * [-551.956] (-552.746) (-551.755) (-555.452) -- 0:00:01
970000 -- [-551.879] (-553.333) (-558.895) (-557.325) * (-551.171) [-553.575] (-552.954) (-554.010) -- 0:00:01
Average standard deviation of split frequencies: 0.007770
970500 -- [-552.062] (-553.382) (-557.736) (-553.031) * (-551.916) (-551.652) (-554.057) [-554.656] -- 0:00:01
971000 -- (-553.788) (-554.541) [-552.180] (-551.365) * (-553.757) (-551.530) [-555.606] (-555.627) -- 0:00:01
971500 -- [-551.732] (-552.209) (-553.316) (-551.746) * (-558.151) (-551.823) [-555.260] (-554.738) -- 0:00:01
972000 -- (-553.259) (-556.748) (-557.412) [-551.901] * (-553.165) (-551.658) [-556.055] (-553.636) -- 0:00:01
972500 -- (-552.458) (-552.853) (-555.208) [-552.535] * (-553.111) [-552.485] (-552.815) (-554.388) -- 0:00:01
973000 -- [-552.451] (-552.555) (-554.316) (-554.435) * (-552.974) (-552.642) (-552.217) [-551.460] -- 0:00:01
973500 -- (-558.452) [-551.363] (-552.329) (-554.834) * (-554.817) [-551.816] (-552.672) (-551.376) -- 0:00:01
974000 -- (-551.966) [-554.788] (-552.594) (-554.361) * (-553.292) (-552.747) (-555.781) [-552.672] -- 0:00:01
974500 -- (-553.734) (-553.741) [-555.487] (-553.408) * (-554.327) (-556.279) (-552.886) [-551.818] -- 0:00:01
975000 -- (-551.677) [-552.186] (-556.292) (-551.659) * (-556.297) (-553.754) [-553.664] (-551.669) -- 0:00:01
Average standard deviation of split frequencies: 0.007921
975500 -- [-552.619] (-554.380) (-554.164) (-555.271) * (-552.216) [-552.937] (-553.747) (-556.501) -- 0:00:01
976000 -- (-552.976) (-552.282) (-553.490) [-551.768] * (-553.046) (-552.241) (-552.318) [-553.202] -- 0:00:01
976500 -- (-555.867) (-552.235) (-551.571) [-553.173] * [-553.113] (-558.315) (-552.440) (-551.935) -- 0:00:01
977000 -- [-552.612] (-553.492) (-552.869) (-553.820) * (-552.615) [-552.932] (-551.445) (-553.466) -- 0:00:01
977500 -- (-552.808) (-553.664) [-552.090] (-554.886) * [-553.614] (-552.762) (-552.247) (-552.975) -- 0:00:01
978000 -- (-555.729) (-551.842) (-555.923) [-552.568] * [-551.802] (-553.634) (-553.615) (-556.294) -- 0:00:01
978500 -- [-554.317] (-553.097) (-553.187) (-554.695) * (-551.783) (-553.743) [-552.111] (-559.593) -- 0:00:01
979000 -- (-557.039) (-555.850) [-553.203] (-552.030) * (-553.683) [-553.332] (-552.329) (-553.610) -- 0:00:01
979500 -- (-554.652) (-554.537) [-553.802] (-552.245) * (-555.444) [-553.031] (-551.869) (-553.384) -- 0:00:01
980000 -- (-554.929) (-551.640) (-555.973) [-555.384] * [-557.149] (-554.203) (-552.863) (-553.038) -- 0:00:01
Average standard deviation of split frequencies: 0.007563
980500 -- (-555.076) (-552.868) [-553.267] (-553.610) * (-553.546) (-552.934) (-552.435) [-553.122] -- 0:00:01
981000 -- (-553.506) (-554.928) [-554.660] (-552.509) * (-555.142) (-556.387) (-551.955) [-552.748] -- 0:00:01
981500 -- (-554.241) (-555.508) (-553.109) [-551.850] * [-554.035] (-554.094) (-552.487) (-557.037) -- 0:00:01
982000 -- (-551.856) [-553.672] (-555.110) (-555.349) * (-553.841) (-557.213) [-553.122] (-553.196) -- 0:00:01
982500 -- (-552.779) [-553.273] (-553.367) (-553.102) * [-551.685] (-553.030) (-552.199) (-553.366) -- 0:00:01
983000 -- (-551.540) (-555.266) (-553.540) [-552.869] * (-552.034) (-555.593) [-553.446] (-553.543) -- 0:00:01
983500 -- (-553.729) [-553.056] (-551.615) (-553.069) * (-551.956) [-555.031] (-552.704) (-553.597) -- 0:00:00
984000 -- (-552.760) (-553.970) [-554.276] (-555.336) * (-552.677) [-551.748] (-554.100) (-555.153) -- 0:00:00
984500 -- (-553.119) [-553.566] (-553.089) (-553.125) * (-552.438) [-556.792] (-552.679) (-551.718) -- 0:00:00
985000 -- (-552.784) (-553.272) [-554.145] (-555.150) * (-552.145) (-554.934) [-553.710] (-551.624) -- 0:00:00
Average standard deviation of split frequencies: 0.007554
985500 -- (-553.451) (-557.349) (-555.214) [-551.770] * (-556.708) [-554.438] (-552.160) (-553.240) -- 0:00:00
986000 -- [-554.658] (-552.789) (-552.278) (-553.724) * (-554.148) (-554.744) [-552.309] (-553.040) -- 0:00:00
986500 -- (-552.722) (-552.600) (-551.951) [-554.564] * [-553.247] (-557.056) (-553.696) (-552.593) -- 0:00:00
987000 -- (-552.909) [-552.178] (-552.761) (-558.638) * (-553.893) [-558.585] (-558.423) (-554.568) -- 0:00:00
987500 -- [-552.057] (-552.011) (-552.625) (-557.410) * (-558.096) (-552.550) [-553.529] (-554.996) -- 0:00:00
988000 -- (-552.599) [-552.010] (-552.357) (-554.460) * [-556.209] (-555.079) (-552.879) (-552.321) -- 0:00:00
988500 -- (-552.311) (-552.328) (-553.028) [-554.798] * (-555.741) (-555.555) (-552.530) [-555.351] -- 0:00:00
989000 -- (-555.354) [-552.597] (-558.032) (-554.277) * (-552.529) (-559.057) (-555.723) [-552.453] -- 0:00:00
989500 -- (-557.159) (-554.183) (-556.243) [-553.938] * (-553.248) [-553.560] (-552.979) (-553.406) -- 0:00:00
990000 -- (-555.471) (-553.705) (-553.815) [-554.644] * (-552.139) [-555.877] (-551.245) (-554.146) -- 0:00:00
Average standard deviation of split frequencies: 0.007296
990500 -- (-552.304) [-552.560] (-554.138) (-554.249) * [-551.768] (-552.776) (-555.051) (-557.789) -- 0:00:00
991000 -- (-552.266) (-552.630) [-552.864] (-551.738) * [-552.092] (-554.090) (-553.933) (-553.412) -- 0:00:00
991500 -- (-556.326) (-553.052) (-557.041) [-559.272] * [-552.356] (-553.764) (-553.723) (-554.359) -- 0:00:00
992000 -- [-554.233] (-555.099) (-553.363) (-553.662) * [-552.943] (-554.383) (-557.355) (-552.059) -- 0:00:00
992500 -- (-554.757) (-552.866) [-553.371] (-553.290) * [-553.559] (-554.097) (-551.690) (-558.404) -- 0:00:00
993000 -- (-561.948) (-553.121) (-556.508) [-558.642] * (-561.217) (-554.846) [-553.721] (-553.461) -- 0:00:00
993500 -- (-564.685) (-553.023) (-551.975) [-557.768] * (-556.775) [-554.225] (-551.679) (-556.680) -- 0:00:00
994000 -- (-551.684) (-551.500) (-552.526) [-554.497] * [-552.764] (-552.717) (-551.941) (-554.937) -- 0:00:00
994500 -- [-552.962] (-551.798) (-553.492) (-553.541) * (-558.969) (-552.051) [-552.484] (-554.784) -- 0:00:00
995000 -- (-552.287) (-553.578) (-552.541) [-553.365] * (-555.536) [-551.952] (-555.094) (-556.326) -- 0:00:00
Average standard deviation of split frequencies: 0.007478
995500 -- (-555.540) (-552.682) (-555.018) [-554.049] * [-552.766] (-557.603) (-557.454) (-552.662) -- 0:00:00
996000 -- (-556.055) (-553.230) (-554.526) [-559.159] * [-556.051] (-556.883) (-555.170) (-558.276) -- 0:00:00
996500 -- (-552.203) (-555.341) (-554.056) [-559.222] * (-552.264) (-552.765) (-551.938) [-554.831] -- 0:00:00
997000 -- (-553.919) (-552.057) (-554.143) [-553.035] * (-552.663) [-552.542] (-551.592) (-553.324) -- 0:00:00
997500 -- (-554.155) (-555.175) (-554.021) [-554.108] * (-554.118) (-552.847) [-554.796] (-554.823) -- 0:00:00
998000 -- (-552.387) [-552.907] (-553.680) (-551.700) * (-551.423) (-552.171) [-553.057] (-552.589) -- 0:00:00
998500 -- [-553.607] (-552.224) (-558.555) (-554.201) * (-551.428) [-551.561] (-552.813) (-552.840) -- 0:00:00
999000 -- (-553.676) [-554.441] (-556.664) (-555.963) * (-553.789) [-551.560] (-553.045) (-553.454) -- 0:00:00
999500 -- (-555.477) (-552.603) [-553.115] (-553.321) * (-553.554) (-552.811) (-555.925) [-552.481] -- 0:00:00
1000000 -- [-552.427] (-552.707) (-553.340) (-554.619) * (-552.674) (-553.493) [-553.491] (-556.466) -- 0:00:00
Average standard deviation of split frequencies: 0.007129
Analysis completed in 59 seconds
Analysis used 57.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -551.08
Likelihood of best state for "cold" chain of run 2 was -551.08
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 63 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.8 % ( 26 %) Dirichlet(Pi{all})
35.0 % ( 31 %) Slider(Pi{all})
78.3 % ( 48 %) Multiplier(Alpha{1,2})
77.7 % ( 51 %) Multiplier(Alpha{3})
24.9 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 81 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.5 % (100 %) Nodeslider(V{all})
30.5 % ( 15 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 75 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
34.6 % ( 30 %) Dirichlet(Pi{all})
33.9 % ( 23 %) Slider(Pi{all})
78.5 % ( 57 %) Multiplier(Alpha{1,2})
77.5 % ( 42 %) Multiplier(Alpha{3})
24.7 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.7 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166937 0.82 0.67
3 | 166694 166432 0.84
4 | 166919 166482 166536
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166871 0.82 0.67
3 | 166058 166496 0.84
4 | 166913 166694 166968
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -552.95
| 1 1 2 1 11 |
| 2 1 2 1 2 |
|21 22 2 12 2 2 2 2 1 1 |
| 1 1 111 2 2 * 122 22 21 |
| 1 2 1 1 * * 1 1 21 2|
|1 2 2 21 1 1 2 1 2 21 |
| 2 2 1 2 1 1 1 111 1 2 * 2 |
| 21 2 2 2 2 212 22 2 |
| 21 12 * 1 1 1 |
| 1 2 21 1 2 21 |
| 2 1 1 2 1 1 12 |
| |
| |
| 2 |
| 2 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -554.50
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -552.77 -556.06
2 -552.77 -556.56
--------------------------------------
TOTAL -552.77 -556.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894084 0.084884 0.353254 1.453920 0.864430 1478.85 1489.93 1.000
r(A<->C){all} 0.164411 0.020446 0.000074 0.458020 0.123223 204.09 363.28 1.000
r(A<->G){all} 0.161685 0.018144 0.000261 0.428213 0.126274 203.00 206.42 1.001
r(A<->T){all} 0.182620 0.020549 0.000164 0.465062 0.152375 130.43 196.98 1.000
r(C<->G){all} 0.164374 0.018970 0.000023 0.445916 0.128614 167.39 217.45 1.000
r(C<->T){all} 0.165022 0.019693 0.000052 0.442745 0.128992 156.38 239.21 1.005
r(G<->T){all} 0.161888 0.020073 0.000133 0.453407 0.119725 169.75 196.72 1.006
pi(A){all} 0.188148 0.000351 0.150420 0.223565 0.187962 1164.95 1273.42 1.000
pi(C){all} 0.308716 0.000503 0.267630 0.354628 0.309055 1254.47 1254.90 1.000
pi(G){all} 0.302940 0.000479 0.263196 0.348201 0.302433 1209.07 1270.36 1.000
pi(T){all} 0.200196 0.000389 0.162595 0.240174 0.199496 1247.39 1319.69 1.000
alpha{1,2} 0.426636 0.256601 0.000126 1.494055 0.249399 1175.47 1261.05 1.000
alpha{3} 0.448832 0.235838 0.000402 1.391626 0.281808 1414.90 1451.98 1.000
pinvar{all} 0.995883 0.000027 0.986775 0.999998 0.997493 1338.63 1360.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ..*..*
9 -- .*...*
10 -- ..****
11 -- .***.*
12 -- ..**..
13 -- .**.**
14 -- ..*.*.
15 -- .*..*.
16 -- .****.
17 -- .**...
18 -- ....**
19 -- .*.*..
20 -- .*.***
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.005653 0.148568 0.156562 2
8 458 0.152565 0.015075 0.141905 0.163225 2
9 448 0.149234 0.008480 0.143238 0.155230 2
10 448 0.149234 0.002827 0.147235 0.151233 2
11 436 0.145237 0.008480 0.139241 0.151233 2
12 432 0.143904 0.000942 0.143238 0.144570 2
13 429 0.142905 0.000471 0.142572 0.143238 2
14 428 0.142572 0.005653 0.138574 0.146569 2
15 427 0.142239 0.008951 0.135909 0.148568 2
16 423 0.140906 0.002355 0.139241 0.142572 2
17 418 0.139241 0.009422 0.132578 0.145903 2
18 414 0.137908 0.016017 0.126582 0.149234 2
19 410 0.136576 0.002827 0.134577 0.138574 2
20 406 0.135243 0.003769 0.132578 0.137908 2
21 400 0.133245 0.016017 0.121919 0.144570 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098377 0.010252 0.000038 0.313124 0.066724 1.000 2
length{all}[2] 0.099217 0.009165 0.000004 0.288656 0.070751 1.000 2
length{all}[3] 0.099784 0.009568 0.000013 0.298434 0.069312 1.000 2
length{all}[4] 0.102418 0.011113 0.000028 0.307966 0.068756 1.000 2
length{all}[5] 0.097465 0.009764 0.000011 0.302311 0.068016 1.000 2
length{all}[6] 0.099075 0.009612 0.000049 0.290004 0.069254 1.000 2
length{all}[7] 0.102480 0.010879 0.000191 0.315179 0.068832 0.998 2
length{all}[8] 0.103716 0.011222 0.000226 0.322762 0.071570 1.000 2
length{all}[9] 0.097657 0.009906 0.000161 0.289438 0.069119 1.001 2
length{all}[10] 0.101020 0.010822 0.000095 0.310430 0.065653 0.999 2
length{all}[11] 0.106794 0.011675 0.000006 0.328790 0.070429 0.999 2
length{all}[12] 0.095657 0.008007 0.000082 0.273025 0.066408 1.000 2
length{all}[13] 0.099027 0.009907 0.000515 0.299205 0.069700 1.006 2
length{all}[14] 0.095079 0.010913 0.000613 0.314619 0.056658 0.998 2
length{all}[15] 0.094066 0.009452 0.000103 0.293950 0.055954 0.999 2
length{all}[16] 0.093447 0.009488 0.000236 0.279762 0.063390 1.000 2
length{all}[17] 0.096885 0.008944 0.000038 0.292216 0.065768 0.999 2
length{all}[18] 0.107013 0.010524 0.000142 0.296101 0.076260 1.003 2
length{all}[19] 0.104440 0.010091 0.000401 0.308964 0.075884 0.998 2
length{all}[20] 0.097919 0.009438 0.000255 0.279114 0.070710 0.999 2
length{all}[21] 0.094444 0.008106 0.000064 0.276800 0.066110 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007129
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 405
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 135 / 135 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 135 / 135 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018240 0.012596 0.034277 0.028519 0.095308 0.020423 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -573.437405
Iterating by ming2
Initial: fx= 573.437405
x= 0.01824 0.01260 0.03428 0.02852 0.09531 0.02042 0.30000 1.30000
1 h-m-p 0.0000 0.0001 323.8926 ++ 563.472458 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0281 35.1041 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 296.0535 ++ 559.740022 m 0.0000 44 | 2/8
4 h-m-p 0.0004 0.0418 29.0725 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 264.8127 ++ 558.584361 m 0.0000 74 | 3/8
6 h-m-p 0.0002 0.0488 23.7116 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 229.1183 ++ 555.371588 m 0.0001 104 | 4/8
8 h-m-p 0.0006 0.0571 18.2941 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 186.9531 ++ 553.848916 m 0.0000 135 | 5/8
10 h-m-p 0.0005 0.0707 12.5548 -----------.. | 5/8
11 h-m-p 0.0000 0.0005 131.6680 +++ 545.729255 m 0.0005 167 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 545.729255 m 8.0000 178 | 6/8
13 h-m-p 0.1321 8.0000 0.0005 +++ 545.729255 m 8.0000 192 | 6/8
14 h-m-p 0.0160 8.0000 59.1358 +++++ 545.729197 m 8.0000 208 | 6/8
15 h-m-p 1.6000 8.0000 0.1257 ++ 545.729197 m 8.0000 219 | 6/8
16 h-m-p 0.3061 8.0000 3.2856 +++ 545.729197 m 8.0000 233 | 6/8
17 h-m-p 1.6000 8.0000 11.5735 ++ 545.729197 m 8.0000 244 | 6/8
18 h-m-p 0.1701 0.8655 544.1727 ++ 545.729196 m 0.8655 255 | 7/8
19 h-m-p 1.2629 6.3146 58.3084 ---------Y 545.729196 0 0.0000 275 | 7/8
20 h-m-p 0.8750 8.0000 0.0002 ----------C 545.729196 0 0.0000 296
Out..
lnL = -545.729196
297 lfun, 297 eigenQcodon, 1782 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042348 0.037926 0.026783 0.027432 0.029489 0.072709 999.000000 0.619159 0.361733
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.028027
np = 9
lnL0 = -576.879334
Iterating by ming2
Initial: fx= 576.879334
x= 0.04235 0.03793 0.02678 0.02743 0.02949 0.07271 951.42857 0.61916 0.36173
1 h-m-p 0.0000 0.0002 316.9010 +++ 555.950313 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0006 40.9389 ++ 555.374872 m 0.0006 27 | 2/9
3 h-m-p 0.0002 0.0012 70.8045 ----------.. | 2/9
4 h-m-p 0.0000 0.0000 264.6827 ++ 554.295220 m 0.0000 59 | 3/9
5 h-m-p 0.0003 0.0349 13.4260 ----------.. | 3/9
6 h-m-p 0.0000 0.0001 229.0329 ++ 550.961106 m 0.0001 91 | 4/9
7 h-m-p 0.0013 0.0705 9.3181 -----------.. | 4/9
8 h-m-p 0.0000 0.0000 187.5955 ++ 549.791333 m 0.0000 124 | 5/9
9 h-m-p 0.0007 0.1007 6.2837 -----------.. | 5/9
10 h-m-p 0.0000 0.0002 132.0753 +++ 545.729288 m 0.0002 158 | 6/9
11 h-m-p 0.5198 8.0000 0.0000 ++ 545.729288 m 8.0000 170 | 6/9
12 h-m-p 0.0160 8.0000 0.0200 --------N 545.729288 0 0.0000 193 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 545.729288 m 8.0000 211 | 6/9
14 h-m-p 0.0003 0.1512 2.3792 -------Y 545.729288 0 0.0000 233 | 6/9
15 h-m-p 0.0246 8.0000 0.0000 -C 545.729288 0 0.0015 246 | 6/9
16 h-m-p 0.0200 8.0000 0.0000 -------Y 545.729288 0 0.0000 268
Out..
lnL = -545.729288
269 lfun, 807 eigenQcodon, 3228 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038792 0.069893 0.043601 0.069833 0.011442 0.096102 951.428571 1.644056 0.165698 0.240705 439.211108
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000503
np = 11
lnL0 = -562.642545
Iterating by ming2
Initial: fx= 562.642545
x= 0.03879 0.06989 0.04360 0.06983 0.01144 0.09610 951.42857 1.64406 0.16570 0.24071 439.21111
1 h-m-p 0.0000 0.0006 43.4341 +++ 561.411576 m 0.0006 17 | 1/11
2 h-m-p 0.0016 0.0693 13.6986 +++ 550.897478 m 0.0693 32 | 2/11
3 h-m-p 0.0000 0.0001 1643.2045 ++ 549.612140 m 0.0001 46 | 3/11
4 h-m-p 0.0000 0.0000 499.5517 ++ 549.605455 m 0.0000 60 | 4/11
5 h-m-p 0.0000 0.0005 177.0863 +++ 546.834646 m 0.0005 75 | 5/11
6 h-m-p 0.0005 0.0025 171.9025 ++ 545.729201 m 0.0025 89 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ++ 545.729201 m 8.0000 103 | 6/11
8 h-m-p 0.0194 8.0000 0.0062 -------------.. | 6/11
9 h-m-p 0.0160 8.0000 0.0000 ------------- | 6/11
10 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -545.729201
194 lfun, 776 eigenQcodon, 3492 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -545.726611 S = -545.726166 -0.000170
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:02
did 20 / 51 patterns 0:02
did 30 / 51 patterns 0:03
did 40 / 51 patterns 0:03
did 50 / 51 patterns 0:03
did 51 / 51 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020524 0.103827 0.081175 0.104053 0.062755 0.059528 951.428572 0.715461 1.388170
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.037124
np = 9
lnL0 = -601.631788
Iterating by ming2
Initial: fx= 601.631788
x= 0.02052 0.10383 0.08118 0.10405 0.06276 0.05953 951.42857 0.71546 1.38817
1 h-m-p 0.0000 0.0002 304.8500 +++ 586.577439 m 0.0002 24 | 1/9
2 h-m-p 0.0029 0.0527 15.3704 ------------.. | 1/9
3 h-m-p 0.0000 0.0003 283.1494 +++ 561.394047 m 0.0003 76 | 2/9
4 h-m-p 0.0104 0.1443 7.4287 -------------.. | 2/9
5 h-m-p 0.0000 0.0000 263.3352 ++ 559.658672 m 0.0000 126 | 3/9
6 h-m-p 0.0013 0.3386 4.4607 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 227.6555 ++ 552.135231 m 0.0001 172 | 4/9
8 h-m-p 0.0068 0.4389 3.8999 -------------.. | 4/9
9 h-m-p 0.0000 0.0002 188.1706 +++ 545.761783 m 0.0002 219 | 5/9
10 h-m-p 0.0054 0.5781 4.3718 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 135.5384 ++ 545.729317 m 0.0000 262 | 6/9
12 h-m-p 0.0329 8.0000 0.0000 N 545.729317 0 0.0329 278 | 6/9
13 h-m-p 0.0168 8.0000 0.0000 N 545.729317 0 0.0042 293
Out..
lnL = -545.729317
294 lfun, 3234 eigenQcodon, 17640 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059552 0.025665 0.074608 0.038580 0.081709 0.072080 951.428572 0.900000 0.901538 1.514020 368.193908
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000808
np = 11
lnL0 = -559.678198
Iterating by ming2
Initial: fx= 559.678198
x= 0.05955 0.02566 0.07461 0.03858 0.08171 0.07208 951.42857 0.90000 0.90154 1.51402 368.19391
1 h-m-p 0.0000 0.0010 104.9224 +++YYYCYCYCCC 552.634687 9 0.0007 44 | 0/11
2 h-m-p 0.0003 0.0013 32.0287 ++ 551.315076 m 0.0013 69 | 1/11
3 h-m-p 0.0162 0.0874 2.3202 ++ 549.840030 m 0.0874 94 | 2/11
4 h-m-p 0.0020 0.0100 6.3887 ++ 548.340962 m 0.0100 118 | 3/11
5 h-m-p 0.0001 0.0005 13.2422 ++ 548.252080 m 0.0005 141 | 4/11
6 h-m-p 0.0000 0.0001 62.5485 ++ 548.059429 m 0.0001 163 | 5/11
7 h-m-p 0.0007 0.0831 6.6964 +++YYCYCYC 546.914349 6 0.0703 196 | 5/11
8 h-m-p 0.3002 1.5009 0.8981 ---------------.. | 5/11
9 h-m-p 0.0000 0.0003 67.2463 +++ 545.729209 m 0.0003 250 | 6/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 545.729209 m 8.0000 270 | 6/11
11 h-m-p 0.0160 8.0000 0.1587 +++++ 545.729198 m 8.0000 292 | 6/11
12 h-m-p 1.6000 8.0000 0.0324 ++ 545.729198 m 8.0000 311 | 6/11
13 h-m-p 0.1640 0.8202 0.6956 +
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+ 545.729197 m 0.8202 330
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75134, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
14 h-m-p 0.0000 0.0000 0.7504
h-m-p: 1.79145346e-18 8.95726728e-18 7.50448471e-01 545.729197
..
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75134, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+ 545.729197 m 8.0000 368
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75134, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
16 h-m-p 0.0130 6.5240 0.1266
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
+ 545.729196 m 6.5240 390
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75134, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
17 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
C 545.729196 0 0.0014 413
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75134, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
18 h-m-p 0.2935 8.0000 0.0000
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
C 545.729196 0 0.0000 442
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -545.729196
443 lfun, 5316 eigenQcodon, 29238 P(t)
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -545.726095 S = -545.726068 -0.000012
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:15
did 20 / 51 patterns 0:15
did 30 / 51 patterns 0:15
did 40 / 51 patterns 0:15
did 50 / 51 patterns 0:16
did 51 / 51 patterns 0:16
QuantileBeta(0.85, 2.75148, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=135
NC_011896_1_WP_010907935_1_837_MLBR_RS03920 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
NC_002677_1_NP_301611_1_483_ML0799 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA
**************************************************
NC_011896_1_WP_010907935_1_837_MLBR_RS03920 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
NC_002677_1_NP_301611_1_483_ML0799 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420 AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV
**************************************************
NC_011896_1_WP_010907935_1_837_MLBR_RS03920 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
NC_002677_1_NP_301611_1_483_ML0799 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420 LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
***********************************
>NC_011896_1_WP_010907935_1_837_MLBR_RS03920 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT GCTGG >NC_002677_1_NP_301611_1_483_ML0799 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT GCTGG >NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT GCTGG >NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT GCTGG >NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT GCTGG >NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420 TTGCAATTCGACACCGTTAACAACCTATCTCGCAATACCCTGACACCGCG TCTGAGCAGGTATTCAAAAACACTGATTATCGCGCTACCTCGCGAGCTAG CCATCGCGATACTGTCGGCACCGTCCCGATTGTCGCTGAAGGAGACTGCC GCGGCGCCCGGTGTGACCAAAGCCAACACGGCCGAACCCGCTGCCGCTCA GCGGGCTACTAGCTATGTCGTCGGCGGGGTCTTCCCTTCTGGTCAGTGGA AGCGGTTGCGGACGGTTGTGGACACCTCAGCGTTGAGCTGGGACCGGGTG CTTTGCAACGCCGGTAAGCGGCATCGACTCCTTGCGCCAGGATGCCGAGG CGAACCAGGTTATGTTCGGCATCCATCCGGCTGGCGATCGGCCGAGCGGT GCTGG
>NC_011896_1_WP_010907935_1_837_MLBR_RS03920 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW >NC_002677_1_NP_301611_1_483_ML0799 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW >NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW >NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW >NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW >NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420 LQFDTVNNLSRNTLTPRLSRYSKTLIIALPRELAIAILSAPSRLSLKETA AAPGVTKANTAEPAAAQRATSYVVGGVFPSGQWKRLRTVVDTSALSWDRV LCNAGKRHRLLAPGCRGEPGYVRHPSGWRSAERCW
#NEXUS
[ID: 0904094917]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907935_1_837_MLBR_RS03920
NC_002677_1_NP_301611_1_483_ML0799
NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090
NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020
NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350
NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907935_1_837_MLBR_RS03920,
2 NC_002677_1_NP_301611_1_483_ML0799,
3 NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090,
4 NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020,
5 NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350,
6 NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06672405,2:0.07075099,3:0.06931247,4:0.06875562,5:0.06801551,6:0.06925448);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06672405,2:0.07075099,3:0.06931247,4:0.06875562,5:0.06801551,6:0.06925448);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -552.77 -556.06
2 -552.77 -556.56
--------------------------------------
TOTAL -552.77 -556.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0799/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894084 0.084884 0.353254 1.453920 0.864430 1478.85 1489.93 1.000
r(A<->C){all} 0.164411 0.020446 0.000074 0.458020 0.123223 204.09 363.28 1.000
r(A<->G){all} 0.161685 0.018144 0.000261 0.428213 0.126274 203.00 206.42 1.001
r(A<->T){all} 0.182620 0.020549 0.000164 0.465062 0.152375 130.43 196.98 1.000
r(C<->G){all} 0.164374 0.018970 0.000023 0.445916 0.128614 167.39 217.45 1.000
r(C<->T){all} 0.165022 0.019693 0.000052 0.442745 0.128992 156.38 239.21 1.005
r(G<->T){all} 0.161888 0.020073 0.000133 0.453407 0.119725 169.75 196.72 1.006
pi(A){all} 0.188148 0.000351 0.150420 0.223565 0.187962 1164.95 1273.42 1.000
pi(C){all} 0.308716 0.000503 0.267630 0.354628 0.309055 1254.47 1254.90 1.000
pi(G){all} 0.302940 0.000479 0.263196 0.348201 0.302433 1209.07 1270.36 1.000
pi(T){all} 0.200196 0.000389 0.162595 0.240174 0.199496 1247.39 1319.69 1.000
alpha{1,2} 0.426636 0.256601 0.000126 1.494055 0.249399 1175.47 1261.05 1.000
alpha{3} 0.448832 0.235838 0.000402 1.391626 0.281808 1414.90 1451.98 1.000
pinvar{all} 0.995883 0.000027 0.986775 0.999998 0.997493 1338.63 1360.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0799/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 135
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 2 2 2 2 2 2
CTA 3 3 3 3 3 3 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 4 4 4 4 4 4
CTG 5 5 5 5 5 5 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 4 4 4 4 4 4 | AAC 4 4 4 4 4 4 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 3 3 3 3 3 3 | GCC 7 7 7 7 7 7 | GAC 3 3 3 3 3 3 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 6 6 6 6 6 6 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907935_1_837_MLBR_RS03920
position 1: T:0.18519 C:0.28889 A:0.20741 G:0.31852
position 2: T:0.22222 C:0.33333 A:0.19259 G:0.25185
position 3: T:0.19259 C:0.30370 A:0.16296 G:0.34074
Average T:0.20000 C:0.30864 A:0.18765 G:0.30370
#2: NC_002677_1_NP_301611_1_483_ML0799
position 1: T:0.18519 C:0.28889 A:0.20741 G:0.31852
position 2: T:0.22222 C:0.33333 A:0.19259 G:0.25185
position 3: T:0.19259 C:0.30370 A:0.16296 G:0.34074
Average T:0.20000 C:0.30864 A:0.18765 G:0.30370
#3: NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090
position 1: T:0.18519 C:0.28889 A:0.20741 G:0.31852
position 2: T:0.22222 C:0.33333 A:0.19259 G:0.25185
position 3: T:0.19259 C:0.30370 A:0.16296 G:0.34074
Average T:0.20000 C:0.30864 A:0.18765 G:0.30370
#4: NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020
position 1: T:0.18519 C:0.28889 A:0.20741 G:0.31852
position 2: T:0.22222 C:0.33333 A:0.19259 G:0.25185
position 3: T:0.19259 C:0.30370 A:0.16296 G:0.34074
Average T:0.20000 C:0.30864 A:0.18765 G:0.30370
#5: NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350
position 1: T:0.18519 C:0.28889 A:0.20741 G:0.31852
position 2: T:0.22222 C:0.33333 A:0.19259 G:0.25185
position 3: T:0.19259 C:0.30370 A:0.16296 G:0.34074
Average T:0.20000 C:0.30864 A:0.18765 G:0.30370
#6: NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420
position 1: T:0.18519 C:0.28889 A:0.20741 G:0.31852
position 2: T:0.22222 C:0.33333 A:0.19259 G:0.25185
position 3: T:0.19259 C:0.30370 A:0.16296 G:0.34074
Average T:0.20000 C:0.30864 A:0.18765 G:0.30370
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 18 | Cys C TGT 0
TTC 12 | TCC 12 | TAC 0 | TGC 18
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 6
CTC 6 | CCC 12 | CAC 0 | CGC 12
CTA 18 | CCA 18 | Gln Q CAA 6 | CGA 24
CTG 30 | CCG 12 | CAG 12 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 24 | AAC 24 | AGC 18
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 0 | ACG 12 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 0 | Gly G GGT 24
GTC 18 | GCC 42 | GAC 18 | GGC 18
GTA 0 | GCA 6 | Glu E GAA 12 | GGA 6
GTG 18 | GCG 36 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18519 C:0.28889 A:0.20741 G:0.31852
position 2: T:0.22222 C:0.33333 A:0.19259 G:0.25185
position 3: T:0.19259 C:0.30370 A:0.16296 G:0.34074
Average T:0.20000 C:0.30864 A:0.18765 G:0.30370
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -545.729196 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 368.193908
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907935_1_837_MLBR_RS03920: 0.000004, NC_002677_1_NP_301611_1_483_ML0799: 0.000004, NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090: 0.000004, NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020: 0.000004, NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350: 0.000004, NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 368.19391
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 273.5 131.5 368.1939 0.0000 0.0000 0.0 0.0
7..2 0.000 273.5 131.5 368.1939 0.0000 0.0000 0.0 0.0
7..3 0.000 273.5 131.5 368.1939 0.0000 0.0000 0.0 0.0
7..4 0.000 273.5 131.5 368.1939 0.0000 0.0000 0.0 0.0
7..5 0.000 273.5 131.5 368.1939 0.0000 0.0000 0.0 0.0
7..6 0.000 273.5 131.5 368.1939 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -545.729288 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.428571 0.612085 0.338347
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907935_1_837_MLBR_RS03920: 0.000004, NC_002677_1_NP_301611_1_483_ML0799: 0.000004, NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090: 0.000004, NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020: 0.000004, NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350: 0.000004, NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42857
MLEs of dN/dS (w) for site classes (K=2)
p: 0.61209 0.38791
w: 0.33835 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 273.5 131.5 0.5950 0.0000 0.0000 0.0 0.0
7..2 0.000 273.5 131.5 0.5950 0.0000 0.0000 0.0 0.0
7..3 0.000 273.5 131.5 0.5950 0.0000 0.0000 0.0 0.0
7..4 0.000 273.5 131.5 0.5950 0.0000 0.0000 0.0 0.0
7..5 0.000 273.5 131.5 0.5950 0.0000 0.0000 0.0 0.0
7..6 0.000 273.5 131.5 0.5950 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -545.729201 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.428572 0.900367 0.061915 0.135773 439.211369
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907935_1_837_MLBR_RS03920: 0.000004, NC_002677_1_NP_301611_1_483_ML0799: 0.000004, NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090: 0.000004, NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020: 0.000004, NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350: 0.000004, NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42857
MLEs of dN/dS (w) for site classes (K=3)
p: 0.90037 0.06191 0.03772
w: 0.13577 1.00000 439.21137
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 273.5 131.5 16.7505 0.0000 0.0000 0.0 0.0
7..2 0.000 273.5 131.5 16.7505 0.0000 0.0000 0.0 0.0
7..3 0.000 273.5 131.5 16.7505 0.0000 0.0000 0.0 0.0
7..4 0.000 273.5 131.5 16.7505 0.0000 0.0000 0.0 0.0
7..5 0.000 273.5 131.5 16.7505 0.0000 0.0000 0.0 0.0
7..6 0.000 273.5 131.5 16.7505 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907935_1_837_MLBR_RS03920)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907935_1_837_MLBR_RS03920)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -545.729317 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.428572 0.715385 1.387968
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907935_1_837_MLBR_RS03920: 0.000004, NC_002677_1_NP_301611_1_483_ML0799: 0.000004, NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090: 0.000004, NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020: 0.000004, NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350: 0.000004, NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42857
Parameters in M7 (beta):
p = 0.71539 q = 1.38797
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.01061 0.04970 0.10279 0.16713 0.24206 0.32795 0.42611 0.53933 0.67375 0.84835
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 273.5 131.5 0.3388 0.0000 0.0000 0.0 0.0
7..2 0.000 273.5 131.5 0.3388 0.0000 0.0000 0.0 0.0
7..3 0.000 273.5 131.5 0.3388 0.0000 0.0000 0.0 0.0
7..4 0.000 273.5 131.5 0.3388 0.0000 0.0000 0.0 0.0
7..5 0.000 273.5 131.5 0.3388 0.0000 0.0000 0.0 0.0
7..6 0.000 273.5 131.5 0.3388 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -545.729196 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.428622 0.000010 2.751480 0.005000 368.201528
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907935_1_837_MLBR_RS03920: 0.000004, NC_002677_1_NP_301611_1_483_ML0799: 0.000004, NZ_LVXE01000001_1_WP_010907935_1_222_A3216_RS01090: 0.000004, NZ_LYPH01000001_1_WP_010907935_1_211_A8144_RS01020: 0.000004, NZ_CP029543_1_WP_010907935_1_856_DIJ64_RS04350: 0.000004, NZ_AP014567_1_WP_010907935_1_870_JK2ML_RS04420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42862
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 2.75148 q = 0.00500
(p1 = 0.99999) w = 368.20153
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 368.20153
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 273.5 131.5 368.1979 0.0000 0.0000 0.0 0.0
7..2 0.000 273.5 131.5 368.1979 0.0000 0.0000 0.0 0.0
7..3 0.000 273.5 131.5 368.1979 0.0000 0.0000 0.0 0.0
7..4 0.000 273.5 131.5 368.1979 0.0000 0.0000 0.0 0.0
7..5 0.000 273.5 131.5 368.1979 0.0000 0.0000 0.0 0.0
7..6 0.000 273.5 131.5 368.1979 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907935_1_837_MLBR_RS03920)
Pr(w>1) post mean +- SE for w
1 L 1.000** 368.198
2 Q 1.000** 368.198
3 F 1.000** 368.198
4 D 1.000** 368.198
5 T 1.000** 368.198
6 V 1.000** 368.198
7 N 1.000** 368.198
8 N 1.000** 368.198
9 L 1.000** 368.198
10 S 1.000** 368.198
11 R 1.000** 368.198
12 N 1.000** 368.198
13 T 1.000** 368.198
14 L 1.000** 368.198
15 T 1.000** 368.198
16 P 1.000** 368.198
17 R 1.000** 368.198
18 L 1.000** 368.198
19 S 1.000** 368.198
20 R 1.000** 368.198
21 Y 1.000** 368.198
22 S 1.000** 368.198
23 K 1.000** 368.198
24 T 1.000** 368.198
25 L 1.000** 368.198
26 I 1.000** 368.198
27 I 1.000** 368.198
28 A 1.000** 368.198
29 L 1.000** 368.198
30 P 1.000** 368.198
31 R 1.000** 368.198
32 E 1.000** 368.198
33 L 1.000** 368.198
34 A 1.000** 368.198
35 I 1.000** 368.198
36 A 1.000** 368.198
37 I 1.000** 368.198
38 L 1.000** 368.198
39 S 1.000** 368.198
40 A 1.000** 368.198
41 P 1.000** 368.198
42 S 1.000** 368.198
43 R 1.000** 368.198
44 L 1.000** 368.198
45 S 1.000** 368.198
46 L 1.000** 368.198
47 K 1.000** 368.198
48 E 1.000** 368.198
49 T 1.000** 368.198
50 A 1.000** 368.198
51 A 1.000** 368.198
52 A 1.000** 368.198
53 P 1.000** 368.198
54 G 1.000** 368.198
55 V 1.000** 368.198
56 T 1.000** 368.198
57 K 1.000** 368.198
58 A 1.000** 368.198
59 N 1.000** 368.198
60 T 1.000** 368.198
61 A 1.000** 368.198
62 E 1.000** 368.198
63 P 1.000** 368.198
64 A 1.000** 368.198
65 A 1.000** 368.198
66 A 1.000** 368.198
67 Q 1.000** 368.198
68 R 1.000** 368.198
69 A 1.000** 368.198
70 T 1.000** 368.198
71 S 1.000** 368.198
72 Y 1.000** 368.198
73 V 1.000** 368.198
74 V 1.000** 368.198
75 G 1.000** 368.198
76 G 1.000** 368.198
77 V 1.000** 368.198
78 F 1.000** 368.198
79 P 1.000** 368.198
80 S 1.000** 368.198
81 G 1.000** 368.198
82 Q 1.000** 368.198
83 W 1.000** 368.198
84 K 1.000** 368.198
85 R 1.000** 368.198
86 L 1.000** 368.198
87 R 1.000** 368.198
88 T 1.000** 368.198
89 V 1.000** 368.198
90 V 1.000** 368.198
91 D 1.000** 368.198
92 T 1.000** 368.198
93 S 1.000** 368.198
94 A 1.000** 368.198
95 L 1.000** 368.198
96 S 1.000** 368.198
97 W 1.000** 368.198
98 D 1.000** 368.198
99 R 1.000** 368.198
100 V 1.000** 368.198
101 L 1.000** 368.198
102 C 1.000** 368.198
103 N 1.000** 368.198
104 A 1.000** 368.198
105 G 1.000** 368.198
106 K 1.000** 368.198
107 R 1.000** 368.198
108 H 1.000** 368.198
109 R 1.000** 368.198
110 L 1.000** 368.198
111 L 1.000** 368.198
112 A 1.000** 368.198
113 P 1.000** 368.198
114 G 1.000** 368.198
115 C 1.000** 368.198
116 R 1.000** 368.198
117 G 1.000** 368.198
118 E 1.000** 368.198
119 P 1.000** 368.198
120 G 1.000** 368.198
121 Y 1.000** 368.198
122 V 1.000** 368.198
123 R 1.000** 368.198
124 H 1.000** 368.198
125 P 1.000** 368.198
126 S 1.000** 368.198
127 G 1.000** 368.198
128 W 1.000** 368.198
129 R 1.000** 368.198
130 S 1.000** 368.198
131 A 1.000** 368.198
132 E 1.000** 368.198
133 R 1.000** 368.198
134 C 1.000** 368.198
135 W 1.000** 368.198
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907935_1_837_MLBR_RS03920)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -545.729288 Model 2: PositiveSelection -545.729201 Model 0: one-ratio -545.729196 Model 7: beta -545.729317 Model 8: beta&w>1 -545.729196 Model 0 vs 1 1.83999999990192E-4 Model 2 vs 1 1.7400000001543958E-4 Model 8 vs 7 2.4200000007112976E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
