--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:24:47 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0397/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2504.86         -2508.52
2      -2504.89         -2509.04
--------------------------------------
TOTAL    -2504.88         -2508.82
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.882053    0.086597    0.364337    1.463445    0.844752   1451.24   1476.12    1.000
r(A<->C){all}   0.217103    0.025785    0.000281    0.522788    0.181608    207.27    207.82    1.000
r(A<->G){all}   0.160874    0.019135    0.000095    0.441636    0.124650    222.78    290.27    1.001
r(A<->T){all}   0.156423    0.017589    0.000002    0.426453    0.122942    226.79    264.08    1.000
r(C<->G){all}   0.140228    0.017066    0.000071    0.407164    0.101587    173.99    229.50    1.001
r(C<->T){all}   0.149853    0.016588    0.000022    0.403660    0.114113    269.31    290.59    1.000
r(G<->T){all}   0.175517    0.021284    0.000091    0.470544    0.134957    370.50    376.14    1.000
pi(A){all}      0.210739    0.000091    0.191752    0.228006    0.210658   1250.85   1298.23    1.000
pi(C){all}      0.284197    0.000113    0.264445    0.305598    0.284419   1148.04   1248.09    1.000
pi(G){all}      0.275073    0.000107    0.256299    0.296795    0.275178   1040.69   1212.07    1.000
pi(T){all}      0.229990    0.000100    0.210222    0.249263    0.229995   1284.03   1294.38    1.000
alpha{1,2}      0.337963    0.209496    0.000128    1.318733    0.150810   1036.18   1178.52    1.000
alpha{3}        0.358694    0.183443    0.001112    1.229236    0.224666   1139.04   1320.02    1.000
pinvar{all}     0.997983    0.000003    0.994492    0.999964    0.998450    942.49   1140.35    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2405.359583
Model 2: PositiveSelection	-2405.068172
Model 0: one-ratio	-2405.068155
Model 7: beta	-2405.379338
Model 8: beta&w>1	-2405.068172


Model 0 vs 1	0.5828559999999925

Model 2 vs 1	0.5828220000003057

Model 8 vs 7	0.6223320000008243
>C1
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C2
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVELSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C3
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C4
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C5
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C6
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=602 

C1              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C2              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C3              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C4              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C5              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C6              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
                **************************************************

C1              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C2              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C3              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C4              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C5              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C6              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
                **************************************************

C1              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C2              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C3              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C4              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C5              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C6              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
                **************************************************

C1              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C2              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C3              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C4              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C5              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C6              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
                **************************************************

C1              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C2              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C3              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C4              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C5              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C6              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
                **************************************************

C1              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C2              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C3              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C4              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C5              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C6              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
                **************************************************

C1              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C2              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C3              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C4              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C5              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C6              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
                **************************************************

C1              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C2              VIMAGSVELSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C3              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C4              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C5              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C6              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
                *******:******************************************

C1              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C2              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C3              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C4              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C5              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C6              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
                **************************************************

C1              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C2              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C3              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C4              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C5              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C6              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
                **************************************************

C1              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C2              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C3              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C4              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C5              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C6              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
                **************************************************

C1              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C2              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C3              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C4              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C5              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C6              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
                **************************************************

C1              IK
C2              IK
C3              IK
C4              IK
C5              IK
C6              IK
                **




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  602 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  602 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [18060]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [18060]--->[18060]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.587 Mb, Max= 31.220 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C2              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C3              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C4              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C5              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
C6              VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
                **************************************************

C1              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C2              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C3              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C4              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C5              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
C6              VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
                **************************************************

C1              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C2              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C3              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C4              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C5              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
C6              LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
                **************************************************

C1              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C2              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C3              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C4              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C5              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
C6              NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
                **************************************************

C1              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C2              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C3              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C4              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C5              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
C6              VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
                **************************************************

C1              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C2              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C3              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C4              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C5              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
C6              LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
                **************************************************

C1              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C2              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C3              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C4              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C5              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
C6              PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
                **************************************************

C1              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C2              VIMAGSVELSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C3              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C4              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C5              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
C6              VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
                *******:******************************************

C1              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C2              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C3              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C4              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C5              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
C6              VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
                **************************************************

C1              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C2              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C3              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C4              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C5              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
C6              LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
                **************************************************

C1              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C2              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C3              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C4              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C5              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
C6              ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
                **************************************************

C1              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C2              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C3              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C4              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C5              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
C6              SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
                **************************************************

C1              IK
C2              IK
C3              IK
C4              IK
C5              IK
C6              IK
                **




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.83 C1	 C2	 99.83
TOP	    1    0	 99.83 C2	 C1	 99.83
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 99.83 C2	 C3	 99.83
TOP	    2    1	 99.83 C3	 C2	 99.83
BOT	    1    3	 99.83 C2	 C4	 99.83
TOP	    3    1	 99.83 C4	 C2	 99.83
BOT	    1    4	 99.83 C2	 C5	 99.83
TOP	    4    1	 99.83 C5	 C2	 99.83
BOT	    1    5	 99.83 C2	 C6	 99.83
TOP	    5    1	 99.83 C6	 C2	 99.83
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.97
AVG	 1	 C2	  *	 99.83
AVG	 2	 C3	  *	 99.97
AVG	 3	 C4	  *	 99.97
AVG	 4	 C5	  *	 99.97
AVG	 5	 C6	  *	 99.97
TOT	 TOT	  *	 99.94
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
C2              GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
C3              GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
C4              GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
C5              GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
C6              GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
                **************************************************

C1              CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
C2              CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
C3              CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
C4              CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
C5              CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
C6              CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
                **************************************************

C1              AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
C2              AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
C3              AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
C4              AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
C5              AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
C6              AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
                **************************************************

C1              GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
C2              GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
C3              GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
C4              GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
C5              GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
C6              GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
                **************************************************

C1              TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
C2              TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
C3              TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
C4              TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
C5              TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
C6              TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
                **************************************************

C1              TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
C2              TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
C3              TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
C4              TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
C5              TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
C6              TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
                **************************************************

C1              TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
C2              TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
C3              TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
C4              TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
C5              TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
C6              TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
                **************************************************

C1              CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
C2              CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
C3              CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
C4              CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
C5              CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
C6              CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
                **************************************************

C1              TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
C2              TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
C3              TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
C4              TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
C5              TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
C6              TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
                **************************************************

C1              AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
C2              AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
C3              AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
C4              AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
C5              AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
C6              AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
                **************************************************

C1              ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
C2              ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
C3              ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
C4              ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
C5              ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
C6              ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
                **************************************************

C1              TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
C2              TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
C3              TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
C4              TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
C5              TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
C6              TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
                **************************************************

C1              GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
C2              GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
C3              GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
C4              GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
C5              GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
C6              GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
                **************************************************

C1              GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
C2              GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
C3              GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
C4              GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
C5              GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
C6              GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
                **************************************************

C1              TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
C2              TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
C3              TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
C4              TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
C5              TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
C6              TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
                **************************************************

C1              CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
C2              CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
C3              CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
C4              CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
C5              CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
C6              CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
                **************************************************

C1              TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
C2              TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
C3              TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
C4              TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
C5              TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
C6              TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
                **************************************************

C1              CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
C2              CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
C3              CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
C4              CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
C5              CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
C6              CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
                **************************************************

C1              CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
C2              CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
C3              CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
C4              CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
C5              CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
C6              CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
                **************************************************

C1              TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
C2              TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
C3              TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
C4              TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
C5              TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
C6              TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
                **************************************************

C1              TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
C2              TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
C3              TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
C4              TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
C5              TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
C6              TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
                **************************************************

C1              GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
C2              GTTATCATGGCAGGCTCCGTTGAACTATCGGTGGGCTCGATCGTCGCATT
C3              GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
C4              GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
C5              GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
C6              GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
                ***********************.**************************

C1              GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
C2              GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
C3              GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
C4              GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
C5              GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
C6              GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
                **************************************************

C1              TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
C2              TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
C3              TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
C4              TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
C5              TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
C6              TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
                **************************************************

C1              GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
C2              GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
C3              GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
C4              GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
C5              GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
C6              GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
                **************************************************

C1              TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
C2              TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
C3              TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
C4              TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
C5              TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
C6              TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
                **************************************************

C1              CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
C2              CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
C3              CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
C4              CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
C5              CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
C6              CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
                **************************************************

C1              CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
C2              CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
C3              CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
C4              CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
C5              CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
C6              CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
                **************************************************

C1              CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
C2              CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
C3              CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
C4              CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
C5              CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
C6              CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
                **************************************************

C1              CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
C2              CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
C3              CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
C4              CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
C5              CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
C6              CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
                **************************************************

C1              ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
C2              ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
C3              ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
C4              ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
C5              ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
C6              ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
                **************************************************

C1              CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
C2              CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
C3              CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
C4              CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
C5              CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
C6              CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
                **************************************************

C1              CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
C2              CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
C3              CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
C4              CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
C5              CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
C6              CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
                **************************************************

C1              AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
C2              AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
C3              AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
C4              AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
C5              AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
C6              AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
                **************************************************

C1              GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
C2              GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
C3              GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
C4              GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
C5              GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
C6              GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
                **************************************************

C1              TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
C2              TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
C3              TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
C4              TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
C5              TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
C6              TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
                **************************************************

C1              ATCAAA
C2              ATCAAA
C3              ATCAAA
C4              ATCAAA
C5              ATCAAA
C6              ATCAAA
                ******



>C1
GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
ATCAAA
>C2
GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
GTTATCATGGCAGGCTCCGTTGAACTATCGGTGGGCTCGATCGTCGCATT
GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
ATCAAA
>C3
GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
ATCAAA
>C4
GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
ATCAAA
>C5
GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
ATCAAA
>C6
GTGGATCACACGACGAAGTGTGACGCCGAACAATACTTCCAAGCGATTGT
CACATCAATGGCCGACGGAGTCATTGTGGTAGACATCGACGGACGGATTG
AGTCCATTAATCCCGCCGCTACTCGGATATTGGGCTTACGAGCCCACGAT
GTCGTTGACATGAAGCATGGCCATCCATTCTGCTTCTACGATACAGACAA
TCAGCGGGTTGATCTTGAGCGTGAGGTCATGCGCGTCGTACGACGCGAAG
TAACAACGGTAAGCAAAGTCGTCGGCATTGACCAACACAGTGGCCAGCGG
TTATGGCTATCGGTAAACGTGAGCCTGCTTGCGTACAAGGCTCCCCCACA
CTCTGCACTGGTAGTCTCGTTTTCTGACATTTCTGCCCACCACCTTTCGA
TCGAACGGCTCACCTACGAGGCAACCCACGACTGTCTCACCGGTCTTGCC
AATCGCAGGTTTGCGGAAGACCAGATCACCAAATCACTGCAGCATGACGA
ACGCTCTCGATTAGCTGCTGTACTGCTTCTTGACCTCGACGATTTCAAAG
TGATCAACGACTCACTAGGCCACGACGTAGGTGACGCGGTGTTGCAGACT
GTAGCGCAGCGACTACGCTCGGCTGTGCGGCCCGACGATGTCGTCGCGCG
GCTGGGCGGAGACGAGTTCATCGTACTACTCCGGGGTCCCCTTTCGGACA
TGAATGCTAACGACGTCGCAAAAAGACTGCACACAACACTGTCCGAGTCA
CTCGTGGTCGACCAGCTCACGGTGCCTATCGGAGCGAGTGTTGGCATCCT
TGAGGTGAGACCTGACGATCGACGGCGGGCCGCCGACATTTTGCGTGATG
CCGACTCCGCGATGTATGCAGCCAAGAACAAGAAACAATGTGCCGTCACG
CCGCAGCAGCTGGTACCGTTCGTCGCGCTGATCGCACTGTTTGTGTTTTT
TACAGCTGCGGCCGGAGCTAAGTTCTATGCACCATCAAATCTGCTGGTCA
TTCTCCAACAAACCGTGGTGCTGGCGATCGTCGGATACGGCATGACTTTC
GTTATCATGGCAGGCTCCGTTGACCTATCGGTGGGCTCGATCGTCGCATT
GACTGGAGTCACCGCGGCACTCGTGGCTGCACAGAATCAATTCGCTGCGA
TCGTCACCGCCCTGCTGGTGGGGTTGGCTGCTGGGATGGTAAACGGCATC
GTTTTTGCCTACGGGAAGATTCCGTCATTCGTTAGCACCCTCGGCATGCT
TCAAGTCTGCCGTGGTATCACCCTGATGATCAGCGACAGTTCTGCCAAAC
CGATGCCGTTTCACGGAATACTGGGTGCAATGGGAGCCATGCCGTGGATC
CTCATCGTCTGTCTTTTCGTCACAATCCTGGCAGGGATCTTATTCCAATT
CACCATGTTTGGTCGGTGGGTCAAAGCCATCGGTGGCAACGAACGTGTCG
CAACGTTAGCCGGGGTACCTACCCGCGGGATCAAAGTCGCGATCTTCGCG
ATCTGCGGACTGACAGCAGGCCTCGGCGGTATCGTGCTTGCTTCCCGCCT
CGGAGCCGGGACACCCACCGCAGCAACAGGTTTCGAGATCGATGTCATCG
CCGCAGTCGTCATCGGCGGCACGCCCTTAACCGGCGGATTGGGACGACTC
AGCGGAACGCTGATCGGTGCAATAATCATCTCGATGCTCTCCAACGGCAT
GGTGTTTATGGGTGTTGGGAATGCCGCCTCGCAGATCATCAAGGGAATTA
TGCTCGCCGCTGCGGTTTTTGTCTTCCTACAACGCCGCAAGATCGGCATT
ATCAAA
>C1
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C2
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVELSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C3
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C4
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C5
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK
>C6
VDHTTKCDAEQYFQAIVTSMADGVIVVDIDGRIESINPAATRILGLRAHD
VVDMKHGHPFCFYDTDNQRVDLEREVMRVVRREVTTVSKVVGIDQHSGQR
LWLSVNVSLLAYKAPPHSALVVSFSDISAHHLSIERLTYEATHDCLTGLA
NRRFAEDQITKSLQHDERSRLAAVLLLDLDDFKVINDSLGHDVGDAVLQT
VAQRLRSAVRPDDVVARLGGDEFIVLLRGPLSDMNANDVAKRLHTTLSES
LVVDQLTVPIGASVGILEVRPDDRRRAADILRDADSAMYAAKNKKQCAVT
PQQLVPFVALIALFVFFTAAAGAKFYAPSNLLVILQQTVVLAIVGYGMTF
VIMAGSVDLSVGSIVALTGVTAALVAAQNQFAAIVTALLVGLAAGMVNGI
VFAYGKIPSFVSTLGMLQVCRGITLMISDSSAKPMPFHGILGAMGAMPWI
LIVCLFVTILAGILFQFTMFGRWVKAIGGNERVATLAGVPTRGIKVAIFA
ICGLTAGLGGIVLASRLGAGTPTAATGFEIDVIAAVVIGGTPLTGGLGRL
SGTLIGAIIISMLSNGMVFMGVGNAASQIIKGIMLAAAVFVFLQRRKIGI
IK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1806 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579800164
      Setting output file names to "/data/4res/ML0397/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2067165026
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0296044032
      Seed = 865266695
      Swapseed = 1579800164
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 5 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -4045.315662 -- -24.965149
         Chain 2 -- -4045.315894 -- -24.965149
         Chain 3 -- -4045.316762 -- -24.965149
         Chain 4 -- -4045.317444 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -4045.316762 -- -24.965149
         Chain 2 -- -4045.317444 -- -24.965149
         Chain 3 -- -4045.316762 -- -24.965149
         Chain 4 -- -4045.317212 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-4045.316] (-4045.316) (-4045.317) (-4045.317) * [-4045.317] (-4045.317) (-4045.317) (-4045.317) 
        500 -- (-2521.004) (-2513.387) [-2513.768] (-2512.017) * [-2507.269] (-2514.979) (-2511.738) (-2514.141) -- 0:00:00
       1000 -- (-2508.703) (-2512.603) (-2507.901) [-2507.294] * (-2507.148) (-2523.045) (-2508.319) [-2509.908] -- 0:00:00
       1500 -- (-2511.988) (-2511.916) (-2508.929) [-2506.057] * (-2513.442) (-2518.015) [-2511.910] (-2514.425) -- 0:11:05
       2000 -- (-2510.583) (-2514.915) [-2513.695] (-2506.276) * (-2509.861) (-2515.349) (-2512.522) [-2511.812] -- 0:08:19
       2500 -- (-2507.737) (-2512.246) [-2512.197] (-2509.774) * (-2509.547) [-2509.323] (-2515.876) (-2512.482) -- 0:06:39
       3000 -- (-2508.976) (-2513.873) [-2507.378] (-2510.328) * (-2511.511) [-2506.556] (-2510.743) (-2508.725) -- 0:05:32
       3500 -- (-2507.019) (-2514.379) (-2522.441) [-2503.676] * (-2517.441) (-2509.322) (-2512.475) [-2511.836] -- 0:04:44
       4000 -- (-2510.775) [-2511.020] (-2522.447) (-2511.965) * (-2520.406) (-2517.621) (-2509.815) [-2509.141] -- 0:04:09
       4500 -- (-2510.528) [-2506.980] (-2519.615) (-2514.487) * (-2510.611) [-2505.237] (-2508.068) (-2515.327) -- 0:03:41
       5000 -- [-2516.478] (-2515.777) (-2509.253) (-2517.144) * (-2508.590) (-2508.135) (-2512.098) [-2511.008] -- 0:03:19

      Average standard deviation of split frequencies: 0.097274

       5500 -- (-2505.854) (-2510.368) (-2512.432) [-2508.888] * (-2508.790) (-2511.071) (-2516.920) [-2511.647] -- 0:03:00
       6000 -- (-2513.812) [-2509.723] (-2513.907) (-2516.524) * (-2506.304) (-2509.464) (-2518.355) [-2509.429] -- 0:02:45
       6500 -- (-2526.112) [-2513.023] (-2515.010) (-2510.751) * (-2514.468) (-2510.269) (-2505.449) [-2516.693] -- 0:02:32
       7000 -- (-2512.563) (-2505.294) (-2507.973) [-2507.332] * [-2513.376] (-2511.936) (-2509.470) (-2510.876) -- 0:02:21
       7500 -- (-2507.424) (-2508.223) (-2507.240) [-2507.366] * [-2510.481] (-2505.656) (-2510.115) (-2517.110) -- 0:02:12
       8000 -- (-2514.667) (-2508.694) (-2512.542) [-2509.054] * (-2511.772) (-2507.864) [-2505.677] (-2507.461) -- 0:02:04
       8500 -- (-2509.596) (-2510.144) [-2505.772] (-2520.040) * (-2510.942) (-2513.977) [-2510.510] (-2514.818) -- 0:01:56
       9000 -- [-2505.029] (-2509.299) (-2514.010) (-2509.424) * (-2506.023) (-2512.574) [-2510.853] (-2509.547) -- 0:01:50
       9500 -- (-2504.266) (-2513.724) [-2509.292] (-2509.367) * (-2505.631) [-2508.259] (-2512.830) (-2512.276) -- 0:01:44
      10000 -- (-2507.113) (-2508.181) [-2514.793] (-2509.986) * [-2504.422] (-2512.740) (-2513.894) (-2510.252) -- 0:01:39

      Average standard deviation of split frequencies: 0.083736

      10500 -- (-2515.720) [-2511.292] (-2507.298) (-2513.396) * (-2512.991) (-2508.467) [-2513.881] (-2519.558) -- 0:01:34
      11000 -- [-2510.570] (-2510.834) (-2507.477) (-2508.823) * (-2508.984) (-2511.450) [-2514.607] (-2518.133) -- 0:01:29
      11500 -- (-2514.573) [-2507.259] (-2512.571) (-2508.125) * (-2513.190) (-2514.696) (-2509.395) [-2506.102] -- 0:01:25
      12000 -- [-2510.399] (-2508.183) (-2506.437) (-2509.794) * [-2511.487] (-2519.095) (-2522.427) (-2514.456) -- 0:01:22
      12500 -- (-2508.059) [-2503.267] (-2511.133) (-2507.326) * (-2513.890) (-2515.194) (-2509.349) [-2510.039] -- 0:01:19
      13000 -- (-2508.313) (-2504.892) [-2507.879] (-2513.998) * (-2513.019) [-2506.254] (-2511.352) (-2515.683) -- 0:01:15
      13500 -- (-2511.584) [-2503.911] (-2510.135) (-2510.562) * (-2511.874) [-2515.023] (-2508.838) (-2513.266) -- 0:01:13
      14000 -- (-2510.330) (-2505.196) [-2509.957] (-2510.262) * [-2510.490] (-2509.703) (-2510.591) (-2514.517) -- 0:01:10
      14500 -- (-2513.344) [-2505.732] (-2509.102) (-2509.112) * (-2525.426) (-2512.936) (-2509.760) [-2506.954] -- 0:01:07
      15000 -- (-2515.668) (-2505.665) [-2509.818] (-2508.143) * [-2507.385] (-2512.524) (-2523.460) (-2506.504) -- 0:02:11

      Average standard deviation of split frequencies: 0.062199

      15500 -- [-2509.438] (-2507.581) (-2511.317) (-2514.062) * [-2511.177] (-2510.248) (-2510.802) (-2507.010) -- 0:02:07
      16000 -- (-2515.882) (-2507.495) (-2508.895) [-2513.939] * (-2514.927) (-2509.586) (-2510.241) [-2507.848] -- 0:02:03
      16500 -- (-2512.587) (-2506.461) (-2513.053) [-2504.629] * (-2515.030) (-2509.672) (-2507.761) [-2507.642] -- 0:01:59
      17000 -- (-2523.884) [-2503.737] (-2514.028) (-2511.758) * [-2510.066] (-2504.973) (-2507.011) (-2507.432) -- 0:01:55
      17500 -- (-2516.502) (-2504.711) (-2512.230) [-2510.197] * (-2506.714) (-2505.728) (-2509.624) [-2506.179] -- 0:01:52
      18000 -- (-2521.845) [-2504.853] (-2506.448) (-2506.241) * (-2510.512) [-2504.083] (-2510.619) (-2509.153) -- 0:01:49
      18500 -- (-2514.226) (-2507.934) (-2508.763) [-2516.072] * [-2511.370] (-2506.643) (-2507.872) (-2506.172) -- 0:01:46
      19000 -- [-2506.198] (-2507.279) (-2511.440) (-2507.186) * [-2515.102] (-2503.803) (-2508.271) (-2506.673) -- 0:01:43
      19500 -- (-2508.900) (-2504.275) [-2506.303] (-2509.247) * (-2513.355) [-2504.832] (-2508.109) (-2506.046) -- 0:01:40
      20000 -- (-2509.534) (-2503.520) [-2509.419] (-2512.057) * [-2510.853] (-2504.322) (-2507.312) (-2505.126) -- 0:01:38

      Average standard deviation of split frequencies: 0.053223

      20500 -- (-2521.712) (-2503.749) [-2504.950] (-2511.552) * [-2508.503] (-2504.473) (-2507.472) (-2505.995) -- 0:01:35
      21000 -- (-2508.412) (-2507.948) [-2517.589] (-2507.167) * [-2511.577] (-2506.255) (-2511.769) (-2506.162) -- 0:01:33
      21500 -- (-2516.730) (-2510.242) (-2516.654) [-2512.473] * [-2509.237] (-2509.434) (-2516.454) (-2507.057) -- 0:01:31
      22000 -- (-2512.975) (-2504.894) [-2505.753] (-2508.944) * [-2512.674] (-2508.398) (-2516.396) (-2506.583) -- 0:01:28
      22500 -- (-2516.674) (-2512.567) [-2506.359] (-2512.512) * [-2511.078] (-2506.545) (-2508.643) (-2507.087) -- 0:01:26
      23000 -- (-2513.750) (-2512.250) (-2509.355) [-2509.367] * (-2505.452) (-2506.387) [-2505.910] (-2509.713) -- 0:01:24
      23500 -- (-2511.695) (-2509.684) [-2510.362] (-2509.367) * (-2504.545) (-2504.499) [-2505.758] (-2513.648) -- 0:01:23
      24000 -- (-2509.475) [-2509.438] (-2508.333) (-2507.955) * (-2506.708) (-2504.928) [-2504.294] (-2508.011) -- 0:01:21
      24500 -- (-2507.020) (-2511.278) (-2520.535) [-2513.268] * (-2510.210) (-2504.775) [-2503.593] (-2506.187) -- 0:01:19
      25000 -- (-2509.898) [-2506.189] (-2505.302) (-2507.142) * (-2512.901) (-2507.280) [-2504.593] (-2506.191) -- 0:01:18

      Average standard deviation of split frequencies: 0.043357

      25500 -- [-2510.329] (-2505.680) (-2505.582) (-2511.649) * (-2510.663) [-2504.882] (-2504.125) (-2505.686) -- 0:01:16
      26000 -- (-2513.317) (-2505.685) [-2507.778] (-2507.414) * (-2510.476) (-2505.083) [-2505.433] (-2508.861) -- 0:01:14
      26500 -- (-2513.429) (-2506.630) [-2511.319] (-2508.401) * [-2510.667] (-2503.559) (-2505.790) (-2512.174) -- 0:01:13
      27000 -- (-2507.617) (-2508.754) (-2504.339) [-2505.157] * (-2506.402) [-2505.549] (-2507.037) (-2509.602) -- 0:01:12
      27500 -- (-2506.290) (-2510.619) [-2509.285] (-2509.761) * (-2506.621) (-2507.357) (-2506.719) [-2508.216] -- 0:01:10
      28000 -- (-2510.863) (-2506.834) [-2509.191] (-2513.526) * [-2507.147] (-2505.517) (-2504.735) (-2510.326) -- 0:01:09
      28500 -- [-2505.515] (-2504.548) (-2514.670) (-2507.997) * (-2507.226) (-2504.655) (-2505.644) [-2507.018] -- 0:01:42
      29000 -- (-2507.762) (-2508.526) [-2509.720] (-2512.691) * (-2506.539) [-2504.343] (-2505.010) (-2506.185) -- 0:01:40
      29500 -- (-2508.616) (-2506.538) [-2507.818] (-2507.468) * (-2505.189) [-2504.683] (-2506.367) (-2510.233) -- 0:01:38
      30000 -- (-2510.187) [-2505.909] (-2512.966) (-2508.436) * (-2507.876) (-2504.657) (-2507.919) [-2508.504] -- 0:01:37

      Average standard deviation of split frequencies: 0.043041

      30500 -- [-2511.537] (-2507.557) (-2513.827) (-2510.197) * (-2507.200) (-2505.411) (-2505.638) [-2509.533] -- 0:01:35
      31000 -- (-2514.761) [-2505.951] (-2506.503) (-2511.914) * (-2505.685) [-2505.478] (-2507.852) (-2507.658) -- 0:01:33
      31500 -- (-2525.296) (-2507.832) (-2509.484) [-2512.416] * [-2506.986] (-2505.505) (-2508.697) (-2508.101) -- 0:01:32
      32000 -- (-2510.879) (-2507.663) (-2517.615) [-2512.548] * [-2507.342] (-2505.691) (-2506.452) (-2507.693) -- 0:01:30
      32500 -- [-2508.905] (-2508.282) (-2508.899) (-2514.938) * [-2506.662] (-2505.530) (-2506.306) (-2506.891) -- 0:01:29
      33000 -- (-2516.594) [-2507.349] (-2510.955) (-2511.165) * (-2504.223) (-2505.545) [-2506.286] (-2509.750) -- 0:01:27
      33500 -- (-2511.278) (-2507.001) [-2506.586] (-2514.503) * [-2505.705] (-2506.640) (-2505.706) (-2507.882) -- 0:01:26
      34000 -- (-2506.851) (-2507.034) (-2521.543) [-2508.036] * (-2504.232) (-2506.503) (-2506.693) [-2506.241] -- 0:01:25
      34500 -- (-2509.415) (-2507.915) [-2508.311] (-2514.878) * (-2504.500) (-2507.129) [-2506.783] (-2506.164) -- 0:01:23
      35000 -- (-2512.266) (-2506.553) [-2513.653] (-2517.961) * (-2508.231) [-2509.194] (-2507.160) (-2504.698) -- 0:01:22

      Average standard deviation of split frequencies: 0.046766

      35500 -- (-2508.204) (-2507.429) [-2504.106] (-2510.373) * (-2507.726) (-2507.082) (-2506.931) [-2508.234] -- 0:01:21
      36000 -- (-2511.496) (-2505.767) [-2513.081] (-2504.368) * (-2504.969) (-2504.747) [-2506.991] (-2508.080) -- 0:01:20
      36500 -- (-2505.294) [-2506.293] (-2513.320) (-2506.493) * [-2506.569] (-2507.082) (-2505.537) (-2508.890) -- 0:01:19
      37000 -- (-2512.874) (-2505.739) [-2507.123] (-2505.405) * (-2506.885) [-2503.900] (-2505.412) (-2507.036) -- 0:01:18
      37500 -- [-2509.987] (-2506.264) (-2511.760) (-2507.630) * [-2509.785] (-2504.750) (-2505.355) (-2507.961) -- 0:01:17
      38000 -- (-2512.259) (-2506.107) (-2523.058) [-2506.021] * [-2508.505] (-2504.955) (-2503.358) (-2506.535) -- 0:01:15
      38500 -- [-2515.875] (-2505.549) (-2505.689) (-2505.461) * [-2505.966] (-2506.327) (-2505.881) (-2510.325) -- 0:01:14
      39000 -- [-2510.662] (-2505.881) (-2509.768) (-2506.010) * [-2504.998] (-2504.753) (-2506.282) (-2510.222) -- 0:01:13
      39500 -- [-2504.917] (-2508.510) (-2510.209) (-2504.490) * (-2507.457) (-2504.636) [-2506.972] (-2509.976) -- 0:01:12
      40000 -- [-2507.188] (-2508.510) (-2515.522) (-2507.061) * (-2508.080) [-2502.846] (-2506.807) (-2508.725) -- 0:01:12

      Average standard deviation of split frequencies: 0.037094

      40500 -- (-2507.352) (-2508.529) [-2505.059] (-2506.580) * (-2507.786) (-2505.095) (-2505.742) [-2506.253] -- 0:01:11
      41000 -- [-2514.349] (-2505.697) (-2509.125) (-2505.934) * (-2512.697) (-2504.444) [-2507.310] (-2508.233) -- 0:01:10
      41500 -- [-2506.809] (-2507.960) (-2511.429) (-2506.157) * [-2506.640] (-2504.386) (-2507.569) (-2508.204) -- 0:01:09
      42000 -- [-2508.081] (-2506.443) (-2507.956) (-2507.755) * (-2505.846) (-2504.240) [-2506.448] (-2508.425) -- 0:01:31
      42500 -- (-2506.548) [-2507.779] (-2514.617) (-2511.541) * (-2509.646) (-2505.423) [-2507.041] (-2506.195) -- 0:01:30
      43000 -- (-2509.070) (-2507.008) [-2509.679] (-2505.677) * (-2506.381) [-2503.697] (-2509.019) (-2505.654) -- 0:01:29
      43500 -- (-2505.082) [-2505.077] (-2513.899) (-2507.464) * (-2506.493) (-2503.046) (-2507.613) [-2505.784] -- 0:01:27
      44000 -- (-2510.120) (-2503.341) [-2515.224] (-2506.258) * (-2506.859) [-2503.590] (-2504.262) (-2510.410) -- 0:01:26
      44500 -- (-2502.658) (-2506.098) [-2511.287] (-2506.173) * (-2507.532) (-2504.986) [-2505.993] (-2505.380) -- 0:01:25
      45000 -- (-2510.304) (-2506.273) (-2514.600) [-2506.709] * (-2507.773) [-2508.190] (-2503.268) (-2506.569) -- 0:01:24

      Average standard deviation of split frequencies: 0.033184

      45500 -- (-2510.178) (-2506.020) [-2507.900] (-2505.095) * (-2507.554) (-2508.590) [-2503.560] (-2508.151) -- 0:01:23
      46000 -- (-2506.542) [-2505.811] (-2508.927) (-2506.353) * (-2505.970) (-2509.008) [-2503.146] (-2505.666) -- 0:01:22
      46500 -- (-2507.476) (-2507.565) [-2507.825] (-2506.248) * (-2508.813) (-2507.823) (-2505.174) [-2504.297] -- 0:01:22
      47000 -- [-2511.314] (-2503.548) (-2511.532) (-2507.180) * (-2508.342) (-2507.971) [-2505.421] (-2504.441) -- 0:01:21
      47500 -- [-2510.093] (-2504.164) (-2510.218) (-2506.250) * (-2505.632) (-2505.488) (-2504.589) [-2505.250] -- 0:01:20
      48000 -- (-2511.476) [-2504.743] (-2515.188) (-2506.098) * (-2505.479) (-2503.594) (-2506.514) [-2505.583] -- 0:01:19
      48500 -- (-2515.565) (-2503.151) (-2515.586) [-2505.190] * (-2509.342) [-2503.364] (-2509.838) (-2505.814) -- 0:01:18
      49000 -- (-2514.602) (-2502.669) [-2508.719] (-2504.785) * [-2505.758] (-2504.519) (-2508.822) (-2508.703) -- 0:01:17
      49500 -- [-2509.578] (-2503.190) (-2516.640) (-2506.330) * (-2508.041) [-2502.798] (-2505.841) (-2505.719) -- 0:01:16
      50000 -- (-2505.410) (-2506.323) [-2507.870] (-2505.279) * (-2510.404) (-2503.229) (-2505.545) [-2506.396] -- 0:01:16

      Average standard deviation of split frequencies: 0.033229

      50500 -- (-2515.788) (-2505.627) (-2508.592) [-2506.047] * (-2509.292) (-2502.273) [-2506.989] (-2506.601) -- 0:01:15
      51000 -- (-2509.689) (-2506.416) (-2506.876) [-2504.842] * (-2505.786) (-2504.728) (-2508.555) [-2505.255] -- 0:01:14
      51500 -- (-2511.620) (-2507.740) [-2516.662] (-2504.393) * (-2507.609) (-2504.920) [-2507.622] (-2505.386) -- 0:01:13
      52000 -- (-2508.666) [-2511.474] (-2508.171) (-2504.047) * (-2506.616) [-2503.085] (-2510.161) (-2507.055) -- 0:01:12
      52500 -- [-2516.991] (-2508.064) (-2509.281) (-2503.505) * (-2505.085) [-2503.221] (-2506.408) (-2508.314) -- 0:01:12
      53000 -- (-2505.402) [-2506.681] (-2509.285) (-2506.643) * (-2506.854) (-2503.755) (-2508.487) [-2509.444] -- 0:01:11
      53500 -- [-2507.489] (-2504.509) (-2511.409) (-2506.029) * (-2507.806) [-2505.048] (-2508.565) (-2505.780) -- 0:01:10
      54000 -- [-2509.279] (-2507.192) (-2511.916) (-2506.703) * (-2506.698) (-2503.539) (-2506.927) [-2504.388] -- 0:01:10
      54500 -- (-2509.471) [-2505.885] (-2526.725) (-2509.529) * (-2507.905) (-2507.050) (-2514.039) [-2504.419] -- 0:01:09
      55000 -- [-2513.484] (-2506.773) (-2508.692) (-2507.134) * (-2505.826) (-2506.602) [-2508.087] (-2504.735) -- 0:01:08

      Average standard deviation of split frequencies: 0.030866

      55500 -- [-2508.428] (-2507.949) (-2511.219) (-2503.395) * (-2504.379) (-2511.509) (-2507.068) [-2504.449] -- 0:01:08
      56000 -- (-2510.527) (-2510.833) [-2507.657] (-2504.740) * (-2505.656) (-2506.004) (-2505.978) [-2505.075] -- 0:01:24
      56500 -- [-2509.946] (-2506.678) (-2512.515) (-2507.062) * [-2505.706] (-2506.436) (-2507.417) (-2505.740) -- 0:01:23
      57000 -- (-2508.290) (-2509.430) (-2509.943) [-2503.583] * [-2506.528] (-2503.879) (-2507.053) (-2507.397) -- 0:01:22
      57500 -- (-2509.518) (-2505.407) [-2512.555] (-2505.119) * [-2503.665] (-2505.882) (-2508.249) (-2502.742) -- 0:01:21
      58000 -- (-2509.437) (-2504.811) [-2508.383] (-2506.070) * [-2504.954] (-2508.700) (-2508.249) (-2504.020) -- 0:01:21
      58500 -- [-2512.786] (-2509.426) (-2510.474) (-2507.972) * (-2505.721) [-2505.768] (-2508.479) (-2503.665) -- 0:01:20
      59000 -- [-2509.643] (-2507.882) (-2510.516) (-2507.093) * (-2506.255) (-2505.379) [-2505.952] (-2504.357) -- 0:01:19
      59500 -- (-2514.429) (-2506.927) [-2506.303] (-2508.208) * (-2505.752) (-2505.953) [-2506.891] (-2503.708) -- 0:01:19
      60000 -- [-2503.777] (-2507.179) (-2512.850) (-2507.651) * (-2506.862) (-2505.831) (-2507.894) [-2514.326] -- 0:01:18

      Average standard deviation of split frequencies: 0.031452

      60500 -- [-2505.444] (-2506.589) (-2509.512) (-2507.521) * [-2506.044] (-2505.962) (-2510.079) (-2509.231) -- 0:01:17
      61000 -- (-2509.865) (-2505.399) [-2508.234] (-2505.859) * (-2506.044) (-2505.728) (-2510.958) [-2504.760] -- 0:01:16
      61500 -- [-2508.953] (-2510.497) (-2511.920) (-2506.476) * (-2505.377) (-2506.025) (-2507.767) [-2502.784] -- 0:01:16
      62000 -- (-2511.298) (-2511.223) [-2510.119] (-2503.592) * (-2506.362) (-2506.727) [-2506.874] (-2506.327) -- 0:01:15
      62500 -- (-2514.296) (-2510.347) (-2518.220) [-2506.973] * (-2505.447) (-2507.877) [-2506.795] (-2503.778) -- 0:01:15
      63000 -- (-2519.104) (-2511.388) [-2513.135] (-2506.029) * (-2511.652) (-2504.874) [-2507.217] (-2505.071) -- 0:01:14
      63500 -- (-2509.624) (-2510.962) (-2527.511) [-2506.162] * [-2507.815] (-2506.049) (-2506.206) (-2505.082) -- 0:01:13
      64000 -- (-2517.671) (-2508.430) [-2509.248] (-2507.307) * (-2506.891) (-2508.493) (-2506.471) [-2506.274] -- 0:01:13
      64500 -- (-2513.319) (-2507.751) [-2505.656] (-2504.654) * [-2504.891] (-2512.240) (-2506.559) (-2505.575) -- 0:01:12
      65000 -- (-2511.301) (-2507.581) [-2508.961] (-2504.801) * (-2503.885) (-2511.627) [-2508.164] (-2505.593) -- 0:01:11

      Average standard deviation of split frequencies: 0.032296

      65500 -- (-2509.787) (-2507.661) (-2506.822) [-2505.725] * (-2506.799) (-2510.200) (-2507.652) [-2505.511] -- 0:01:11
      66000 -- (-2508.573) [-2506.441] (-2514.488) (-2505.026) * (-2510.508) [-2508.130] (-2506.205) (-2505.498) -- 0:01:10
      66500 -- (-2514.171) (-2507.855) (-2512.568) [-2507.610] * (-2510.429) (-2504.447) (-2505.484) [-2505.498] -- 0:01:10
      67000 -- [-2510.775] (-2507.815) (-2505.338) (-2508.061) * [-2506.772] (-2507.212) (-2505.473) (-2505.739) -- 0:01:09
      67500 -- [-2510.220] (-2507.591) (-2507.641) (-2510.323) * [-2506.479] (-2506.425) (-2505.236) (-2505.432) -- 0:01:09
      68000 -- (-2506.720) [-2506.281] (-2505.881) (-2508.965) * (-2505.575) (-2508.734) [-2504.969] (-2505.416) -- 0:01:08
      68500 -- (-2505.568) (-2508.759) [-2508.543] (-2513.360) * (-2508.927) (-2507.635) [-2505.334] (-2505.920) -- 0:01:07
      69000 -- (-2505.454) [-2508.393] (-2509.147) (-2509.182) * [-2506.812] (-2509.226) (-2506.824) (-2506.705) -- 0:01:07
      69500 -- (-2507.085) [-2506.654] (-2507.003) (-2509.518) * (-2509.903) (-2507.705) (-2505.338) [-2504.947] -- 0:01:20
      70000 -- (-2507.817) (-2507.319) [-2510.042] (-2505.674) * (-2506.621) (-2505.906) [-2504.272] (-2505.434) -- 0:01:19

      Average standard deviation of split frequencies: 0.034804

      70500 -- (-2505.568) (-2508.020) (-2506.177) [-2505.603] * (-2504.595) [-2508.045] (-2505.434) (-2509.420) -- 0:01:19
      71000 -- (-2504.788) [-2506.444] (-2505.844) (-2508.271) * (-2503.626) [-2509.072] (-2505.345) (-2510.390) -- 0:01:18
      71500 -- (-2504.064) [-2506.411] (-2507.905) (-2510.317) * [-2504.746] (-2507.131) (-2504.185) (-2510.731) -- 0:01:17
      72000 -- [-2505.089] (-2510.431) (-2509.942) (-2505.592) * (-2504.096) [-2506.972] (-2504.171) (-2508.321) -- 0:01:17
      72500 -- [-2502.890] (-2508.687) (-2508.886) (-2506.566) * [-2504.894] (-2506.267) (-2506.196) (-2509.424) -- 0:01:16
      73000 -- (-2505.749) (-2506.336) (-2507.331) [-2506.194] * (-2508.716) (-2508.862) [-2506.714] (-2507.467) -- 0:01:16
      73500 -- (-2506.837) (-2510.336) (-2504.171) [-2504.014] * (-2504.876) (-2506.561) [-2503.546] (-2509.599) -- 0:01:15
      74000 -- (-2503.216) (-2506.499) [-2504.953] (-2506.739) * [-2504.875] (-2509.260) (-2505.817) (-2509.121) -- 0:01:15
      74500 -- (-2507.556) (-2509.750) (-2505.348) [-2507.855] * [-2505.194] (-2508.257) (-2505.380) (-2507.870) -- 0:01:14
      75000 -- [-2509.669] (-2507.714) (-2507.363) (-2510.023) * (-2507.272) (-2506.362) [-2504.882] (-2506.609) -- 0:01:14

      Average standard deviation of split frequencies: 0.033269

      75500 -- (-2503.642) (-2507.842) [-2504.079] (-2506.701) * (-2508.550) (-2505.837) [-2504.417] (-2507.383) -- 0:01:13
      76000 -- [-2504.386] (-2508.360) (-2506.529) (-2505.814) * (-2505.013) (-2506.052) [-2505.197] (-2505.616) -- 0:01:12
      76500 -- [-2506.941] (-2506.517) (-2510.731) (-2504.787) * (-2505.150) (-2505.505) (-2505.266) [-2505.943] -- 0:01:12
      77000 -- [-2502.310] (-2507.290) (-2506.793) (-2506.923) * [-2506.274] (-2505.984) (-2505.807) (-2506.573) -- 0:01:11
      77500 -- [-2508.668] (-2506.752) (-2513.810) (-2504.817) * (-2508.480) (-2510.657) (-2503.156) [-2505.765] -- 0:01:11
      78000 -- (-2507.597) (-2508.631) (-2510.253) [-2506.668] * (-2505.497) (-2508.045) (-2507.086) [-2504.835] -- 0:01:10
      78500 -- (-2507.288) (-2507.579) (-2508.003) [-2506.358] * (-2506.096) (-2507.933) (-2507.470) [-2506.611] -- 0:01:10
      79000 -- [-2506.679] (-2506.187) (-2505.713) (-2506.699) * (-2505.275) (-2507.000) [-2505.067] (-2504.673) -- 0:01:09
      79500 -- (-2504.586) (-2507.085) [-2508.025] (-2506.779) * [-2505.573] (-2507.400) (-2504.503) (-2507.440) -- 0:01:09
      80000 -- (-2505.339) (-2505.666) [-2506.143] (-2506.836) * [-2504.900] (-2507.326) (-2505.351) (-2504.708) -- 0:01:09

      Average standard deviation of split frequencies: 0.031065

      80500 -- [-2504.472] (-2507.581) (-2508.032) (-2509.225) * (-2505.171) (-2508.037) [-2508.097] (-2508.377) -- 0:01:08
      81000 -- (-2503.510) [-2507.448] (-2505.132) (-2508.341) * (-2512.012) (-2508.134) [-2506.228] (-2508.618) -- 0:01:08
      81500 -- [-2505.712] (-2504.193) (-2502.414) (-2506.725) * [-2505.185] (-2505.591) (-2505.109) (-2509.199) -- 0:01:07
      82000 -- (-2507.306) (-2504.861) [-2504.998] (-2504.570) * (-2510.853) (-2509.514) (-2506.725) [-2506.900] -- 0:01:07
      82500 -- (-2507.048) (-2505.757) [-2505.496] (-2504.505) * (-2507.026) (-2510.975) [-2507.172] (-2506.706) -- 0:01:06
      83000 -- (-2509.952) (-2503.216) [-2503.841] (-2504.194) * (-2507.639) (-2509.218) [-2507.283] (-2506.537) -- 0:01:06
      83500 -- (-2507.389) [-2503.273] (-2503.795) (-2509.217) * [-2503.168] (-2507.538) (-2505.747) (-2506.948) -- 0:01:16
      84000 -- (-2514.714) [-2502.511] (-2504.043) (-2509.966) * (-2503.827) (-2507.919) (-2507.174) [-2507.927] -- 0:01:16
      84500 -- (-2509.528) [-2503.872] (-2504.548) (-2505.877) * [-2507.112] (-2507.811) (-2507.354) (-2503.107) -- 0:01:15
      85000 -- (-2507.339) [-2503.498] (-2505.188) (-2509.709) * (-2506.970) [-2505.642] (-2508.263) (-2503.698) -- 0:01:15

      Average standard deviation of split frequencies: 0.026411

      85500 -- (-2505.706) [-2502.953] (-2506.104) (-2507.522) * [-2506.371] (-2507.853) (-2508.278) (-2504.328) -- 0:01:14
      86000 -- (-2511.800) (-2503.899) (-2508.139) [-2507.558] * [-2508.565] (-2505.019) (-2509.586) (-2506.061) -- 0:01:14
      86500 -- (-2507.458) (-2504.036) [-2506.903] (-2505.356) * (-2512.666) [-2505.238] (-2507.562) (-2506.447) -- 0:01:13
      87000 -- [-2506.065] (-2505.426) (-2507.807) (-2504.634) * (-2512.707) [-2506.278] (-2507.503) (-2506.245) -- 0:01:13
      87500 -- (-2506.379) (-2503.230) (-2505.650) [-2505.321] * (-2507.951) (-2505.602) (-2506.865) [-2507.422] -- 0:01:13
      88000 -- [-2504.442] (-2503.677) (-2505.939) (-2503.793) * (-2506.873) [-2506.597] (-2509.175) (-2508.439) -- 0:01:12
      88500 -- (-2509.742) (-2504.727) (-2506.515) [-2507.321] * (-2506.790) (-2506.375) (-2508.969) [-2507.375] -- 0:01:12
      89000 -- (-2509.173) (-2505.115) (-2509.770) [-2505.593] * (-2505.514) (-2507.945) [-2506.694] (-2505.145) -- 0:01:11
      89500 -- [-2506.307] (-2505.900) (-2509.255) (-2504.734) * [-2505.437] (-2506.847) (-2505.491) (-2506.429) -- 0:01:11
      90000 -- [-2506.622] (-2506.778) (-2510.320) (-2505.563) * (-2506.656) (-2507.516) (-2509.914) [-2506.151] -- 0:01:10

      Average standard deviation of split frequencies: 0.023633

      90500 -- [-2505.283] (-2504.895) (-2505.149) (-2504.491) * (-2509.948) (-2512.195) [-2505.292] (-2503.569) -- 0:01:10
      91000 -- (-2505.771) [-2507.002] (-2506.579) (-2507.926) * (-2506.330) (-2509.483) [-2506.929] (-2505.102) -- 0:01:09
      91500 -- [-2506.646] (-2505.676) (-2509.505) (-2507.316) * (-2507.220) (-2505.471) (-2506.341) [-2505.662] -- 0:01:09
      92000 -- (-2506.866) (-2505.854) [-2512.416] (-2509.561) * (-2506.658) [-2505.131] (-2504.656) (-2504.510) -- 0:01:09
      92500 -- [-2504.841] (-2505.557) (-2513.365) (-2505.449) * (-2506.036) (-2504.304) [-2503.151] (-2511.034) -- 0:01:08
      93000 -- (-2505.650) [-2505.520] (-2513.292) (-2505.111) * (-2505.228) [-2506.356] (-2504.845) (-2507.822) -- 0:01:08
      93500 -- (-2506.586) [-2504.108] (-2508.561) (-2507.269) * [-2504.673] (-2503.819) (-2503.778) (-2508.898) -- 0:01:07
      94000 -- (-2505.540) (-2506.617) (-2513.132) [-2505.417] * (-2507.022) (-2505.390) [-2505.307] (-2508.198) -- 0:01:07
      94500 -- (-2505.334) (-2505.155) (-2505.498) [-2505.417] * [-2505.597] (-2505.856) (-2507.758) (-2511.065) -- 0:01:07
      95000 -- [-2506.168] (-2504.294) (-2505.250) (-2508.765) * (-2504.622) (-2504.877) [-2506.071] (-2515.759) -- 0:01:06

      Average standard deviation of split frequencies: 0.023816

      95500 -- [-2504.613] (-2504.077) (-2505.708) (-2507.171) * [-2505.459] (-2506.174) (-2504.627) (-2506.926) -- 0:01:06
      96000 -- (-2505.214) [-2503.911] (-2505.683) (-2508.997) * (-2505.679) [-2506.476] (-2505.866) (-2508.195) -- 0:01:05
      96500 -- [-2508.493] (-2504.552) (-2506.416) (-2507.199) * (-2505.618) (-2505.191) (-2507.361) [-2506.990] -- 0:01:05
      97000 -- (-2506.267) [-2505.159] (-2508.526) (-2509.351) * (-2506.039) [-2506.503] (-2507.033) (-2506.305) -- 0:01:05
      97500 -- [-2505.627] (-2504.643) (-2507.328) (-2507.740) * (-2505.728) (-2506.357) [-2506.599] (-2506.524) -- 0:01:14
      98000 -- [-2504.907] (-2504.860) (-2506.681) (-2506.763) * (-2506.594) (-2505.997) [-2507.142] (-2508.385) -- 0:01:13
      98500 -- [-2505.900] (-2505.721) (-2507.038) (-2506.175) * (-2507.796) (-2506.847) (-2503.421) [-2507.140] -- 0:01:13
      99000 -- (-2507.617) [-2503.193] (-2507.089) (-2509.998) * (-2505.452) (-2509.189) [-2504.588] (-2505.635) -- 0:01:12
      99500 -- (-2505.802) (-2506.095) [-2507.716] (-2505.654) * (-2506.965) (-2510.524) [-2508.390] (-2506.561) -- 0:01:12
      100000 -- [-2504.387] (-2505.123) (-2507.891) (-2512.507) * (-2504.930) (-2504.450) (-2508.967) [-2504.648] -- 0:01:12

      Average standard deviation of split frequencies: 0.024819

      100500 -- (-2506.352) [-2505.789] (-2507.557) (-2516.027) * (-2506.224) (-2503.498) (-2505.334) [-2506.222] -- 0:01:11
      101000 -- (-2507.691) (-2504.852) [-2508.701] (-2511.608) * [-2508.356] (-2505.285) (-2505.121) (-2509.643) -- 0:01:11
      101500 -- (-2504.855) (-2504.772) (-2508.878) [-2505.795] * (-2508.172) (-2504.779) (-2504.141) [-2506.981] -- 0:01:10
      102000 -- [-2503.537] (-2508.177) (-2508.073) (-2506.896) * (-2509.172) (-2505.170) [-2506.215] (-2504.974) -- 0:01:10
      102500 -- (-2504.608) (-2508.141) [-2507.660] (-2507.403) * (-2508.083) (-2507.054) [-2504.581] (-2506.524) -- 0:01:10
      103000 -- [-2511.574] (-2504.929) (-2507.475) (-2508.923) * (-2507.409) (-2509.042) (-2506.814) [-2504.303] -- 0:01:09
      103500 -- (-2509.007) [-2505.378] (-2505.591) (-2512.122) * (-2505.285) [-2508.927] (-2510.600) (-2505.868) -- 0:01:09
      104000 -- (-2509.034) (-2505.893) [-2506.028] (-2510.974) * (-2505.929) [-2511.409] (-2511.193) (-2507.022) -- 0:01:08
      104500 -- (-2510.326) (-2504.898) [-2505.786] (-2508.383) * (-2512.152) [-2504.571] (-2506.644) (-2510.888) -- 0:01:08
      105000 -- (-2508.871) (-2507.478) [-2511.112] (-2508.466) * (-2506.438) (-2503.047) (-2509.402) [-2503.850] -- 0:01:08

      Average standard deviation of split frequencies: 0.025673

      105500 -- [-2505.285] (-2505.588) (-2508.311) (-2512.954) * [-2503.947] (-2504.303) (-2507.942) (-2504.693) -- 0:01:07
      106000 -- [-2504.807] (-2509.214) (-2504.888) (-2510.922) * [-2503.768] (-2507.052) (-2503.352) (-2508.477) -- 0:01:07
      106500 -- (-2507.871) (-2509.761) (-2504.776) [-2504.922] * (-2505.000) [-2506.351] (-2506.070) (-2508.866) -- 0:01:07
      107000 -- [-2507.599] (-2509.902) (-2506.640) (-2505.234) * (-2505.331) (-2503.560) (-2503.929) [-2508.618] -- 0:01:06
      107500 -- (-2506.219) (-2509.689) [-2505.728] (-2505.128) * (-2505.151) [-2506.171] (-2505.741) (-2505.306) -- 0:01:06
      108000 -- [-2505.569] (-2511.406) (-2505.677) (-2507.554) * (-2508.031) (-2505.327) (-2506.638) [-2503.993] -- 0:01:06
      108500 -- (-2504.808) (-2508.633) (-2506.606) [-2507.946] * (-2507.451) (-2507.046) (-2503.398) [-2505.695] -- 0:01:05
      109000 -- (-2506.930) (-2509.772) (-2506.754) [-2505.631] * [-2505.170] (-2505.214) (-2505.084) (-2505.096) -- 0:01:05
      109500 -- (-2509.090) (-2509.186) (-2506.649) [-2503.586] * (-2505.231) [-2506.983] (-2505.136) (-2505.431) -- 0:01:05
      110000 -- (-2509.107) (-2510.083) (-2508.343) [-2505.407] * (-2506.907) (-2505.299) (-2508.305) [-2506.269] -- 0:01:04

      Average standard deviation of split frequencies: 0.026369

      110500 -- (-2509.389) (-2506.338) (-2507.181) [-2505.331] * (-2505.801) (-2507.626) [-2511.762] (-2504.874) -- 0:01:04
      111000 -- (-2506.255) (-2506.052) (-2504.987) [-2505.489] * (-2511.174) (-2507.653) [-2503.413] (-2505.892) -- 0:01:04
      111500 -- (-2505.913) [-2506.583] (-2505.462) (-2506.851) * (-2509.336) [-2505.190] (-2503.589) (-2506.725) -- 0:01:11
      112000 -- (-2505.374) (-2505.996) (-2508.765) [-2507.201] * [-2507.364] (-2505.048) (-2505.977) (-2508.493) -- 0:01:11
      112500 -- (-2505.967) (-2506.664) (-2508.819) [-2506.450] * (-2508.519) (-2505.242) [-2504.613] (-2508.789) -- 0:01:11
      113000 -- [-2505.532] (-2503.339) (-2506.313) (-2504.310) * (-2507.258) (-2505.712) [-2506.811] (-2508.783) -- 0:01:10
      113500 -- (-2507.331) (-2505.354) (-2507.205) [-2506.042] * (-2506.272) [-2503.430] (-2506.192) (-2508.806) -- 0:01:10
      114000 -- [-2505.765] (-2505.130) (-2510.738) (-2505.594) * (-2504.265) (-2504.945) (-2506.699) [-2508.797] -- 0:01:09
      114500 -- (-2505.006) (-2505.122) (-2513.766) [-2505.312] * [-2506.775] (-2508.068) (-2505.347) (-2508.923) -- 0:01:09
      115000 -- (-2503.610) (-2506.925) [-2508.704] (-2506.119) * (-2508.284) (-2511.737) [-2507.144] (-2507.370) -- 0:01:09

      Average standard deviation of split frequencies: 0.024383

      115500 -- [-2507.364] (-2505.705) (-2507.466) (-2508.802) * (-2509.061) (-2509.352) [-2507.377] (-2508.664) -- 0:01:08
      116000 -- [-2505.528] (-2504.612) (-2511.635) (-2504.062) * (-2504.919) [-2507.556] (-2506.440) (-2507.660) -- 0:01:08
      116500 -- (-2505.613) (-2504.450) (-2508.838) [-2504.177] * (-2508.550) [-2508.681] (-2505.968) (-2505.344) -- 0:01:08
      117000 -- (-2505.996) (-2506.253) (-2510.875) [-2505.661] * [-2506.541] (-2507.404) (-2506.966) (-2505.421) -- 0:01:07
      117500 -- [-2505.152] (-2503.222) (-2506.489) (-2507.462) * (-2505.381) (-2509.779) [-2507.747] (-2508.736) -- 0:01:07
      118000 -- [-2505.994] (-2505.310) (-2506.146) (-2506.457) * (-2507.030) (-2516.289) (-2505.338) [-2508.040] -- 0:01:07
      118500 -- [-2505.628] (-2506.026) (-2506.481) (-2505.202) * [-2505.573] (-2504.461) (-2506.391) (-2508.808) -- 0:01:06
      119000 -- [-2506.140] (-2506.656) (-2504.243) (-2505.532) * (-2505.135) (-2504.597) (-2504.338) [-2507.113] -- 0:01:06
      119500 -- (-2508.327) (-2506.663) (-2506.673) [-2505.261] * [-2510.439] (-2505.476) (-2507.943) (-2508.019) -- 0:01:06
      120000 -- (-2506.390) (-2506.306) [-2509.089] (-2505.184) * [-2504.942] (-2507.389) (-2508.165) (-2508.563) -- 0:01:06

      Average standard deviation of split frequencies: 0.022882

      120500 -- (-2504.901) (-2506.164) (-2506.808) [-2506.621] * [-2505.498] (-2508.464) (-2508.494) (-2507.786) -- 0:01:05
      121000 -- [-2505.833] (-2505.582) (-2507.611) (-2508.224) * [-2506.158] (-2505.555) (-2506.051) (-2506.534) -- 0:01:05
      121500 -- [-2505.542] (-2503.758) (-2511.990) (-2508.382) * [-2505.502] (-2505.396) (-2505.693) (-2507.899) -- 0:01:05
      122000 -- [-2506.575] (-2507.438) (-2507.472) (-2505.203) * [-2505.790] (-2506.592) (-2509.370) (-2507.372) -- 0:01:04
      122500 -- [-2504.774] (-2509.078) (-2507.891) (-2506.106) * (-2506.285) (-2506.875) [-2505.192] (-2512.880) -- 0:01:04
      123000 -- [-2507.335] (-2503.542) (-2510.983) (-2506.981) * (-2510.262) (-2507.238) (-2506.380) [-2505.131] -- 0:01:04
      123500 -- [-2507.852] (-2504.741) (-2509.981) (-2506.694) * [-2504.575] (-2507.924) (-2506.411) (-2506.829) -- 0:01:03
      124000 -- (-2510.974) [-2504.716] (-2509.830) (-2506.402) * [-2504.462] (-2505.876) (-2506.791) (-2507.136) -- 0:01:03
      124500 -- [-2507.929] (-2508.874) (-2506.401) (-2512.146) * (-2504.400) [-2504.267] (-2507.149) (-2506.131) -- 0:01:03
      125000 -- (-2506.696) (-2505.655) [-2504.278] (-2506.633) * (-2508.783) (-2508.456) [-2506.920] (-2506.874) -- 0:01:03

      Average standard deviation of split frequencies: 0.022448

      125500 -- (-2506.573) [-2507.225] (-2507.811) (-2507.030) * [-2502.709] (-2507.353) (-2510.344) (-2507.490) -- 0:01:09
      126000 -- [-2506.126] (-2506.772) (-2508.025) (-2507.330) * [-2503.317] (-2506.681) (-2511.660) (-2504.509) -- 0:01:09
      126500 -- (-2505.618) (-2505.875) (-2510.090) [-2504.890] * (-2504.435) [-2502.879] (-2508.185) (-2505.376) -- 0:01:09
      127000 -- (-2510.242) (-2505.408) (-2508.651) [-2506.069] * (-2505.912) [-2504.587] (-2508.335) (-2506.103) -- 0:01:08
      127500 -- [-2506.780] (-2505.587) (-2507.052) (-2504.820) * [-2504.473] (-2505.226) (-2506.739) (-2505.784) -- 0:01:08
      128000 -- (-2506.779) (-2503.808) (-2505.505) [-2506.240] * (-2506.314) (-2508.144) (-2506.651) [-2504.126] -- 0:01:08
      128500 -- [-2505.247] (-2506.371) (-2504.929) (-2504.381) * (-2505.387) (-2513.197) (-2509.713) [-2511.379] -- 0:01:07
      129000 -- (-2506.533) [-2505.710] (-2505.996) (-2504.645) * (-2505.153) (-2513.121) [-2509.162] (-2510.848) -- 0:01:07
      129500 -- (-2505.813) [-2504.196] (-2505.127) (-2504.613) * (-2505.353) (-2509.431) (-2508.203) [-2505.677] -- 0:01:07
      130000 -- (-2505.658) [-2504.649] (-2504.737) (-2505.325) * (-2509.623) (-2515.061) (-2508.771) [-2511.032] -- 0:01:06

      Average standard deviation of split frequencies: 0.020787

      130500 -- (-2505.280) (-2503.740) [-2504.473] (-2507.253) * [-2506.156] (-2511.263) (-2504.991) (-2504.906) -- 0:01:06
      131000 -- (-2505.878) (-2503.750) [-2505.417] (-2510.261) * (-2506.595) (-2507.569) [-2504.229] (-2505.410) -- 0:01:06
      131500 -- (-2505.272) (-2503.776) (-2504.214) [-2506.625] * (-2504.237) (-2509.743) [-2506.041] (-2506.041) -- 0:01:06
      132000 -- [-2506.289] (-2504.209) (-2506.683) (-2504.955) * (-2504.433) (-2504.730) (-2507.740) [-2504.339] -- 0:01:05
      132500 -- (-2506.586) (-2504.322) (-2506.678) [-2503.023] * (-2502.827) (-2502.874) [-2504.732] (-2509.813) -- 0:01:05
      133000 -- (-2508.085) (-2504.683) (-2503.114) [-2506.141] * (-2503.247) [-2503.847] (-2505.775) (-2507.217) -- 0:01:05
      133500 -- (-2507.747) [-2506.077] (-2506.556) (-2506.166) * (-2506.972) (-2504.880) [-2504.809] (-2506.135) -- 0:01:04
      134000 -- (-2511.156) (-2507.159) [-2506.649] (-2506.021) * (-2504.876) (-2504.583) (-2504.004) [-2505.040] -- 0:01:04
      134500 -- (-2506.718) (-2505.704) [-2507.763] (-2510.183) * (-2502.954) (-2505.111) (-2505.132) [-2507.151] -- 0:01:04
      135000 -- (-2506.581) (-2506.354) [-2504.614] (-2506.292) * [-2506.405] (-2505.598) (-2503.323) (-2506.214) -- 0:01:04

      Average standard deviation of split frequencies: 0.021457

      135500 -- (-2506.918) (-2504.883) (-2506.718) [-2506.624] * (-2506.076) (-2505.614) (-2504.655) [-2503.915] -- 0:01:03
      136000 -- (-2512.217) (-2506.971) [-2504.869] (-2509.332) * (-2508.692) (-2502.877) (-2507.267) [-2503.856] -- 0:01:03
      136500 -- (-2507.561) (-2507.618) (-2507.658) [-2505.631] * (-2506.535) (-2509.153) (-2508.038) [-2504.763] -- 0:01:03
      137000 -- (-2509.474) (-2506.659) [-2503.965] (-2504.544) * [-2503.733] (-2509.063) (-2507.647) (-2504.553) -- 0:01:02
      137500 -- (-2508.015) [-2504.461] (-2507.214) (-2507.009) * (-2508.799) (-2504.804) [-2504.714] (-2506.100) -- 0:01:02
      138000 -- (-2507.768) [-2504.239] (-2506.477) (-2504.464) * [-2507.526] (-2503.411) (-2507.762) (-2505.227) -- 0:01:02
      138500 -- (-2504.007) [-2504.868] (-2506.571) (-2504.363) * (-2503.297) (-2506.931) (-2508.400) [-2503.335] -- 0:01:02
      139000 -- (-2504.973) (-2505.463) (-2504.089) [-2504.409] * [-2507.658] (-2509.239) (-2506.727) (-2508.269) -- 0:01:01
      139500 -- (-2508.675) (-2507.769) [-2507.926] (-2506.980) * (-2505.674) (-2507.082) [-2505.560] (-2510.117) -- 0:01:07
      140000 -- (-2507.180) (-2511.445) (-2507.700) [-2507.242] * (-2508.617) (-2506.888) (-2505.606) [-2503.906] -- 0:01:07

      Average standard deviation of split frequencies: 0.021783

      140500 -- (-2507.278) (-2512.404) (-2504.791) [-2506.268] * (-2510.492) (-2506.398) (-2504.790) [-2508.242] -- 0:01:07
      141000 -- (-2512.216) [-2507.848] (-2503.338) (-2505.785) * (-2508.563) (-2505.776) (-2505.718) [-2504.530] -- 0:01:07
      141500 -- (-2510.128) [-2507.845] (-2505.529) (-2505.046) * (-2508.840) (-2506.204) (-2506.568) [-2504.870] -- 0:01:06
      142000 -- (-2506.670) (-2504.919) [-2506.523] (-2506.689) * [-2504.583] (-2506.590) (-2506.521) (-2506.301) -- 0:01:06
      142500 -- (-2505.178) (-2507.451) [-2505.746] (-2505.494) * (-2506.020) (-2508.727) (-2508.037) [-2509.516] -- 0:01:06
      143000 -- (-2504.824) (-2503.617) [-2504.524] (-2507.784) * (-2505.587) (-2505.156) [-2504.359] (-2503.936) -- 0:01:05
      143500 -- (-2508.617) [-2503.986] (-2506.449) (-2510.076) * (-2506.827) (-2503.659) [-2504.384] (-2503.799) -- 0:01:05
      144000 -- [-2506.146] (-2505.030) (-2506.200) (-2503.158) * (-2504.310) (-2505.200) (-2505.151) [-2503.519] -- 0:01:05
      144500 -- [-2506.722] (-2504.121) (-2505.854) (-2505.631) * (-2507.774) [-2504.134] (-2502.340) (-2505.008) -- 0:01:05
      145000 -- [-2505.531] (-2505.962) (-2506.255) (-2506.011) * (-2506.000) (-2504.907) [-2508.552] (-2505.547) -- 0:01:04

      Average standard deviation of split frequencies: 0.019834

      145500 -- (-2506.014) (-2505.636) [-2509.051] (-2507.646) * [-2503.398] (-2505.506) (-2502.831) (-2503.935) -- 0:01:04
      146000 -- (-2508.351) (-2507.199) (-2508.873) [-2507.370] * (-2508.773) [-2506.989] (-2504.603) (-2504.870) -- 0:01:04
      146500 -- (-2507.299) (-2505.507) (-2504.687) [-2504.807] * (-2504.688) [-2505.144] (-2504.752) (-2503.389) -- 0:01:04
      147000 -- (-2506.318) (-2505.608) [-2504.419] (-2504.946) * (-2507.151) (-2507.085) [-2505.233] (-2505.400) -- 0:01:03
      147500 -- (-2506.572) (-2509.859) (-2506.191) [-2502.528] * (-2507.964) (-2506.922) [-2506.071] (-2507.453) -- 0:01:03
      148000 -- (-2508.061) (-2508.854) [-2506.576] (-2503.477) * (-2507.239) (-2507.219) (-2506.834) [-2504.893] -- 0:01:03
      148500 -- (-2508.335) (-2510.403) (-2502.241) [-2505.274] * (-2506.226) (-2511.785) (-2506.393) [-2509.682] -- 0:01:03
      149000 -- [-2505.250] (-2507.446) (-2502.499) (-2504.543) * (-2504.735) (-2507.387) [-2507.309] (-2502.589) -- 0:01:02
      149500 -- (-2504.197) (-2507.742) (-2505.762) [-2505.051] * [-2505.778] (-2506.454) (-2504.434) (-2504.484) -- 0:01:02
      150000 -- (-2503.529) (-2508.300) [-2506.097] (-2506.147) * (-2507.241) [-2508.143] (-2503.884) (-2505.732) -- 0:01:02

      Average standard deviation of split frequencies: 0.019071

      150500 -- (-2505.493) (-2510.487) (-2503.550) [-2506.321] * (-2506.976) (-2508.582) (-2504.392) [-2509.875] -- 0:01:02
      151000 -- (-2505.248) [-2504.456] (-2504.119) (-2505.083) * (-2506.156) (-2509.526) (-2507.391) [-2504.538] -- 0:01:01
      151500 -- (-2505.354) [-2504.688] (-2505.792) (-2506.615) * (-2511.448) (-2507.172) (-2506.138) [-2505.357] -- 0:01:01
      152000 -- (-2506.591) [-2506.724] (-2506.887) (-2506.326) * (-2504.509) (-2505.241) (-2505.224) [-2503.839] -- 0:01:01
      152500 -- (-2506.063) (-2505.510) [-2503.129] (-2511.139) * (-2506.717) [-2508.213] (-2506.322) (-2506.055) -- 0:01:01
      153000 -- (-2507.614) [-2507.810] (-2503.428) (-2513.909) * (-2505.505) (-2506.062) [-2505.941] (-2506.015) -- 0:01:00
      153500 -- (-2506.691) [-2506.955] (-2505.065) (-2507.918) * [-2505.778] (-2506.671) (-2505.841) (-2505.289) -- 0:01:06
      154000 -- (-2506.252) (-2505.513) [-2504.470] (-2506.026) * [-2506.686] (-2504.510) (-2504.680) (-2509.097) -- 0:01:05
      154500 -- [-2506.640] (-2506.535) (-2510.888) (-2508.225) * (-2506.890) (-2505.584) (-2504.879) [-2505.630] -- 0:01:05
      155000 -- (-2506.317) (-2504.464) [-2504.790] (-2507.330) * (-2504.936) [-2505.845] (-2505.956) (-2509.134) -- 0:01:05

      Average standard deviation of split frequencies: 0.020699

      155500 -- [-2503.221] (-2504.412) (-2502.384) (-2506.355) * [-2505.431] (-2508.261) (-2506.269) (-2510.541) -- 0:01:05
      156000 -- (-2505.314) (-2506.128) [-2506.080] (-2509.284) * (-2503.405) [-2506.239] (-2503.843) (-2507.847) -- 0:01:04
      156500 -- (-2504.768) (-2508.919) [-2503.022] (-2507.563) * (-2505.510) (-2506.194) (-2505.201) [-2507.481] -- 0:01:04
      157000 -- (-2505.393) [-2505.920] (-2501.594) (-2507.100) * (-2506.351) (-2504.034) (-2506.637) [-2510.328] -- 0:01:04
      157500 -- (-2506.904) (-2506.467) (-2507.058) [-2508.933] * (-2508.959) [-2506.802] (-2507.386) (-2509.462) -- 0:01:04
      158000 -- (-2509.564) [-2510.506] (-2508.034) (-2508.069) * (-2511.456) (-2507.359) [-2512.159] (-2505.545) -- 0:01:03
      158500 -- (-2505.896) [-2508.725] (-2506.793) (-2506.263) * [-2504.787] (-2503.737) (-2506.213) (-2506.663) -- 0:01:03
      159000 -- (-2507.021) (-2506.540) [-2507.341] (-2507.027) * (-2504.870) (-2507.469) [-2505.939] (-2506.745) -- 0:01:03
      159500 -- (-2503.512) (-2506.085) (-2505.238) [-2507.934] * (-2505.608) [-2505.366] (-2506.578) (-2504.120) -- 0:01:03
      160000 -- (-2506.689) (-2510.319) (-2504.888) [-2505.895] * (-2508.416) (-2506.747) [-2506.585] (-2504.077) -- 0:01:02

      Average standard deviation of split frequencies: 0.019071

      160500 -- (-2505.292) [-2503.760] (-2506.017) (-2505.856) * (-2509.922) (-2507.445) [-2507.773] (-2506.026) -- 0:01:02
      161000 -- (-2503.445) (-2507.662) [-2507.310] (-2507.155) * (-2508.944) (-2507.466) (-2504.714) [-2504.378] -- 0:01:02
      161500 -- (-2505.396) [-2507.782] (-2506.791) (-2506.447) * (-2506.096) [-2508.701] (-2505.582) (-2506.779) -- 0:01:02
      162000 -- [-2506.828] (-2509.703) (-2507.343) (-2507.398) * (-2508.256) (-2505.960) [-2507.597] (-2504.457) -- 0:01:02
      162500 -- [-2505.741] (-2505.934) (-2505.909) (-2506.699) * (-2508.083) (-2507.024) [-2506.547] (-2509.082) -- 0:01:01
      163000 -- [-2505.762] (-2505.048) (-2505.747) (-2507.265) * (-2508.128) (-2512.863) [-2506.381] (-2505.124) -- 0:01:01
      163500 -- (-2504.827) (-2509.349) (-2508.819) [-2508.340] * (-2517.357) [-2509.297] (-2507.312) (-2504.814) -- 0:01:01
      164000 -- (-2506.513) (-2505.687) [-2508.052] (-2508.993) * (-2509.281) (-2507.245) [-2507.398] (-2503.362) -- 0:01:01
      164500 -- [-2506.261] (-2504.167) (-2508.035) (-2510.771) * (-2510.176) [-2504.382] (-2506.479) (-2503.513) -- 0:01:00
      165000 -- (-2505.747) (-2506.253) [-2506.721] (-2509.829) * (-2508.322) [-2507.886] (-2504.298) (-2504.088) -- 0:01:00

      Average standard deviation of split frequencies: 0.019338

      165500 -- (-2506.828) [-2506.126] (-2505.061) (-2506.579) * (-2507.090) (-2508.447) (-2504.049) [-2504.383] -- 0:01:00
      166000 -- (-2507.186) [-2505.421] (-2506.658) (-2506.229) * (-2505.554) [-2506.497] (-2507.627) (-2505.315) -- 0:01:00
      166500 -- (-2507.156) (-2504.935) [-2504.097] (-2506.132) * (-2507.016) (-2506.181) (-2506.700) [-2504.831] -- 0:01:00
      167000 -- (-2508.297) [-2503.652] (-2506.148) (-2505.910) * [-2509.159] (-2505.426) (-2506.295) (-2507.133) -- 0:00:59
      167500 -- (-2509.616) (-2508.995) [-2509.345] (-2504.472) * (-2510.479) (-2508.454) (-2503.774) [-2506.842] -- 0:01:04
      168000 -- (-2507.793) [-2504.360] (-2509.098) (-2504.034) * (-2509.723) [-2508.153] (-2505.922) (-2504.877) -- 0:01:04
      168500 -- (-2505.885) (-2507.300) [-2505.532] (-2506.732) * (-2509.080) (-2507.196) [-2506.108] (-2505.680) -- 0:01:04
      169000 -- [-2505.856] (-2507.146) (-2506.085) (-2507.591) * (-2508.532) [-2509.221] (-2506.042) (-2504.707) -- 0:01:03
      169500 -- (-2508.281) (-2507.024) [-2505.313] (-2507.398) * (-2508.180) (-2509.723) (-2506.288) [-2506.142] -- 0:01:03
      170000 -- [-2509.419] (-2507.785) (-2507.597) (-2506.480) * (-2507.529) (-2504.918) (-2507.647) [-2505.191] -- 0:01:03

      Average standard deviation of split frequencies: 0.021268

      170500 -- (-2510.124) (-2505.216) [-2505.792] (-2504.305) * (-2507.333) (-2503.716) [-2508.016] (-2506.458) -- 0:01:03
      171000 -- [-2509.759] (-2506.149) (-2504.772) (-2507.580) * (-2510.721) (-2505.253) (-2507.754) [-2504.713] -- 0:01:03
      171500 -- (-2508.606) [-2505.598] (-2502.684) (-2510.135) * (-2507.957) [-2505.557] (-2510.132) (-2503.038) -- 0:01:02
      172000 -- (-2509.625) (-2505.302) (-2505.546) [-2509.173] * (-2507.828) (-2506.038) (-2504.456) [-2503.890] -- 0:01:02
      172500 -- (-2508.165) (-2506.078) [-2505.270] (-2512.010) * (-2506.975) (-2505.888) (-2506.118) [-2505.712] -- 0:01:02
      173000 -- (-2506.753) (-2504.285) (-2511.470) [-2506.084] * (-2504.918) [-2506.365] (-2504.911) (-2504.057) -- 0:01:02
      173500 -- [-2507.978] (-2506.973) (-2506.913) (-2506.625) * (-2505.689) (-2505.474) (-2511.122) [-2505.214] -- 0:01:01
      174000 -- (-2507.424) [-2506.592] (-2508.050) (-2508.472) * (-2506.897) (-2505.901) (-2504.989) [-2503.400] -- 0:01:01
      174500 -- [-2507.859] (-2506.824) (-2505.755) (-2505.546) * (-2509.998) (-2506.003) (-2506.138) [-2503.639] -- 0:01:01
      175000 -- (-2510.563) [-2507.855] (-2509.395) (-2505.152) * (-2512.849) (-2505.590) (-2503.501) [-2504.833] -- 0:01:01

      Average standard deviation of split frequencies: 0.021829

      175500 -- (-2507.018) (-2506.152) (-2508.269) [-2506.761] * (-2506.392) (-2505.882) (-2504.216) [-2504.963] -- 0:01:01
      176000 -- [-2506.157] (-2507.837) (-2505.010) (-2506.583) * (-2507.364) [-2505.357] (-2506.328) (-2505.522) -- 0:01:00
      176500 -- (-2507.221) (-2506.051) [-2503.587] (-2506.191) * (-2503.699) [-2505.413] (-2506.600) (-2506.004) -- 0:01:00
      177000 -- (-2506.793) (-2505.440) (-2506.114) [-2506.133] * (-2506.114) (-2505.317) (-2507.478) [-2504.596] -- 0:01:00
      177500 -- (-2507.832) (-2507.595) (-2507.001) [-2506.130] * (-2509.131) (-2511.551) [-2506.135] (-2506.429) -- 0:01:00
      178000 -- (-2503.006) (-2504.551) [-2504.960] (-2506.351) * (-2508.907) (-2509.460) [-2505.152] (-2510.281) -- 0:01:00
      178500 -- (-2504.494) (-2510.529) [-2504.950] (-2505.308) * [-2509.146] (-2513.879) (-2506.446) (-2507.955) -- 0:00:59
      179000 -- (-2506.167) [-2504.308] (-2507.863) (-2506.416) * (-2506.866) (-2510.627) [-2506.626] (-2504.552) -- 0:00:59
      179500 -- [-2503.224] (-2506.771) (-2507.242) (-2506.369) * (-2507.666) (-2508.962) [-2506.518] (-2507.806) -- 0:00:59
      180000 -- (-2507.566) (-2505.036) (-2511.682) [-2506.543] * [-2508.125] (-2510.894) (-2506.718) (-2508.907) -- 0:00:59

      Average standard deviation of split frequencies: 0.020874

      180500 -- (-2506.064) (-2506.739) [-2510.958] (-2507.284) * (-2507.790) (-2510.303) (-2505.266) [-2503.841] -- 0:00:59
      181000 -- [-2504.875] (-2508.652) (-2512.147) (-2505.402) * [-2505.293] (-2508.586) (-2508.148) (-2506.211) -- 0:01:03
      181500 -- (-2503.642) (-2510.120) [-2507.252] (-2505.549) * (-2504.997) [-2506.018] (-2508.630) (-2508.344) -- 0:01:03
      182000 -- [-2506.345] (-2506.959) (-2506.330) (-2504.971) * [-2507.434] (-2504.685) (-2506.844) (-2505.733) -- 0:01:02
      182500 -- [-2503.663] (-2508.149) (-2506.639) (-2506.681) * (-2506.566) (-2504.526) [-2505.823] (-2507.358) -- 0:01:02
      183000 -- (-2503.539) (-2505.926) [-2506.019] (-2508.821) * (-2506.809) (-2504.066) (-2507.145) [-2503.172] -- 0:01:02
      183500 -- (-2504.955) (-2508.288) [-2509.250] (-2507.258) * (-2509.116) (-2505.762) [-2506.369] (-2504.670) -- 0:01:02
      184000 -- (-2506.245) (-2506.099) [-2503.959] (-2513.715) * (-2504.788) (-2504.628) (-2506.325) [-2505.329] -- 0:01:02
      184500 -- (-2505.953) (-2507.196) (-2503.662) [-2507.723] * [-2506.101] (-2506.699) (-2505.507) (-2504.963) -- 0:01:01
      185000 -- (-2507.365) (-2507.946) (-2505.108) [-2505.982] * (-2505.330) (-2507.456) (-2502.983) [-2504.439] -- 0:01:01

      Average standard deviation of split frequencies: 0.019672

      185500 -- (-2511.402) [-2505.859] (-2512.539) (-2504.917) * (-2508.955) (-2504.577) [-2506.449] (-2506.933) -- 0:01:01
      186000 -- (-2506.746) (-2506.599) [-2504.239] (-2504.448) * (-2509.753) (-2507.303) [-2505.703] (-2505.565) -- 0:01:01
      186500 -- (-2507.120) (-2504.517) (-2505.296) [-2505.750] * (-2506.377) [-2505.035] (-2505.587) (-2505.953) -- 0:01:01
      187000 -- (-2505.568) [-2506.975] (-2506.015) (-2504.012) * (-2511.396) (-2505.348) [-2505.393] (-2506.732) -- 0:01:00
      187500 -- (-2505.076) [-2505.783] (-2508.163) (-2504.400) * (-2511.006) [-2505.567] (-2505.644) (-2507.389) -- 0:01:00
      188000 -- (-2504.377) (-2508.857) [-2509.565] (-2504.246) * (-2507.870) (-2505.505) [-2505.410] (-2508.034) -- 0:01:00
      188500 -- [-2504.896] (-2508.412) (-2509.492) (-2504.858) * [-2505.675] (-2506.771) (-2506.510) (-2509.429) -- 0:01:00
      189000 -- [-2513.061] (-2507.629) (-2508.028) (-2506.750) * (-2507.385) [-2506.511] (-2506.608) (-2505.051) -- 0:01:00
      189500 -- (-2506.407) (-2509.430) [-2504.963] (-2504.157) * (-2507.379) (-2503.283) [-2507.144] (-2502.446) -- 0:00:59
      190000 -- (-2510.091) [-2504.533] (-2510.244) (-2505.612) * (-2505.469) [-2505.806] (-2505.351) (-2504.661) -- 0:00:59

      Average standard deviation of split frequencies: 0.021074

      190500 -- [-2504.577] (-2504.347) (-2509.733) (-2507.053) * [-2505.562] (-2505.497) (-2506.377) (-2504.669) -- 0:00:59
      191000 -- [-2505.003] (-2505.786) (-2509.320) (-2505.144) * (-2507.259) [-2505.604] (-2505.780) (-2504.044) -- 0:00:59
      191500 -- (-2504.146) (-2504.557) (-2512.651) [-2506.332] * (-2511.757) (-2510.329) [-2506.975] (-2505.304) -- 0:00:59
      192000 -- (-2503.447) [-2502.678] (-2509.642) (-2510.129) * (-2509.560) (-2509.018) (-2508.130) [-2504.390] -- 0:00:58
      192500 -- [-2508.772] (-2505.177) (-2508.107) (-2510.039) * (-2509.285) (-2507.156) (-2507.549) [-2503.827] -- 0:00:58
      193000 -- (-2505.197) [-2506.497] (-2509.015) (-2509.091) * [-2508.318] (-2505.602) (-2504.805) (-2505.402) -- 0:00:58
      193500 -- (-2510.135) [-2501.812] (-2507.837) (-2505.180) * (-2507.886) (-2507.392) (-2512.746) [-2504.732] -- 0:00:58
      194000 -- (-2506.998) [-2503.575] (-2508.870) (-2506.714) * (-2504.302) (-2506.093) (-2505.600) [-2502.531] -- 0:00:58
      194500 -- (-2506.623) [-2505.361] (-2508.152) (-2505.543) * (-2507.345) (-2506.170) (-2507.688) [-2502.253] -- 0:00:57
      195000 -- [-2504.090] (-2507.121) (-2507.887) (-2504.755) * (-2507.205) (-2506.745) [-2509.976] (-2502.195) -- 0:01:01

      Average standard deviation of split frequencies: 0.021303

      195500 -- (-2504.489) (-2504.708) (-2505.415) [-2504.747] * (-2508.246) (-2507.471) (-2507.562) [-2503.675] -- 0:01:01
      196000 -- [-2510.625] (-2503.715) (-2505.993) (-2502.952) * [-2505.524] (-2507.615) (-2508.809) (-2505.442) -- 0:01:01
      196500 -- (-2508.054) (-2505.173) (-2506.976) [-2504.198] * (-2505.613) [-2508.924] (-2505.259) (-2509.559) -- 0:01:01
      197000 -- (-2508.297) [-2505.414] (-2507.477) (-2509.396) * (-2506.613) (-2506.562) (-2506.701) [-2504.389] -- 0:01:01
      197500 -- (-2505.498) [-2507.585] (-2508.965) (-2504.670) * [-2507.999] (-2504.997) (-2508.406) (-2505.443) -- 0:01:00
      198000 -- (-2513.996) (-2507.069) (-2512.394) [-2505.345] * (-2506.575) [-2505.070] (-2507.237) (-2502.725) -- 0:01:00
      198500 -- [-2509.768] (-2506.203) (-2509.260) (-2510.386) * [-2504.059] (-2507.669) (-2504.141) (-2503.151) -- 0:01:00
      199000 -- (-2509.918) [-2506.448] (-2506.721) (-2505.447) * (-2507.106) (-2506.275) (-2509.765) [-2506.642] -- 0:01:00
      199500 -- (-2505.109) (-2506.093) (-2505.518) [-2509.228] * (-2509.692) (-2506.780) [-2510.073] (-2509.214) -- 0:01:00
      200000 -- (-2506.661) [-2508.047] (-2506.579) (-2503.631) * (-2509.960) (-2508.586) (-2505.756) [-2508.460] -- 0:00:59

      Average standard deviation of split frequencies: 0.021031

      200500 -- [-2506.708] (-2507.103) (-2505.858) (-2506.656) * [-2509.810] (-2507.006) (-2505.765) (-2506.100) -- 0:00:59
      201000 -- (-2508.173) (-2506.676) [-2505.435] (-2504.860) * [-2507.862] (-2506.792) (-2504.133) (-2503.279) -- 0:00:59
      201500 -- [-2505.250] (-2506.477) (-2506.917) (-2509.067) * (-2508.438) [-2506.623] (-2504.993) (-2505.318) -- 0:00:59
      202000 -- (-2505.241) (-2506.759) [-2504.415] (-2510.785) * (-2506.518) (-2507.895) [-2504.484] (-2510.875) -- 0:00:59
      202500 -- (-2505.619) [-2504.365] (-2509.082) (-2509.697) * [-2505.868] (-2507.012) (-2508.892) (-2510.943) -- 0:00:59
      203000 -- (-2505.611) [-2504.934] (-2508.549) (-2506.264) * (-2504.867) (-2506.149) [-2505.471] (-2514.520) -- 0:00:58
      203500 -- (-2504.719) (-2506.273) [-2508.095] (-2503.954) * [-2506.258] (-2505.476) (-2505.932) (-2509.596) -- 0:00:58
      204000 -- (-2505.272) (-2507.791) (-2507.104) [-2505.499] * (-2505.771) (-2507.249) (-2508.177) [-2508.900] -- 0:00:58
      204500 -- (-2507.471) [-2504.424] (-2507.602) (-2507.107) * [-2505.339] (-2505.923) (-2507.342) (-2509.485) -- 0:00:58
      205000 -- (-2506.217) [-2504.267] (-2509.304) (-2507.425) * (-2507.008) (-2505.715) (-2505.496) [-2505.949] -- 0:00:58

      Average standard deviation of split frequencies: 0.017579

      205500 -- (-2505.982) (-2506.066) (-2507.021) [-2506.936] * [-2506.109] (-2505.647) (-2506.625) (-2507.671) -- 0:00:57
      206000 -- (-2508.592) (-2504.826) (-2505.016) [-2507.099] * (-2505.973) (-2506.439) [-2506.241] (-2503.706) -- 0:00:57
      206500 -- (-2509.030) [-2504.212] (-2505.077) (-2507.534) * (-2505.423) (-2508.877) (-2505.045) [-2503.679] -- 0:00:57
      207000 -- (-2511.107) (-2505.135) (-2505.556) [-2503.804] * (-2506.761) (-2508.028) [-2506.534] (-2506.321) -- 0:00:57
      207500 -- (-2508.225) (-2503.747) [-2507.591] (-2504.406) * (-2506.898) (-2506.928) (-2508.156) [-2504.528] -- 0:00:57
      208000 -- (-2506.440) (-2504.723) (-2509.608) [-2505.128] * (-2506.886) [-2507.404] (-2508.365) (-2505.941) -- 0:00:57
      208500 -- [-2505.236] (-2504.177) (-2507.568) (-2506.025) * (-2505.951) (-2507.180) (-2509.342) [-2505.216] -- 0:00:56
      209000 -- (-2508.479) (-2504.065) [-2508.660] (-2509.044) * (-2507.906) (-2508.933) (-2507.074) [-2503.497] -- 0:01:00
      209500 -- (-2510.020) [-2505.070] (-2506.997) (-2504.554) * (-2508.227) (-2507.212) (-2505.660) [-2504.823] -- 0:01:00
      210000 -- (-2505.508) (-2504.559) [-2504.322] (-2509.728) * [-2507.985] (-2506.556) (-2508.029) (-2506.990) -- 0:01:00

      Average standard deviation of split frequencies: 0.019606

      210500 -- (-2505.282) (-2505.632) (-2504.350) [-2506.164] * (-2509.981) [-2506.048] (-2507.169) (-2508.593) -- 0:01:00
      211000 -- (-2505.920) (-2507.964) [-2505.242] (-2508.396) * [-2509.587] (-2507.335) (-2504.653) (-2504.862) -- 0:00:59
      211500 -- (-2504.484) [-2507.710] (-2505.357) (-2510.041) * [-2506.702] (-2505.500) (-2506.258) (-2507.997) -- 0:00:59
      212000 -- [-2508.083] (-2506.212) (-2506.267) (-2506.213) * [-2508.305] (-2505.865) (-2505.341) (-2504.634) -- 0:00:59
      212500 -- [-2510.394] (-2506.595) (-2511.169) (-2506.918) * (-2509.644) (-2505.247) [-2505.342] (-2507.184) -- 0:00:59
      213000 -- [-2507.932] (-2505.714) (-2509.300) (-2504.827) * (-2507.688) (-2506.031) (-2504.904) [-2504.479] -- 0:00:59
      213500 -- (-2506.524) (-2508.173) [-2507.725] (-2506.733) * (-2508.332) (-2506.445) [-2503.416] (-2506.441) -- 0:00:58
      214000 -- (-2507.086) (-2509.417) (-2506.105) [-2506.616] * [-2505.941] (-2505.736) (-2502.945) (-2506.982) -- 0:00:58
      214500 -- [-2505.130] (-2506.674) (-2505.151) (-2510.440) * [-2505.863] (-2506.837) (-2504.027) (-2504.696) -- 0:00:58
      215000 -- (-2505.548) (-2504.222) [-2506.324] (-2507.589) * [-2506.813] (-2507.207) (-2503.108) (-2506.742) -- 0:00:58

      Average standard deviation of split frequencies: 0.019122

      215500 -- (-2506.123) (-2503.107) (-2510.679) [-2504.788] * (-2505.209) (-2505.484) (-2504.257) [-2505.984] -- 0:00:58
      216000 -- (-2505.090) (-2505.113) (-2506.253) [-2504.557] * (-2505.387) [-2505.907] (-2502.991) (-2505.605) -- 0:00:58
      216500 -- (-2511.182) (-2505.156) (-2506.203) [-2506.092] * (-2505.667) (-2508.335) [-2505.027] (-2507.108) -- 0:00:57
      217000 -- (-2508.255) (-2506.423) [-2505.016] (-2505.303) * (-2507.528) (-2504.407) (-2507.395) [-2505.713] -- 0:00:57
      217500 -- (-2506.787) [-2506.414] (-2507.466) (-2507.372) * (-2507.371) (-2506.150) (-2507.311) [-2504.129] -- 0:00:57
      218000 -- [-2504.561] (-2503.882) (-2508.159) (-2509.586) * (-2510.743) (-2508.569) [-2505.336] (-2505.866) -- 0:00:57
      218500 -- [-2504.658] (-2506.447) (-2506.633) (-2507.101) * (-2506.562) (-2504.941) [-2507.356] (-2510.998) -- 0:00:57
      219000 -- (-2505.204) [-2507.875] (-2507.932) (-2504.397) * (-2505.360) (-2508.428) [-2509.512] (-2504.362) -- 0:00:57
      219500 -- [-2504.418] (-2511.774) (-2505.562) (-2506.316) * [-2506.332] (-2504.846) (-2504.893) (-2509.938) -- 0:00:56
      220000 -- (-2509.367) (-2509.768) [-2504.068] (-2508.098) * (-2506.844) (-2509.467) [-2505.556] (-2511.598) -- 0:00:56

      Average standard deviation of split frequencies: 0.017411

      220500 -- [-2506.393] (-2509.303) (-2505.360) (-2510.879) * (-2505.815) (-2511.870) [-2509.245] (-2506.654) -- 0:00:56
      221000 -- (-2506.583) (-2507.857) (-2505.863) [-2504.415] * (-2505.590) (-2508.716) (-2508.757) [-2507.346] -- 0:00:56
      221500 -- (-2505.405) [-2505.775] (-2503.637) (-2507.405) * (-2506.177) (-2509.505) [-2505.603] (-2509.322) -- 0:00:56
      222000 -- [-2505.216] (-2508.658) (-2505.071) (-2506.513) * (-2505.481) [-2508.121] (-2505.932) (-2506.942) -- 0:00:56
      222500 -- [-2507.395] (-2506.744) (-2508.060) (-2505.723) * (-2505.711) [-2505.584] (-2505.696) (-2505.489) -- 0:00:59
      223000 -- (-2505.657) [-2507.285] (-2507.073) (-2503.995) * (-2506.108) (-2508.094) [-2509.355] (-2506.585) -- 0:00:59
      223500 -- (-2505.570) [-2505.332] (-2506.635) (-2507.362) * (-2506.214) (-2506.306) (-2508.074) [-2504.236] -- 0:00:59
      224000 -- (-2505.570) (-2505.794) [-2505.410] (-2506.433) * (-2506.531) (-2506.873) [-2506.650] (-2508.507) -- 0:00:58
      224500 -- (-2508.455) (-2506.184) [-2504.818] (-2507.854) * (-2512.436) [-2506.342] (-2507.365) (-2508.577) -- 0:00:58
      225000 -- (-2508.230) [-2507.479] (-2503.911) (-2506.396) * (-2507.664) (-2505.579) [-2507.726] (-2506.981) -- 0:00:58

      Average standard deviation of split frequencies: 0.016091

      225500 -- (-2505.496) (-2508.920) (-2507.355) [-2506.795] * (-2505.270) [-2505.109] (-2507.157) (-2509.430) -- 0:00:58
      226000 -- (-2506.073) (-2507.494) [-2507.647] (-2507.289) * [-2506.513] (-2507.428) (-2513.088) (-2507.264) -- 0:00:58
      226500 -- [-2506.410] (-2507.624) (-2506.202) (-2510.301) * (-2506.745) (-2506.941) (-2506.797) [-2505.769] -- 0:00:58
      227000 -- (-2505.767) (-2508.889) [-2504.751] (-2508.058) * (-2504.223) (-2509.475) [-2504.604] (-2505.769) -- 0:00:57
      227500 -- (-2505.762) (-2507.228) (-2506.322) [-2504.305] * (-2506.115) (-2505.473) [-2503.718] (-2507.139) -- 0:00:57
      228000 -- [-2508.153] (-2506.090) (-2506.314) (-2504.584) * (-2506.250) (-2504.877) (-2506.126) [-2505.642] -- 0:00:57
      228500 -- (-2505.667) (-2505.304) (-2504.745) [-2504.604] * [-2505.852] (-2504.677) (-2506.359) (-2504.643) -- 0:00:57
      229000 -- (-2506.818) [-2507.178] (-2506.159) (-2507.291) * [-2507.924] (-2507.749) (-2506.622) (-2505.775) -- 0:00:57
      229500 -- (-2506.408) (-2507.089) (-2507.180) [-2506.689] * (-2506.562) (-2507.454) [-2504.948] (-2507.685) -- 0:00:57
      230000 -- [-2506.742] (-2505.170) (-2509.269) (-2506.229) * (-2504.938) (-2507.325) [-2507.416] (-2510.471) -- 0:00:56

      Average standard deviation of split frequencies: 0.017031

      230500 -- (-2508.752) (-2505.993) [-2508.466] (-2508.191) * (-2505.051) (-2508.992) (-2509.453) [-2507.957] -- 0:00:56
      231000 -- (-2507.853) (-2507.438) [-2506.805] (-2505.925) * [-2506.118] (-2505.292) (-2509.240) (-2507.007) -- 0:00:56
      231500 -- (-2510.972) (-2506.140) [-2505.704] (-2506.650) * (-2506.343) (-2505.131) (-2507.054) [-2508.514] -- 0:00:56
      232000 -- (-2510.866) (-2505.923) (-2505.057) [-2509.172] * (-2508.283) (-2505.412) (-2507.245) [-2505.208] -- 0:00:56
      232500 -- (-2512.388) [-2508.200] (-2512.161) (-2508.934) * (-2505.472) [-2508.313] (-2507.668) (-2505.891) -- 0:00:56
      233000 -- (-2509.446) (-2504.926) [-2509.895] (-2507.939) * (-2509.776) (-2510.183) (-2508.119) [-2507.235] -- 0:00:55
      233500 -- [-2509.640] (-2509.482) (-2509.162) (-2508.558) * (-2507.375) [-2506.883] (-2506.145) (-2505.307) -- 0:00:55
      234000 -- (-2506.578) (-2509.581) [-2507.755] (-2511.687) * (-2507.605) (-2508.574) [-2505.117] (-2504.582) -- 0:00:55
      234500 -- [-2506.102] (-2512.723) (-2505.864) (-2508.489) * (-2508.899) [