--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:26:33 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0398/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1432.34 -1435.68
2 -1432.25 -1436.48
--------------------------------------
TOTAL -1432.30 -1436.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.866284 0.082499 0.331085 1.392859 0.831805 1329.69 1415.34 1.000
r(A<->C){all} 0.169713 0.020417 0.000006 0.451153 0.133948 178.86 193.83 1.000
r(A<->G){all} 0.215419 0.023126 0.000260 0.505806 0.189643 210.53 234.88 1.000
r(A<->T){all} 0.155445 0.018446 0.000052 0.433194 0.118116 199.77 266.41 1.000
r(C<->G){all} 0.145500 0.017366 0.000060 0.410735 0.105665 248.40 256.36 1.005
r(C<->T){all} 0.175147 0.020795 0.000009 0.464982 0.140131 158.39 225.83 1.004
r(G<->T){all} 0.138775 0.016036 0.000010 0.399652 0.102279 204.85 248.89 1.001
pi(A){all} 0.250288 0.000184 0.222434 0.275191 0.250191 1250.61 1263.93 1.000
pi(C){all} 0.303718 0.000188 0.278920 0.332112 0.303609 1285.34 1321.88 1.000
pi(G){all} 0.264745 0.000182 0.238900 0.291129 0.264827 1254.01 1284.95 1.000
pi(T){all} 0.181250 0.000135 0.158379 0.202837 0.180979 1129.64 1138.07 1.000
alpha{1,2} 0.290048 0.125408 0.000350 0.973406 0.181075 1037.08 1134.51 1.000
alpha{3} 0.418907 0.249517 0.000128 1.404647 0.230185 1124.67 1197.17 1.000
pinvar{all} 0.996727 0.000007 0.991820 0.999876 0.997402 1261.70 1312.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1374.931759
Model 2: PositiveSelection -1374.614367
Model 0: one-ratio -1374.614236
Model 7: beta -1374.931758
Model 8: beta&w>1 -1374.614367
Model 0 vs 1 0.6350460000003295
Model 2 vs 1 0.6347840000003089
Model 8 vs 7 0.6347820000000866
>C1
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C2
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C3
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C4
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C5
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C6
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGSMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=345
C1 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C2 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C3 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C4 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C5 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C6 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
**************************************************
C1 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C2 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C3 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C4 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C5 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C6 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
**************************************************
C1 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C2 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C3 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C4 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C5 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C6 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
**************************************************
C1 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C2 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C3 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C4 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C5 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C6 GSGIAEALMAGGGSKFLALGSMPGNSVAQGRKAGLESALTAVGHRLVQFQ
********************.*****************************
C1 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C2 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C3 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C4 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C5 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C6 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
**************************************************
C1 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C2 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C3 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C4 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C5 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C6 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
**************************************************
C1 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C2 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C3 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C4 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C5 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C6 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
*********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 345 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 345 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10350]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [10350]--->[10350]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.519 Mb, Max= 30.915 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C2 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C3 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C4 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C5 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
C6 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
**************************************************
C1 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C2 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C3 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C4 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C5 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
C6 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
**************************************************
C1 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C2 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C3 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C4 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C5 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
C6 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
**************************************************
C1 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C2 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C3 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C4 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C5 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
C6 GSGIAEALMAGGGSKFLALGSMPGNSVAQGRKAGLESALTAVGHRLVQFQ
********************.*****************************
C1 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C2 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C3 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C4 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C5 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
C6 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
**************************************************
C1 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C2 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C3 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C4 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C5 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
C6 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
**************************************************
C1 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C2 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C3 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C4 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C5 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
C6 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
*********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.71 C1 C6 99.71
TOP 5 0 99.71 C6 C1 99.71
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.71 C2 C6 99.71
TOP 5 1 99.71 C6 C2 99.71
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.71 C3 C6 99.71
TOP 5 2 99.71 C6 C3 99.71
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.71 C4 C6 99.71
TOP 5 3 99.71 C6 C4 99.71
BOT 4 5 99.71 C5 C6 99.71
TOP 5 4 99.71 C6 C5 99.71
AVG 0 C1 * 99.94
AVG 1 C2 * 99.94
AVG 2 C3 * 99.94
AVG 3 C4 * 99.94
AVG 4 C5 * 99.94
AVG 5 C6 * 99.71
TOT TOT * 99.90
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
C2 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
C3 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
C4 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
C5 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
C6 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
**************************************************
C1 CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
C2 CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
C3 CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
C4 CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
C5 CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
C6 CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
**************************************************
C1 ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
C2 ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
C3 ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
C4 ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
C5 ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
C6 ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
**************************************************
C1 TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
C2 TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
C3 TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
C4 TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
C5 TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
C6 TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
**************************************************
C1 CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
C2 CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
C3 CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
C4 CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
C5 CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
C6 CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
**************************************************
C1 ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
C2 ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
C3 ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
C4 ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
C5 ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
C6 ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
**************************************************
C1 CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
C2 CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
C3 CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
C4 CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
C5 CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
C6 CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
**************************************************
C1 CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
C2 CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
C3 CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
C4 CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
C5 CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
C6 CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
**************************************************
C1 ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
C2 ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
C3 ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
C4 ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
C5 ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
C6 ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
**************************************************
C1 GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
C2 GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
C3 GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
C4 GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
C5 GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
C6 GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
**************************************************
C1 TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
C2 TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
C3 TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
C4 TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
C5 TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
C6 TGCCCTCGGTAGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
**********.***************************************
C1 GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
C2 GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
C3 GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
C4 GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
C5 GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
C6 GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
**************************************************
C1 TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
C2 TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
C3 TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
C4 TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
C5 TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
C6 TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
**************************************************
C1 GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
C2 GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
C3 GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
C4 GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
C5 GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
C6 GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
**************************************************
C1 AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
C2 AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
C3 AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
C4 AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
C5 AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
C6 AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
**************************************************
C1 GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
C2 GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
C3 GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
C4 GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
C5 GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
C6 GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
**************************************************
C1 CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
C2 CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
C3 CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
C4 CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
C5 CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
C6 CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
**************************************************
C1 GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
C2 GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
C3 GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
C4 GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
C5 GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
C6 GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
**************************************************
C1 GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
C2 GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
C3 GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
C4 GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
C5 GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
C6 GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
**************************************************
C1 CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
C2 CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
C3 CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
C4 CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
C5 CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
C6 CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
**************************************************
C1 CCACAACCCCGTTCGATATGACGATCACCTTGAAC
C2 CCACAACCCCGTTCGATATGACGATCACCTTGAAC
C3 CCACAACCCCGTTCGATATGACGATCACCTTGAAC
C4 CCACAACCCCGTTCGATATGACGATCACCTTGAAC
C5 CCACAACCCCGTTCGATATGACGATCACCTTGAAC
C6 CCACAACCCCGTTCGATATGACGATCACCTTGAAC
***********************************
>C1
ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
CCACAACCCCGTTCGATATGACGATCACCTTGAAC
>C2
ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
CCACAACCCCGTTCGATATGACGATCACCTTGAAC
>C3
ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
CCACAACCCCGTTCGATATGACGATCACCTTGAAC
>C4
ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
CCACAACCCCGTTCGATATGACGATCACCTTGAAC
>C5
ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
CCACAACCCCGTTCGATATGACGATCACCTTGAAC
>C6
ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT
CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC
ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC
TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT
CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG
ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC
CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA
CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA
ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC
GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT
TGCCCTCGGTAGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG
GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG
TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT
GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA
AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG
GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT
CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG
GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT
GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC
CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT
CCACAACCCCGTTCGATATGACGATCACCTTGAAC
>C1
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C2
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C3
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C4
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C5
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
>C6
MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
GSGIAEALMAGGGSKFLALGSMPGNSVAQGRKAGLESALTAVGHRLVQFQ
YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1035 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800304
Setting output file names to "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 480409249
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1678619041
Seed = 1804615589
Swapseed = 1579800304
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2319.780940 -- -24.965149
Chain 2 -- -2319.782070 -- -24.965149
Chain 3 -- -2319.780940 -- -24.965149
Chain 4 -- -2319.782358 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2319.782358 -- -24.965149
Chain 2 -- -2319.782070 -- -24.965149
Chain 3 -- -2319.782358 -- -24.965149
Chain 4 -- -2319.782490 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2319.781] (-2319.782) (-2319.781) (-2319.782) * [-2319.782] (-2319.782) (-2319.782) (-2319.782)
500 -- [-1444.871] (-1444.967) (-1446.241) (-1436.051) * [-1434.503] (-1444.681) (-1445.882) (-1444.813) -- 0:00:00
1000 -- (-1447.943) [-1439.231] (-1440.406) (-1431.370) * (-1438.001) [-1445.858] (-1432.195) (-1440.487) -- 0:00:00
1500 -- (-1444.391) (-1439.069) (-1437.216) [-1434.047] * (-1454.182) (-1442.212) [-1435.098] (-1437.626) -- 0:00:00
2000 -- (-1437.549) (-1441.101) (-1434.298) [-1440.998] * (-1431.152) (-1431.569) [-1435.519] (-1444.670) -- 0:00:00
2500 -- (-1434.856) [-1435.328] (-1436.583) (-1432.221) * (-1437.851) (-1436.499) [-1434.939] (-1436.531) -- 0:00:00
3000 -- (-1437.902) [-1438.611] (-1440.141) (-1433.290) * [-1440.872] (-1436.766) (-1439.339) (-1444.774) -- 0:00:00
3500 -- (-1442.179) [-1434.308] (-1440.411) (-1435.915) * (-1443.058) [-1437.574] (-1451.196) (-1436.792) -- 0:00:00
4000 -- (-1439.352) (-1435.383) [-1438.303] (-1437.850) * [-1439.334] (-1441.264) (-1441.623) (-1436.901) -- 0:00:00
4500 -- (-1436.141) (-1437.211) (-1435.234) [-1443.332] * (-1441.868) [-1435.918] (-1443.409) (-1434.691) -- 0:00:00
5000 -- (-1441.209) (-1437.744) (-1440.421) [-1435.034] * (-1438.323) [-1434.590] (-1435.199) (-1434.267) -- 0:00:00
Average standard deviation of split frequencies: 0.070711
5500 -- (-1442.155) (-1440.792) [-1435.844] (-1446.277) * (-1440.642) [-1437.184] (-1436.682) (-1436.477) -- 0:03:00
6000 -- [-1437.794] (-1434.172) (-1435.712) (-1443.865) * (-1444.693) [-1439.221] (-1439.223) (-1438.976) -- 0:02:45
6500 -- (-1442.575) (-1444.521) [-1439.976] (-1437.874) * [-1433.731] (-1442.480) (-1435.204) (-1437.779) -- 0:02:32
7000 -- (-1442.415) (-1437.416) [-1432.173] (-1437.519) * (-1435.855) (-1443.458) [-1438.668] (-1440.701) -- 0:02:21
7500 -- (-1443.425) [-1437.792] (-1442.550) (-1440.817) * (-1434.072) (-1437.583) (-1436.638) [-1440.641] -- 0:02:12
8000 -- (-1446.589) (-1437.470) (-1448.290) [-1438.983] * (-1438.294) (-1441.900) [-1438.928] (-1435.993) -- 0:02:04
8500 -- (-1431.534) (-1444.837) [-1450.106] (-1438.648) * (-1437.014) [-1436.832] (-1439.122) (-1443.524) -- 0:01:56
9000 -- (-1444.327) (-1437.808) [-1439.309] (-1431.506) * (-1440.033) [-1434.497] (-1440.900) (-1440.801) -- 0:01:50
9500 -- [-1434.911] (-1436.550) (-1434.549) (-1440.916) * (-1437.428) [-1440.508] (-1437.955) (-1440.694) -- 0:01:44
10000 -- (-1438.776) [-1432.490] (-1435.061) (-1438.399) * (-1447.374) (-1442.017) [-1438.493] (-1442.321) -- 0:01:39
Average standard deviation of split frequencies: 0.065239
10500 -- [-1438.140] (-1442.482) (-1439.842) (-1439.250) * (-1432.027) (-1432.936) [-1436.093] (-1443.125) -- 0:01:34
11000 -- (-1441.852) [-1438.303] (-1438.427) (-1445.366) * (-1437.288) [-1438.040] (-1444.275) (-1436.814) -- 0:01:29
11500 -- (-1434.972) [-1439.549] (-1437.965) (-1435.448) * (-1438.610) (-1439.719) [-1436.459] (-1437.316) -- 0:01:25
12000 -- [-1434.233] (-1432.206) (-1441.357) (-1436.729) * (-1437.562) [-1435.598] (-1445.388) (-1445.528) -- 0:01:22
12500 -- (-1434.100) (-1433.667) [-1439.244] (-1433.123) * [-1433.563] (-1445.162) (-1441.496) (-1436.449) -- 0:01:19
13000 -- [-1437.143] (-1446.967) (-1441.332) (-1434.244) * (-1435.451) (-1441.245) [-1435.452] (-1442.146) -- 0:01:15
13500 -- (-1438.372) [-1439.741] (-1439.463) (-1437.915) * (-1437.132) (-1435.176) (-1440.311) [-1433.795] -- 0:01:13
14000 -- [-1438.356] (-1442.709) (-1438.457) (-1435.120) * (-1435.289) (-1443.268) [-1435.677] (-1435.950) -- 0:01:10
14500 -- [-1436.343] (-1436.137) (-1436.311) (-1432.740) * (-1443.842) (-1435.665) (-1440.673) [-1434.978] -- 0:01:07
15000 -- (-1437.414) [-1435.156] (-1442.894) (-1435.322) * (-1436.734) (-1440.381) (-1436.563) [-1439.694] -- 0:01:05
Average standard deviation of split frequencies: 0.075294
15500 -- (-1438.196) (-1440.750) [-1432.969] (-1434.117) * (-1436.993) [-1437.666] (-1448.328) (-1436.138) -- 0:01:03
16000 -- [-1441.142] (-1431.827) (-1440.233) (-1433.399) * (-1440.040) (-1444.714) (-1435.972) [-1438.308] -- 0:01:01
16500 -- [-1444.671] (-1441.453) (-1436.441) (-1434.531) * (-1438.903) (-1434.407) [-1442.026] (-1442.008) -- 0:00:59
17000 -- (-1434.828) (-1437.822) (-1435.657) [-1433.735] * [-1437.683] (-1448.676) (-1435.268) (-1436.096) -- 0:00:57
17500 -- (-1431.958) [-1435.308] (-1443.353) (-1433.047) * (-1436.024) [-1436.121] (-1440.156) (-1451.993) -- 0:00:56
18000 -- (-1431.172) [-1438.221] (-1440.090) (-1434.276) * (-1438.633) [-1439.570] (-1444.515) (-1439.851) -- 0:00:54
18500 -- (-1431.530) [-1430.343] (-1443.405) (-1438.545) * (-1438.893) [-1433.531] (-1439.354) (-1434.315) -- 0:00:53
19000 -- (-1434.760) [-1445.694] (-1439.191) (-1434.363) * (-1441.128) [-1435.873] (-1437.262) (-1431.942) -- 0:00:51
19500 -- (-1436.040) [-1434.085] (-1436.784) (-1433.914) * [-1436.044] (-1442.365) (-1440.059) (-1438.352) -- 0:00:50
20000 -- (-1437.845) (-1436.357) (-1432.780) [-1434.185] * (-1439.148) [-1435.021] (-1444.242) (-1432.544) -- 0:01:38
Average standard deviation of split frequencies: 0.046887
20500 -- (-1436.406) [-1437.201] (-1434.356) (-1432.557) * (-1441.651) (-1438.186) [-1437.559] (-1431.829) -- 0:01:35
21000 -- (-1433.542) (-1440.065) [-1440.380] (-1433.784) * [-1434.209] (-1438.491) (-1432.651) (-1430.153) -- 0:01:33
21500 -- (-1436.292) (-1441.212) [-1442.731] (-1432.753) * [-1436.203] (-1441.033) (-1436.305) (-1432.161) -- 0:01:31
22000 -- (-1433.999) (-1430.505) [-1442.958] (-1432.165) * (-1442.782) (-1439.968) [-1434.327] (-1433.228) -- 0:01:28
22500 -- (-1435.998) (-1433.871) (-1442.524) [-1432.941] * (-1438.850) [-1433.780] (-1434.045) (-1433.197) -- 0:01:26
23000 -- (-1433.756) [-1438.138] (-1438.534) (-1433.646) * (-1434.886) (-1440.366) (-1432.509) [-1430.827] -- 0:01:24
23500 -- [-1434.527] (-1439.277) (-1445.948) (-1433.566) * [-1434.914] (-1435.380) (-1433.162) (-1435.220) -- 0:01:23
24000 -- (-1435.053) (-1437.756) [-1440.632] (-1435.160) * [-1433.778] (-1434.481) (-1430.287) (-1434.949) -- 0:01:21
24500 -- (-1433.980) (-1433.246) [-1437.188] (-1433.040) * (-1436.235) (-1434.517) (-1432.502) [-1431.864] -- 0:01:19
25000 -- (-1434.090) [-1441.634] (-1440.689) (-1434.107) * [-1436.104] (-1433.095) (-1434.498) (-1434.119) -- 0:01:18
Average standard deviation of split frequencies: 0.044896
25500 -- (-1434.960) [-1434.283] (-1446.025) (-1431.460) * (-1436.890) (-1439.537) [-1434.818] (-1436.910) -- 0:01:16
26000 -- (-1435.971) (-1437.128) (-1442.955) [-1432.602] * (-1437.414) (-1438.213) (-1436.546) [-1430.712] -- 0:01:14
26500 -- (-1434.075) [-1435.387] (-1442.151) (-1434.268) * (-1435.159) [-1438.254] (-1436.237) (-1434.031) -- 0:01:13
27000 -- (-1434.365) (-1436.046) (-1438.495) [-1431.033] * (-1432.096) [-1437.287] (-1436.485) (-1432.769) -- 0:01:12
27500 -- [-1433.547] (-1447.774) (-1442.850) (-1431.187) * (-1434.476) [-1443.200] (-1433.793) (-1434.781) -- 0:01:10
28000 -- (-1436.239) (-1433.966) (-1441.635) [-1433.129] * (-1436.160) [-1440.704] (-1432.371) (-1432.979) -- 0:01:09
28500 -- (-1436.285) (-1440.835) (-1440.186) [-1433.161] * (-1433.640) (-1446.843) (-1431.684) [-1437.450] -- 0:01:08
29000 -- (-1437.365) (-1439.699) (-1440.479) [-1433.218] * [-1431.396] (-1434.442) (-1435.548) (-1436.881) -- 0:01:06
29500 -- (-1434.853) [-1436.565] (-1440.433) (-1433.956) * (-1434.611) [-1434.459] (-1432.531) (-1437.879) -- 0:01:05
30000 -- (-1435.524) [-1432.532] (-1444.799) (-1433.353) * [-1433.887] (-1437.637) (-1433.559) (-1438.218) -- 0:01:04
Average standard deviation of split frequencies: 0.049532
30500 -- (-1436.861) [-1438.798] (-1438.309) (-1431.884) * [-1435.240] (-1440.167) (-1432.369) (-1433.635) -- 0:01:03
31000 -- (-1441.069) [-1442.438] (-1436.843) (-1431.401) * (-1436.881) (-1436.083) [-1432.218] (-1432.251) -- 0:01:02
31500 -- (-1435.494) [-1439.689] (-1435.373) (-1432.337) * (-1435.097) [-1435.287] (-1432.038) (-1434.480) -- 0:01:01
32000 -- [-1436.047] (-1431.799) (-1439.521) (-1433.448) * (-1436.778) (-1433.869) [-1431.478] (-1434.940) -- 0:01:00
32500 -- [-1434.113] (-1438.596) (-1443.807) (-1432.346) * (-1434.435) (-1435.547) (-1431.889) [-1431.848] -- 0:00:59
33000 -- (-1434.401) [-1431.324] (-1437.052) (-1441.398) * [-1433.001] (-1432.163) (-1433.556) (-1431.983) -- 0:00:58
33500 -- (-1434.499) (-1444.312) (-1437.156) [-1435.530] * (-1435.248) [-1438.805] (-1433.321) (-1432.984) -- 0:00:57
34000 -- (-1434.664) (-1438.164) (-1435.461) [-1434.372] * [-1433.134] (-1439.265) (-1432.506) (-1436.155) -- 0:00:56
34500 -- (-1436.063) (-1433.900) [-1439.639] (-1435.028) * (-1435.494) (-1434.945) (-1432.322) [-1437.005] -- 0:00:55
35000 -- (-1431.845) (-1439.744) (-1436.367) [-1433.530] * (-1434.598) (-1441.044) (-1433.209) [-1434.702] -- 0:01:22
Average standard deviation of split frequencies: 0.042194
35500 -- (-1436.804) (-1445.181) (-1440.139) [-1433.354] * [-1432.822] (-1438.659) (-1431.399) (-1434.930) -- 0:01:21
36000 -- (-1434.365) [-1436.274] (-1437.604) (-1433.257) * (-1437.729) [-1433.609] (-1433.390) (-1435.538) -- 0:01:20
36500 -- (-1430.960) (-1441.816) (-1433.575) [-1433.295] * (-1436.083) (-1440.595) [-1434.614] (-1434.831) -- 0:01:19
37000 -- (-1433.913) (-1445.100) [-1439.742] (-1435.220) * (-1433.491) [-1439.825] (-1431.976) (-1432.794) -- 0:01:18
37500 -- (-1439.006) (-1438.875) [-1433.098] (-1434.620) * (-1433.432) (-1433.301) [-1432.377] (-1432.333) -- 0:01:17
38000 -- (-1447.942) [-1435.494] (-1433.682) (-1434.587) * (-1435.270) [-1434.850] (-1432.009) (-1433.331) -- 0:01:15
38500 -- (-1435.767) (-1442.566) [-1439.142] (-1433.911) * (-1436.010) [-1440.040] (-1433.705) (-1434.632) -- 0:01:14
39000 -- (-1432.742) [-1437.359] (-1439.554) (-1433.729) * [-1434.313] (-1441.356) (-1435.296) (-1430.440) -- 0:01:13
39500 -- (-1432.615) (-1437.881) (-1436.530) [-1431.262] * (-1434.442) [-1441.332] (-1431.992) (-1432.336) -- 0:01:12
40000 -- (-1433.390) (-1433.559) [-1435.370] (-1433.306) * (-1434.737) [-1435.584] (-1432.666) (-1433.777) -- 0:01:12
Average standard deviation of split frequencies: 0.038640
40500 -- (-1433.230) (-1435.145) (-1434.594) [-1433.359] * (-1431.368) [-1433.846] (-1435.372) (-1436.157) -- 0:01:11
41000 -- (-1433.514) [-1437.634] (-1438.381) (-1433.612) * (-1434.083) [-1434.009] (-1434.948) (-1434.547) -- 0:01:10
41500 -- (-1438.875) [-1441.576] (-1436.909) (-1432.351) * (-1438.081) (-1437.184) [-1434.069] (-1435.703) -- 0:01:09
42000 -- (-1434.694) (-1437.376) [-1437.427] (-1436.113) * (-1436.145) [-1436.601] (-1438.455) (-1435.795) -- 0:01:08
42500 -- (-1432.354) (-1441.293) (-1438.141) [-1435.075] * [-1432.734] (-1440.645) (-1433.339) (-1432.511) -- 0:01:07
43000 -- (-1431.905) (-1442.291) [-1439.736] (-1434.417) * [-1432.786] (-1440.158) (-1431.119) (-1437.377) -- 0:01:06
43500 -- (-1437.166) (-1441.000) (-1440.082) [-1434.447] * (-1435.042) (-1437.116) (-1434.665) [-1434.114] -- 0:01:05
44000 -- (-1433.191) (-1434.632) [-1434.818] (-1434.734) * (-1432.219) (-1447.778) [-1438.967] (-1433.283) -- 0:01:05
44500 -- (-1433.673) (-1440.443) [-1431.796] (-1433.831) * (-1432.977) [-1445.523] (-1433.661) (-1431.516) -- 0:01:04
45000 -- (-1432.332) (-1440.654) [-1438.094] (-1433.819) * (-1438.152) [-1434.392] (-1434.134) (-1430.989) -- 0:01:03
Average standard deviation of split frequencies: 0.034843
45500 -- (-1435.527) (-1438.574) [-1440.071] (-1434.722) * [-1430.830] (-1431.804) (-1433.803) (-1431.933) -- 0:01:02
46000 -- [-1436.301] (-1443.961) (-1445.935) (-1433.538) * (-1432.704) (-1432.461) [-1433.979] (-1432.892) -- 0:01:02
46500 -- (-1434.217) (-1434.176) [-1433.467] (-1433.013) * (-1434.334) [-1430.030] (-1434.082) (-1439.126) -- 0:01:01
47000 -- (-1432.927) (-1440.601) [-1437.874] (-1435.040) * (-1433.763) (-1433.324) (-1433.023) [-1432.418] -- 0:01:00
47500 -- [-1433.123] (-1437.653) (-1434.689) (-1435.812) * [-1432.963] (-1437.026) (-1433.457) (-1435.459) -- 0:01:00
48000 -- (-1434.990) (-1443.600) [-1435.226] (-1432.238) * (-1434.625) (-1435.382) (-1431.780) [-1432.062] -- 0:00:59
48500 -- [-1432.777] (-1437.533) (-1445.172) (-1433.399) * [-1432.858] (-1432.434) (-1432.266) (-1431.934) -- 0:00:58
49000 -- [-1433.774] (-1442.404) (-1447.921) (-1433.382) * (-1436.534) [-1430.591] (-1434.138) (-1432.021) -- 0:00:58
49500 -- (-1433.260) [-1439.254] (-1435.492) (-1434.336) * (-1438.398) [-1433.055] (-1434.571) (-1433.373) -- 0:01:16
50000 -- [-1434.366] (-1436.152) (-1432.934) (-1436.277) * [-1433.324] (-1430.937) (-1433.107) (-1432.642) -- 0:01:16
Average standard deviation of split frequencies: 0.033495
50500 -- (-1433.774) (-1439.285) [-1431.612] (-1439.016) * (-1435.323) (-1431.361) [-1433.833] (-1432.397) -- 0:01:15
51000 -- [-1434.066] (-1438.665) (-1431.358) (-1436.728) * (-1433.803) (-1435.666) (-1435.314) [-1433.534] -- 0:01:14
51500 -- (-1433.043) (-1442.622) [-1433.736] (-1437.856) * [-1433.952] (-1433.933) (-1432.120) (-1433.006) -- 0:01:13
52000 -- [-1432.394] (-1436.157) (-1433.100) (-1433.931) * (-1431.645) [-1433.824] (-1432.269) (-1431.774) -- 0:01:12
52500 -- (-1433.374) [-1436.915] (-1433.266) (-1435.689) * (-1434.358) [-1431.987] (-1435.683) (-1433.768) -- 0:01:12
53000 -- (-1432.747) [-1433.939] (-1432.626) (-1435.196) * (-1434.342) (-1432.465) [-1434.137] (-1434.672) -- 0:01:11
53500 -- (-1432.907) (-1437.410) [-1432.992] (-1433.761) * (-1434.398) (-1431.604) [-1432.948] (-1433.445) -- 0:01:10
54000 -- (-1436.753) [-1436.499] (-1431.827) (-1433.491) * (-1435.857) (-1433.602) [-1431.165] (-1433.064) -- 0:01:10
54500 -- (-1434.579) (-1445.111) (-1439.232) [-1437.927] * (-1434.035) (-1434.602) [-1431.870] (-1434.557) -- 0:01:09
55000 -- [-1433.146] (-1440.203) (-1439.826) (-1435.468) * [-1437.234] (-1432.915) (-1430.914) (-1432.550) -- 0:01:08
Average standard deviation of split frequencies: 0.031567
55500 -- (-1436.097) (-1438.794) (-1432.749) [-1434.291] * (-1433.538) [-1434.088] (-1435.403) (-1439.640) -- 0:01:08
56000 -- (-1433.943) [-1437.680] (-1433.463) (-1433.792) * (-1435.669) [-1437.483] (-1432.246) (-1433.335) -- 0:01:07
56500 -- (-1434.017) [-1436.770] (-1438.630) (-1435.194) * (-1436.752) [-1431.983] (-1432.462) (-1434.135) -- 0:01:06
57000 -- (-1434.203) [-1436.844] (-1437.888) (-1432.792) * (-1441.762) (-1434.745) [-1436.048] (-1435.511) -- 0:01:06
57500 -- (-1436.356) [-1438.066] (-1435.397) (-1432.948) * (-1438.338) (-1433.974) (-1432.212) [-1433.224] -- 0:01:05
58000 -- [-1434.850] (-1433.161) (-1436.204) (-1432.561) * [-1433.620] (-1434.354) (-1433.172) (-1434.931) -- 0:01:04
58500 -- [-1433.907] (-1437.950) (-1434.434) (-1432.451) * (-1435.450) (-1434.683) (-1433.661) [-1432.973] -- 0:01:04
59000 -- (-1431.977) (-1436.232) (-1435.963) [-1434.597] * [-1431.533] (-1433.441) (-1434.929) (-1433.542) -- 0:01:03
59500 -- [-1432.704] (-1440.850) (-1432.598) (-1433.929) * (-1433.421) (-1432.410) (-1436.512) [-1431.732] -- 0:01:03
60000 -- (-1436.128) [-1437.227] (-1431.828) (-1432.333) * [-1435.681] (-1437.156) (-1435.277) (-1434.449) -- 0:01:02
Average standard deviation of split frequencies: 0.023743
60500 -- (-1435.022) (-1438.407) [-1433.649] (-1433.367) * (-1435.011) [-1436.839] (-1434.035) (-1432.867) -- 0:01:02
61000 -- (-1435.116) [-1435.330] (-1437.227) (-1432.361) * (-1436.408) (-1435.596) [-1433.137] (-1434.483) -- 0:01:01
61500 -- [-1432.926] (-1442.450) (-1437.720) (-1433.148) * (-1435.500) [-1437.088] (-1433.033) (-1437.059) -- 0:01:01
62000 -- (-1435.223) (-1437.589) [-1433.363] (-1437.776) * (-1440.791) [-1432.732] (-1434.520) (-1432.996) -- 0:01:00
62500 -- (-1434.750) (-1448.198) (-1437.941) [-1434.848] * (-1441.764) (-1432.127) (-1437.050) [-1433.437] -- 0:01:00
63000 -- [-1433.482] (-1437.748) (-1431.583) (-1432.747) * (-1435.517) (-1432.806) [-1435.358] (-1434.803) -- 0:00:59
63500 -- (-1434.934) (-1445.429) [-1434.127] (-1433.281) * (-1434.529) [-1431.922] (-1433.204) (-1433.974) -- 0:00:58
64000 -- (-1434.956) (-1438.621) (-1432.695) [-1431.851] * (-1433.108) (-1432.190) [-1432.844] (-1433.249) -- 0:01:13
64500 -- (-1434.139) (-1453.748) (-1433.331) [-1429.659] * (-1433.516) (-1433.600) [-1433.529] (-1436.185) -- 0:01:12
65000 -- (-1435.409) (-1431.849) (-1432.542) [-1431.403] * (-1434.901) (-1434.399) (-1432.318) [-1434.841] -- 0:01:11
Average standard deviation of split frequencies: 0.023927
65500 -- (-1434.384) [-1441.258] (-1437.937) (-1429.529) * [-1435.323] (-1433.279) (-1436.858) (-1437.948) -- 0:01:11
66000 -- (-1434.519) [-1437.645] (-1433.845) (-1430.956) * [-1433.429] (-1438.062) (-1433.285) (-1435.749) -- 0:01:10
66500 -- (-1435.547) (-1434.588) [-1431.691] (-1430.159) * [-1433.460] (-1433.006) (-1431.848) (-1434.238) -- 0:01:10
67000 -- (-1438.103) [-1440.979] (-1434.126) (-1435.015) * (-1434.653) (-1433.634) [-1432.218] (-1432.239) -- 0:01:09
67500 -- (-1435.680) [-1434.894] (-1432.868) (-1432.386) * [-1435.701] (-1435.829) (-1433.775) (-1436.443) -- 0:01:09
68000 -- (-1435.223) [-1431.883] (-1435.956) (-1431.978) * (-1435.875) (-1433.203) (-1433.914) [-1434.053] -- 0:01:08
68500 -- (-1434.085) [-1435.273] (-1435.479) (-1432.549) * [-1437.814] (-1433.184) (-1437.038) (-1434.286) -- 0:01:07
69000 -- (-1433.766) [-1442.348] (-1434.706) (-1432.636) * (-1434.175) (-1434.646) (-1435.388) [-1434.194] -- 0:01:07
69500 -- (-1434.453) (-1441.384) (-1434.213) [-1433.820] * (-1432.780) [-1434.779] (-1436.232) (-1432.511) -- 0:01:06
70000 -- (-1433.989) (-1445.517) (-1434.638) [-1435.622] * (-1433.215) [-1434.463] (-1435.325) (-1434.573) -- 0:01:06
Average standard deviation of split frequencies: 0.021417
70500 -- (-1432.561) [-1434.737] (-1433.048) (-1434.589) * (-1432.966) (-1437.551) (-1434.002) [-1431.962] -- 0:01:05
71000 -- (-1432.701) (-1437.527) [-1434.442] (-1434.743) * [-1434.489] (-1435.063) (-1433.525) (-1433.487) -- 0:01:05
71500 -- (-1431.595) (-1443.296) [-1432.048] (-1432.923) * [-1433.705] (-1433.565) (-1435.030) (-1434.607) -- 0:01:04
72000 -- (-1432.403) (-1445.663) (-1435.534) [-1432.726] * (-1434.103) [-1433.502] (-1434.500) (-1433.283) -- 0:01:04
72500 -- (-1434.032) [-1439.768] (-1435.535) (-1430.823) * (-1439.640) (-1435.978) (-1433.405) [-1433.425] -- 0:01:03
73000 -- (-1433.870) [-1438.110] (-1433.589) (-1437.886) * [-1439.308] (-1435.576) (-1432.295) (-1433.843) -- 0:01:03
73500 -- (-1433.387) [-1437.139] (-1430.755) (-1434.021) * (-1436.684) [-1435.709] (-1436.004) (-1433.602) -- 0:01:03
74000 -- (-1433.013) (-1436.744) (-1432.180) [-1434.675] * (-1433.839) (-1437.217) [-1436.985] (-1432.366) -- 0:01:02
74500 -- [-1431.940] (-1439.146) (-1436.492) (-1437.848) * (-1435.662) (-1434.589) (-1433.948) [-1433.090] -- 0:01:02
75000 -- (-1430.620) (-1441.632) (-1434.343) [-1437.720] * (-1438.506) (-1434.494) (-1434.411) [-1433.076] -- 0:01:01
Average standard deviation of split frequencies: 0.021399
75500 -- [-1430.577] (-1442.168) (-1432.539) (-1440.704) * [-1431.771] (-1435.310) (-1434.044) (-1436.274) -- 0:01:01
76000 -- [-1432.942] (-1439.047) (-1434.263) (-1439.875) * [-1438.537] (-1434.514) (-1434.161) (-1435.454) -- 0:01:00
76500 -- (-1432.650) (-1436.145) [-1431.156] (-1439.066) * (-1434.253) [-1436.372] (-1435.415) (-1434.306) -- 0:01:00
77000 -- (-1432.663) (-1437.542) [-1432.948] (-1433.748) * (-1437.988) [-1434.000] (-1432.233) (-1436.176) -- 0:00:59
77500 -- (-1434.564) (-1435.224) (-1430.858) [-1432.008] * (-1435.576) (-1432.645) (-1435.311) [-1433.229] -- 0:00:59
78000 -- (-1431.866) [-1434.858] (-1432.618) (-1435.396) * (-1433.336) [-1432.414] (-1431.249) (-1438.926) -- 0:00:59
78500 -- (-1433.167) (-1436.949) (-1434.609) [-1434.464] * (-1434.350) [-1433.007] (-1433.479) (-1437.245) -- 0:00:58
79000 -- (-1432.911) (-1437.081) (-1434.983) [-1433.749] * (-1434.092) [-1435.573] (-1433.719) (-1432.492) -- 0:01:09
79500 -- (-1433.108) (-1435.387) [-1434.280] (-1433.967) * (-1439.804) (-1433.357) (-1435.784) [-1433.900] -- 0:01:09
80000 -- (-1434.573) [-1432.622] (-1431.737) (-1432.069) * (-1433.848) (-1438.467) (-1434.358) [-1436.140] -- 0:01:09
Average standard deviation of split frequencies: 0.023083
80500 -- (-1433.046) (-1433.590) [-1432.138] (-1431.758) * [-1435.265] (-1438.764) (-1431.933) (-1438.969) -- 0:01:08
81000 -- (-1433.305) [-1437.297] (-1431.654) (-1432.145) * [-1435.937] (-1435.237) (-1434.233) (-1440.643) -- 0:01:08
81500 -- [-1435.559] (-1434.862) (-1435.263) (-1433.015) * (-1435.003) (-1432.814) [-1434.429] (-1436.804) -- 0:01:07
82000 -- (-1436.904) (-1437.063) [-1432.854] (-1433.535) * [-1432.325] (-1433.376) (-1431.306) (-1439.167) -- 0:01:07
82500 -- (-1430.207) (-1440.486) (-1434.732) [-1434.121] * (-1435.269) [-1433.603] (-1430.792) (-1438.862) -- 0:01:06
83000 -- (-1434.719) (-1432.847) (-1433.504) [-1434.862] * [-1434.537] (-1434.830) (-1435.932) (-1436.502) -- 0:01:06
83500 -- [-1435.684] (-1433.956) (-1432.615) (-1436.540) * (-1434.129) (-1434.018) [-1432.936] (-1438.500) -- 0:01:05
84000 -- [-1436.354] (-1434.099) (-1433.070) (-1435.695) * (-1435.457) (-1433.703) [-1432.031] (-1434.044) -- 0:01:05
84500 -- (-1440.338) [-1436.432] (-1435.860) (-1437.869) * (-1433.372) [-1438.061] (-1434.512) (-1433.144) -- 0:01:05
85000 -- [-1435.716] (-1435.260) (-1435.060) (-1433.426) * (-1432.110) (-1438.563) [-1431.700] (-1433.995) -- 0:01:04
Average standard deviation of split frequencies: 0.022709
85500 -- (-1433.241) [-1433.704] (-1435.417) (-1434.840) * (-1432.273) (-1435.834) [-1434.792] (-1431.026) -- 0:01:04
86000 -- (-1433.913) (-1431.731) [-1432.114] (-1433.947) * [-1432.462] (-1436.824) (-1435.926) (-1432.777) -- 0:01:03
86500 -- (-1433.900) (-1432.303) (-1434.523) [-1437.897] * [-1433.329] (-1437.824) (-1438.832) (-1433.348) -- 0:01:03
87000 -- (-1433.765) [-1431.658] (-1435.017) (-1438.580) * [-1433.021] (-1439.908) (-1434.666) (-1435.574) -- 0:01:02
87500 -- (-1434.110) (-1433.259) [-1431.968] (-1436.082) * (-1431.381) [-1432.673] (-1441.541) (-1438.531) -- 0:01:02
88000 -- (-1433.854) (-1433.210) [-1431.932] (-1431.404) * (-1431.428) (-1434.761) (-1438.332) [-1433.744] -- 0:01:02
88500 -- [-1434.338] (-1434.215) (-1435.154) (-1432.985) * (-1432.882) (-1434.486) (-1440.117) [-1433.256] -- 0:01:01
89000 -- (-1431.609) [-1431.508] (-1437.997) (-1431.555) * (-1438.499) [-1433.159] (-1438.363) (-1434.230) -- 0:01:01
89500 -- (-1430.493) [-1435.520] (-1435.523) (-1433.865) * (-1433.230) [-1432.845] (-1436.815) (-1433.812) -- 0:01:01
90000 -- [-1431.289] (-1436.567) (-1430.788) (-1433.095) * (-1431.597) [-1432.387] (-1440.516) (-1433.713) -- 0:01:00
Average standard deviation of split frequencies: 0.021540
90500 -- (-1431.913) (-1433.430) [-1431.279] (-1433.170) * [-1431.894] (-1434.558) (-1435.164) (-1432.893) -- 0:01:00
91000 -- (-1433.243) [-1434.066] (-1437.509) (-1435.462) * (-1432.822) (-1435.034) [-1433.552] (-1435.203) -- 0:00:59
91500 -- (-1433.386) (-1436.424) (-1434.253) [-1435.457] * (-1432.869) (-1436.618) (-1431.285) [-1431.235] -- 0:00:59
92000 -- (-1433.291) [-1439.696] (-1433.613) (-1433.179) * [-1433.931] (-1434.831) (-1434.470) (-1431.117) -- 0:00:59
92500 -- [-1438.204] (-1433.520) (-1435.295) (-1432.754) * (-1433.599) (-1435.557) [-1435.343] (-1431.933) -- 0:00:58
93000 -- (-1436.705) (-1432.598) [-1435.691] (-1431.783) * (-1432.596) (-1434.514) [-1430.808] (-1432.249) -- 0:00:58
93500 -- (-1432.827) [-1432.466] (-1436.289) (-1432.619) * (-1432.480) (-1435.095) [-1429.436] (-1431.081) -- 0:01:07
94000 -- [-1434.258] (-1433.314) (-1436.337) (-1434.472) * (-1433.113) (-1432.259) (-1430.561) [-1431.556] -- 0:01:07
94500 -- (-1433.927) [-1430.582] (-1434.741) (-1433.367) * (-1434.405) [-1434.514] (-1433.260) (-1434.778) -- 0:01:07
95000 -- [-1432.452] (-1433.956) (-1436.253) (-1432.747) * (-1431.570) (-1435.034) [-1429.565] (-1433.766) -- 0:01:06
Average standard deviation of split frequencies: 0.018005
95500 -- (-1433.768) (-1440.434) [-1432.742] (-1437.380) * (-1432.543) [-1436.425] (-1430.544) (-1434.170) -- 0:01:06
96000 -- [-1434.008] (-1432.871) (-1432.843) (-1436.145) * (-1436.380) (-1438.761) [-1432.871] (-1433.997) -- 0:01:05
96500 -- (-1435.895) [-1433.505] (-1434.089) (-1435.136) * (-1433.404) (-1436.629) [-1432.213] (-1432.489) -- 0:01:05
97000 -- (-1436.253) (-1435.473) (-1433.818) [-1433.246] * (-1433.589) [-1434.210] (-1432.418) (-1433.480) -- 0:01:05
97500 -- [-1436.145] (-1436.573) (-1434.994) (-1435.207) * (-1433.569) (-1434.837) [-1432.109] (-1434.346) -- 0:01:04
98000 -- [-1433.881] (-1435.326) (-1433.470) (-1431.738) * (-1432.991) [-1433.097] (-1433.187) (-1433.808) -- 0:01:04
98500 -- (-1431.567) (-1434.153) (-1431.875) [-1432.571] * (-1433.181) [-1433.448] (-1435.377) (-1434.504) -- 0:01:04
99000 -- (-1433.843) (-1433.958) (-1435.187) [-1432.867] * (-1435.087) (-1435.121) (-1436.112) [-1435.168] -- 0:01:03
99500 -- (-1434.579) (-1433.905) (-1435.249) [-1433.486] * (-1435.411) (-1435.227) [-1437.624] (-1432.399) -- 0:01:03
100000 -- (-1435.530) (-1435.299) [-1433.273] (-1431.706) * (-1435.420) [-1434.754] (-1433.484) (-1432.991) -- 0:01:02
Average standard deviation of split frequencies: 0.019471
100500 -- [-1432.892] (-1433.735) (-1432.212) (-1433.012) * (-1438.610) (-1441.527) [-1433.965] (-1437.337) -- 0:01:02
101000 -- (-1437.581) (-1435.402) [-1433.021] (-1434.030) * (-1436.564) (-1432.583) [-1438.752] (-1435.219) -- 0:01:02
101500 -- [-1434.593] (-1434.115) (-1432.381) (-1432.598) * (-1438.807) (-1434.547) (-1434.082) [-1436.550] -- 0:01:01
102000 -- (-1432.319) (-1435.265) [-1434.288] (-1430.992) * (-1434.228) (-1433.058) (-1432.131) [-1433.568] -- 0:01:01
102500 -- (-1433.794) (-1434.068) (-1431.247) [-1432.278] * (-1436.090) [-1432.297] (-1433.439) (-1433.653) -- 0:01:01
103000 -- (-1433.312) (-1433.049) [-1432.812] (-1430.456) * (-1431.560) (-1433.027) [-1432.744] (-1437.051) -- 0:01:00
103500 -- (-1434.750) [-1433.909] (-1431.178) (-1431.716) * (-1431.516) [-1433.017] (-1433.228) (-1435.256) -- 0:01:00
104000 -- (-1435.473) (-1437.142) (-1432.527) [-1432.614] * (-1437.367) (-1434.212) [-1434.382] (-1433.749) -- 0:01:00
104500 -- (-1435.065) [-1433.695] (-1434.452) (-1435.506) * (-1435.101) [-1434.884] (-1431.179) (-1432.715) -- 0:00:59
105000 -- (-1434.925) (-1433.568) [-1434.162] (-1435.280) * (-1435.390) (-1432.602) [-1433.075] (-1436.997) -- 0:00:59
Average standard deviation of split frequencies: 0.021791
105500 -- (-1436.190) [-1434.614] (-1436.732) (-1438.495) * (-1435.775) [-1434.599] (-1434.380) (-1439.487) -- 0:00:59
106000 -- (-1434.749) (-1433.506) (-1436.666) [-1434.449] * [-1433.543] (-1435.241) (-1432.048) (-1433.223) -- 0:00:59
106500 -- (-1437.769) (-1434.133) [-1434.789] (-1434.114) * (-1435.920) (-1435.988) (-1434.858) [-1436.866] -- 0:00:58
107000 -- (-1433.900) [-1434.155] (-1436.272) (-1432.998) * (-1434.908) (-1436.961) (-1433.324) [-1436.330] -- 0:00:58
107500 -- (-1435.254) (-1436.063) [-1437.376] (-1434.713) * (-1433.815) (-1432.188) [-1431.439] (-1435.129) -- 0:00:58
108000 -- (-1438.020) [-1435.835] (-1434.415) (-1435.242) * [-1434.212] (-1433.537) (-1434.891) (-1433.618) -- 0:01:06
108500 -- (-1432.165) [-1436.012] (-1436.234) (-1434.123) * [-1432.538] (-1433.091) (-1435.296) (-1432.928) -- 0:01:05
109000 -- (-1431.834) (-1436.722) (-1435.439) [-1433.733] * (-1432.028) (-1432.835) [-1436.537] (-1433.155) -- 0:01:05
109500 -- (-1432.173) [-1433.650] (-1433.760) (-1433.097) * (-1434.392) (-1433.975) (-1435.610) [-1433.596] -- 0:01:05
110000 -- [-1431.925] (-1435.713) (-1433.226) (-1437.517) * (-1435.795) (-1436.621) [-1432.411] (-1433.627) -- 0:01:04
Average standard deviation of split frequencies: 0.019169
110500 -- (-1434.031) [-1434.546] (-1434.922) (-1434.561) * (-1434.618) (-1434.807) [-1432.105] (-1435.003) -- 0:01:04
111000 -- (-1434.166) (-1433.921) (-1433.709) [-1434.643] * (-1434.588) (-1434.685) (-1433.453) [-1434.057] -- 0:01:04
111500 -- [-1431.083] (-1435.734) (-1434.280) (-1435.775) * (-1433.043) (-1434.250) (-1435.363) [-1433.888] -- 0:01:03
112000 -- (-1433.119) (-1436.328) (-1435.121) [-1435.370] * (-1433.007) (-1433.721) (-1434.850) [-1432.781] -- 0:01:03
112500 -- (-1430.784) [-1433.308] (-1434.958) (-1435.347) * (-1434.606) (-1433.654) (-1436.581) [-1434.859] -- 0:01:03
113000 -- (-1431.060) [-1434.406] (-1437.177) (-1432.280) * [-1433.174] (-1434.690) (-1435.935) (-1433.173) -- 0:01:02
113500 -- [-1434.893] (-1433.825) (-1436.756) (-1435.901) * (-1431.257) (-1436.401) (-1433.791) [-1437.462] -- 0:01:02
114000 -- (-1436.282) (-1434.075) (-1436.908) [-1433.949] * (-1433.184) [-1434.089] (-1433.131) (-1434.074) -- 0:01:02
114500 -- [-1436.758] (-1435.396) (-1437.019) (-1434.975) * (-1434.139) (-1435.303) (-1433.279) [-1434.719] -- 0:01:01
115000 -- (-1431.529) (-1435.638) [-1433.626] (-1432.976) * [-1436.938] (-1435.591) (-1435.002) (-1436.695) -- 0:01:01
Average standard deviation of split frequencies: 0.019891
115500 -- [-1430.789] (-1438.836) (-1435.557) (-1430.742) * [-1434.921] (-1435.959) (-1431.044) (-1434.710) -- 0:01:01
116000 -- (-1431.753) (-1437.657) (-1434.410) [-1431.499] * (-1433.382) (-1432.988) (-1434.425) [-1433.113] -- 0:01:00
116500 -- [-1437.860] (-1435.706) (-1439.123) (-1437.420) * (-1432.690) [-1431.683] (-1437.277) (-1435.635) -- 0:01:00
117000 -- (-1436.335) (-1434.204) [-1436.058] (-1433.239) * (-1436.539) (-1439.381) (-1436.551) [-1431.261] -- 0:01:00
117500 -- (-1435.609) [-1433.125] (-1437.057) (-1435.974) * [-1433.528] (-1439.024) (-1433.683) (-1433.236) -- 0:01:00
118000 -- (-1435.487) (-1435.032) (-1438.857) [-1433.080] * (-1434.612) (-1434.421) [-1432.552] (-1437.681) -- 0:00:59
118500 -- (-1430.758) (-1435.029) [-1439.147] (-1432.670) * (-1436.088) (-1430.280) (-1435.760) [-1434.820] -- 0:00:59
119000 -- (-1433.243) (-1433.285) [-1434.012] (-1435.819) * (-1435.363) (-1436.415) [-1433.454] (-1434.048) -- 0:00:59
119500 -- (-1431.896) (-1433.891) (-1438.002) [-1435.324] * (-1433.059) (-1430.748) [-1434.078] (-1432.201) -- 0:00:58
120000 -- [-1432.195] (-1433.506) (-1434.589) (-1433.082) * (-1433.732) (-1434.796) (-1434.239) [-1432.367] -- 0:00:58
Average standard deviation of split frequencies: 0.019316
120500 -- [-1433.771] (-1431.891) (-1433.753) (-1435.214) * (-1435.175) (-1433.320) [-1433.517] (-1434.651) -- 0:00:58
121000 -- (-1433.988) (-1433.093) [-1434.564] (-1432.760) * (-1434.843) (-1435.309) [-1433.658] (-1433.243) -- 0:00:58
121500 -- (-1430.663) (-1432.639) (-1436.936) [-1433.200] * (-1436.340) (-1433.830) [-1432.674] (-1433.366) -- 0:00:57
122000 -- (-1432.527) [-1433.511] (-1434.954) (-1433.549) * [-1434.244] (-1434.111) (-1435.714) (-1434.154) -- 0:00:57
122500 -- (-1437.768) (-1434.883) (-1432.691) [-1435.507] * (-1435.016) [-1431.152] (-1431.862) (-1435.542) -- 0:01:04
123000 -- (-1434.470) (-1431.679) (-1431.923) [-1433.412] * (-1436.567) (-1431.900) (-1431.942) [-1435.714] -- 0:01:04
123500 -- (-1431.088) (-1433.991) (-1432.391) [-1433.398] * (-1434.983) (-1430.456) (-1432.478) [-1432.878] -- 0:01:03
124000 -- [-1432.396] (-1433.516) (-1434.848) (-1433.637) * (-1433.672) (-1434.617) [-1432.991] (-1433.086) -- 0:01:03
124500 -- [-1432.439] (-1432.333) (-1434.293) (-1434.802) * (-1433.351) (-1434.743) (-1432.587) [-1433.623] -- 0:01:03
125000 -- (-1432.310) [-1434.312] (-1434.699) (-1433.734) * (-1433.306) [-1432.800] (-1432.869) (-1433.188) -- 0:01:03
Average standard deviation of split frequencies: 0.016628
125500 -- (-1432.455) [-1436.921] (-1434.054) (-1434.029) * (-1433.585) (-1432.794) [-1431.426] (-1434.264) -- 0:01:02
126000 -- (-1436.521) (-1437.733) (-1433.929) [-1434.576] * [-1433.121] (-1432.851) (-1436.569) (-1434.267) -- 0:01:02
126500 -- [-1431.428] (-1433.717) (-1435.295) (-1434.603) * [-1434.596] (-1431.258) (-1433.469) (-1438.549) -- 0:01:02
127000 -- (-1435.497) [-1433.471] (-1434.112) (-1435.591) * (-1434.991) [-1433.689] (-1432.100) (-1435.756) -- 0:01:01
127500 -- [-1432.093] (-1434.515) (-1434.507) (-1434.469) * (-1433.524) (-1432.540) (-1432.734) [-1433.452] -- 0:01:01
128000 -- (-1434.094) (-1435.384) (-1434.870) [-1431.407] * (-1433.779) (-1432.083) (-1434.317) [-1434.536] -- 0:01:01
128500 -- (-1435.023) (-1433.445) (-1433.601) [-1435.838] * (-1437.117) [-1433.589] (-1436.159) (-1432.667) -- 0:01:01
129000 -- [-1433.799] (-1434.436) (-1430.991) (-1433.084) * (-1437.025) (-1430.901) (-1437.841) [-1434.071] -- 0:01:00
129500 -- (-1437.272) [-1433.673] (-1431.547) (-1435.105) * (-1435.542) (-1436.865) (-1435.846) [-1441.380] -- 0:01:00
130000 -- (-1439.154) [-1434.031] (-1433.589) (-1434.228) * (-1440.959) (-1440.407) (-1434.065) [-1433.199] -- 0:01:00
Average standard deviation of split frequencies: 0.018988
130500 -- [-1435.898] (-1433.363) (-1435.797) (-1432.844) * [-1434.193] (-1435.122) (-1434.917) (-1434.515) -- 0:00:59
131000 -- (-1432.726) (-1434.980) (-1437.098) [-1432.631] * (-1441.482) (-1430.890) [-1435.111] (-1438.168) -- 0:00:59
131500 -- (-1430.076) (-1433.912) (-1435.752) [-1433.143] * (-1435.075) (-1434.547) [-1433.896] (-1434.854) -- 0:00:59
132000 -- [-1435.500] (-1434.032) (-1433.059) (-1432.675) * (-1436.049) [-1431.915] (-1433.607) (-1438.123) -- 0:00:59
132500 -- (-1433.985) (-1434.353) [-1432.316] (-1434.571) * (-1435.427) (-1433.755) (-1433.753) [-1435.748] -- 0:00:58
133000 -- [-1431.910] (-1435.582) (-1433.665) (-1433.424) * [-1434.889] (-1433.022) (-1435.057) (-1432.936) -- 0:00:58
133500 -- [-1431.678] (-1436.918) (-1434.689) (-1433.636) * (-1436.073) [-1432.827] (-1438.952) (-1434.094) -- 0:00:58
134000 -- (-1432.812) [-1434.936] (-1435.666) (-1432.302) * (-1434.838) (-1431.855) (-1435.109) [-1430.909] -- 0:00:58
134500 -- (-1433.588) (-1435.495) [-1438.318] (-1435.046) * [-1431.905] (-1432.138) (-1434.191) (-1431.564) -- 0:00:57
135000 -- (-1433.795) [-1434.371] (-1438.128) (-1434.148) * (-1432.886) (-1433.646) [-1432.688] (-1429.887) -- 0:00:57
Average standard deviation of split frequencies: 0.017331
135500 -- (-1435.385) (-1435.034) (-1433.770) [-1434.143] * (-1433.693) (-1439.450) [-1431.798] (-1431.644) -- 0:00:57
136000 -- (-1435.732) [-1433.190] (-1439.769) (-1435.342) * [-1432.355] (-1433.223) (-1433.528) (-1435.386) -- 0:00:57
136500 -- (-1436.093) [-1433.967] (-1438.710) (-1434.690) * (-1432.693) [-1433.642] (-1433.854) (-1436.071) -- 0:00:56
137000 -- (-1433.321) [-1433.900] (-1436.757) (-1434.872) * [-1432.567] (-1431.943) (-1433.867) (-1435.389) -- 0:00:56
137500 -- (-1433.079) (-1432.960) (-1435.844) [-1435.596] * (-1433.154) [-1434.372] (-1432.192) (-1434.643) -- 0:01:02
138000 -- (-1435.542) [-1433.530] (-1436.205) (-1436.073) * (-1432.754) (-1434.112) (-1432.764) [-1431.567] -- 0:01:02
138500 -- (-1436.431) (-1433.722) (-1436.041) [-1435.616] * (-1434.891) (-1435.450) (-1432.201) [-1432.192] -- 0:01:02
139000 -- (-1432.916) [-1435.214] (-1436.145) (-1432.806) * (-1438.603) (-1436.028) [-1435.934] (-1436.503) -- 0:01:01
139500 -- [-1432.213] (-1436.050) (-1437.076) (-1433.786) * [-1436.075] (-1432.613) (-1433.626) (-1440.164) -- 0:01:01
140000 -- [-1433.702] (-1432.767) (-1437.060) (-1435.549) * (-1434.311) (-1434.149) [-1431.521] (-1434.629) -- 0:01:01
Average standard deviation of split frequencies: 0.015770
140500 -- (-1434.412) [-1431.670] (-1436.863) (-1434.173) * (-1432.145) (-1434.433) [-1433.409] (-1433.491) -- 0:01:01
141000 -- (-1433.228) [-1431.181] (-1438.777) (-1431.073) * (-1434.162) (-1434.091) (-1433.555) [-1431.298] -- 0:01:00
141500 -- (-1431.995) (-1435.288) [-1438.354] (-1433.027) * [-1435.430] (-1434.420) (-1433.443) (-1432.146) -- 0:01:00
142000 -- [-1433.946] (-1433.640) (-1439.137) (-1434.050) * (-1433.423) (-1432.911) [-1434.346] (-1433.768) -- 0:01:00
142500 -- (-1434.302) [-1436.863] (-1438.543) (-1433.899) * [-1433.340] (-1434.233) (-1432.943) (-1433.577) -- 0:01:00
143000 -- [-1433.907] (-1433.908) (-1438.873) (-1433.494) * (-1435.211) (-1432.118) [-1431.019] (-1433.107) -- 0:00:59
143500 -- (-1433.707) [-1433.957] (-1436.229) (-1436.415) * (-1433.609) (-1431.891) (-1433.768) [-1438.611] -- 0:00:59
144000 -- (-1431.932) [-1435.923] (-1434.187) (-1434.045) * (-1432.802) (-1434.413) [-1433.801] (-1433.073) -- 0:00:59
144500 -- (-1437.589) [-1435.402] (-1435.300) (-1434.316) * (-1432.844) (-1432.265) [-1432.616] (-1434.355) -- 0:00:59
145000 -- [-1433.552] (-1435.540) (-1433.713) (-1433.378) * (-1432.291) [-1432.510] (-1435.467) (-1434.170) -- 0:00:58
Average standard deviation of split frequencies: 0.016334
145500 -- (-1434.544) [-1434.157] (-1434.406) (-1434.753) * (-1437.097) (-1435.563) [-1432.925] (-1437.102) -- 0:00:58
146000 -- (-1432.835) [-1432.812] (-1434.603) (-1433.275) * (-1435.248) (-1437.506) [-1432.829] (-1435.392) -- 0:00:58
146500 -- (-1431.584) (-1434.329) (-1434.518) [-1435.244] * (-1433.882) (-1434.508) (-1431.065) [-1436.932] -- 0:00:58
147000 -- (-1432.858) (-1434.985) (-1435.390) [-1432.995] * (-1435.534) (-1433.934) [-1433.023] (-1434.789) -- 0:00:58
147500 -- (-1433.265) [-1432.114] (-1433.191) (-1434.092) * (-1436.282) (-1433.029) [-1432.911] (-1434.315) -- 0:00:57
148000 -- (-1434.220) (-1431.703) [-1436.414] (-1431.104) * (-1437.316) [-1437.997] (-1430.885) (-1432.670) -- 0:00:57
148500 -- (-1435.365) (-1431.139) (-1434.887) [-1431.946] * (-1435.323) (-1434.452) (-1430.523) [-1434.946] -- 0:00:57
149000 -- (-1435.901) (-1431.052) [-1434.233] (-1432.716) * (-1435.609) (-1436.108) [-1430.315] (-1434.449) -- 0:00:57
149500 -- [-1436.892] (-1430.269) (-1434.117) (-1433.228) * (-1435.460) (-1430.799) [-1431.483] (-1434.938) -- 0:00:56
150000 -- (-1436.088) (-1434.763) (-1439.808) [-1433.466] * (-1433.436) (-1432.144) (-1432.746) [-1435.369] -- 0:00:56
Average standard deviation of split frequencies: 0.014540
150500 -- (-1435.281) [-1431.092] (-1436.555) (-1433.265) * (-1434.083) [-1431.444] (-1436.336) (-1434.279) -- 0:00:56
151000 -- (-1437.358) (-1435.083) [-1437.556] (-1432.569) * (-1433.647) [-1434.888] (-1432.433) (-1434.110) -- 0:00:56
151500 -- (-1433.967) (-1438.680) (-1436.316) [-1433.613] * (-1438.632) [-1434.342] (-1433.460) (-1434.885) -- 0:00:56
152000 -- (-1433.526) (-1433.558) (-1433.309) [-1430.905] * (-1434.875) [-1434.120] (-1433.011) (-1434.306) -- 0:01:01
152500 -- [-1432.902] (-1432.259) (-1433.625) (-1432.886) * [-1433.685] (-1431.781) (-1432.704) (-1432.745) -- 0:01:01
153000 -- (-1438.216) (-1432.633) (-1433.022) [-1430.799] * (-1441.923) (-1431.658) [-1433.007] (-1432.824) -- 0:01:00
153500 -- (-1436.510) [-1433.366] (-1434.542) (-1431.700) * (-1439.415) [-1431.188] (-1431.210) (-1436.150) -- 0:01:00
154000 -- (-1434.988) [-1433.202] (-1435.023) (-1434.097) * (-1436.700) (-1432.986) [-1431.635] (-1437.967) -- 0:01:00
154500 -- [-1436.092] (-1433.874) (-1432.142) (-1434.648) * (-1438.435) (-1432.888) [-1430.816] (-1437.379) -- 0:01:00
155000 -- (-1436.430) (-1435.396) [-1433.889] (-1434.091) * [-1434.594] (-1435.513) (-1430.848) (-1436.196) -- 0:00:59
Average standard deviation of split frequencies: 0.014043
155500 -- (-1433.519) [-1433.543] (-1436.130) (-1433.019) * (-1439.019) [-1433.465] (-1433.519) (-1435.307) -- 0:00:59
156000 -- [-1435.163] (-1437.892) (-1433.753) (-1432.987) * (-1436.229) (-1432.924) [-1435.314] (-1434.907) -- 0:00:59
156500 -- [-1432.237] (-1431.644) (-1439.409) (-1431.965) * (-1432.892) [-1432.953] (-1433.055) (-1433.889) -- 0:00:59
157000 -- [-1436.124] (-1433.843) (-1441.916) (-1431.404) * (-1433.273) [-1432.431] (-1435.164) (-1433.063) -- 0:00:59
157500 -- (-1438.110) (-1434.028) (-1438.732) [-1430.379] * (-1435.033) [-1431.301] (-1431.593) (-1433.768) -- 0:00:58
158000 -- [-1435.061] (-1430.571) (-1437.342) (-1432.544) * (-1433.579) (-1431.752) [-1432.972] (-1434.475) -- 0:00:58
158500 -- (-1436.188) (-1430.094) [-1434.455] (-1433.012) * (-1432.237) (-1433.319) [-1431.351] (-1434.013) -- 0:00:58
159000 -- (-1434.063) [-1432.249] (-1436.185) (-1432.900) * (-1431.428) (-1433.131) [-1431.021] (-1436.418) -- 0:00:58
159500 -- (-1434.146) [-1432.750] (-1433.962) (-1433.562) * (-1433.500) (-1431.974) [-1431.566] (-1435.005) -- 0:00:57
160000 -- (-1435.660) [-1431.392] (-1438.851) (-1433.212) * (-1432.854) [-1433.132] (-1431.665) (-1436.193) -- 0:00:57
Average standard deviation of split frequencies: 0.013290
160500 -- [-1431.072] (-1433.551) (-1436.891) (-1432.940) * (-1433.389) (-1435.004) [-1432.775] (-1434.488) -- 0:00:57
161000 -- [-1430.210] (-1432.754) (-1433.910) (-1436.008) * (-1433.750) [-1432.997] (-1433.530) (-1432.425) -- 0:00:57
161500 -- (-1435.272) (-1431.686) [-1431.934] (-1433.853) * (-1434.048) [-1432.062] (-1431.695) (-1434.328) -- 0:00:57
162000 -- (-1434.221) (-1432.183) [-1434.929] (-1432.832) * (-1432.993) (-1433.669) (-1432.375) [-1439.012] -- 0:00:56
162500 -- [-1432.210] (-1430.937) (-1432.275) (-1433.540) * (-1431.537) (-1436.724) [-1430.772] (-1434.578) -- 0:00:56
163000 -- (-1435.301) (-1433.533) (-1433.473) [-1433.164] * [-1433.408] (-1433.394) (-1433.836) (-1433.399) -- 0:00:56
163500 -- (-1431.711) [-1431.601] (-1430.455) (-1433.488) * [-1434.127] (-1433.450) (-1432.800) (-1432.211) -- 0:00:56
164000 -- (-1432.741) (-1431.534) [-1434.707] (-1434.215) * (-1432.866) (-1434.085) [-1431.709] (-1431.243) -- 0:00:56
164500 -- (-1430.969) (-1431.573) [-1436.477] (-1432.941) * (-1436.072) (-1432.490) (-1434.147) [-1431.731] -- 0:00:55
165000 -- (-1432.253) [-1433.963] (-1434.873) (-1432.639) * (-1433.252) [-1433.372] (-1433.119) (-1432.495) -- 0:00:55
Average standard deviation of split frequencies: 0.015777
165500 -- (-1433.067) [-1431.648] (-1435.087) (-1433.233) * (-1432.652) (-1433.182) [-1433.438] (-1431.533) -- 0:00:55
166000 -- (-1435.066) (-1432.641) [-1434.200] (-1433.894) * (-1432.887) (-1435.464) (-1431.903) [-1433.030] -- 0:00:55
166500 -- [-1435.108] (-1434.077) (-1432.470) (-1433.026) * (-1433.091) (-1434.269) [-1432.085] (-1433.993) -- 0:00:55
167000 -- (-1436.017) (-1438.085) [-1430.524] (-1433.236) * (-1438.516) (-1434.142) (-1431.066) [-1435.279] -- 0:00:59
167500 -- (-1435.185) [-1435.654] (-1432.144) (-1434.228) * (-1432.137) (-1431.603) (-1432.613) [-1432.297] -- 0:00:59
168000 -- [-1438.196] (-1435.916) (-1433.704) (-1433.693) * (-1432.449) (-1430.804) [-1433.249] (-1433.526) -- 0:00:59
168500 -- [-1433.214] (-1436.899) (-1435.865) (-1438.007) * (-1434.916) [-1431.823] (-1431.914) (-1432.432) -- 0:00:59
169000 -- (-1431.876) (-1435.155) (-1433.942) [-1432.737] * (-1433.993) [-1432.810] (-1434.181) (-1433.214) -- 0:00:59
169500 -- (-1433.892) (-1431.925) [-1430.779] (-1431.726) * [-1431.664] (-1431.166) (-1434.692) (-1434.588) -- 0:00:58
170000 -- [-1434.622] (-1433.641) (-1434.088) (-1435.324) * [-1430.080] (-1436.423) (-1432.588) (-1431.744) -- 0:00:58
Average standard deviation of split frequencies: 0.016573
170500 -- (-1434.761) (-1435.424) (-1436.154) [-1432.228] * (-1431.724) (-1436.510) (-1433.496) [-1432.786] -- 0:00:58
171000 -- (-1434.899) [-1433.531] (-1434.076) (-1431.958) * [-1433.356] (-1435.064) (-1433.174) (-1430.483) -- 0:00:58
171500 -- (-1433.651) (-1434.558) [-1431.861] (-1432.816) * (-1435.283) [-1433.319] (-1434.564) (-1437.417) -- 0:00:57
172000 -- (-1433.342) (-1440.976) [-1434.081] (-1432.379) * [-1431.263] (-1432.384) (-1434.063) (-1435.166) -- 0:00:57
172500 -- [-1433.054] (-1433.225) (-1433.649) (-1430.283) * (-1432.354) (-1431.579) (-1431.308) [-1433.604] -- 0:00:57
173000 -- (-1435.144) [-1431.989] (-1436.693) (-1431.336) * [-1434.405] (-1432.667) (-1434.157) (-1434.173) -- 0:00:57
173500 -- (-1431.397) (-1431.828) [-1436.158] (-1433.869) * (-1433.150) (-1431.688) [-1434.471] (-1432.794) -- 0:00:57
174000 -- (-1433.255) (-1436.140) (-1436.586) [-1432.270] * (-1433.751) [-1430.103] (-1434.819) (-1433.777) -- 0:00:56
174500 -- (-1432.553) (-1432.687) (-1434.653) [-1432.303] * (-1434.465) (-1430.644) [-1433.911] (-1433.971) -- 0:00:56
175000 -- (-1431.142) [-1436.591] (-1433.929) (-1433.975) * (-1435.915) (-1433.604) (-1434.991) [-1431.736] -- 0:00:56
Average standard deviation of split frequencies: 0.015125
175500 -- (-1434.793) (-1437.498) [-1434.832] (-1434.749) * (-1435.500) (-1431.970) (-1433.761) [-1432.412] -- 0:00:56
176000 -- (-1432.691) (-1433.878) [-1433.844] (-1433.566) * (-1435.279) (-1433.909) [-1432.249] (-1432.606) -- 0:00:56
176500 -- (-1434.481) (-1433.594) [-1435.327] (-1431.482) * (-1433.842) (-1432.950) [-1431.002] (-1434.529) -- 0:00:55
177000 -- (-1435.705) (-1431.980) (-1433.351) [-1433.101] * (-1435.710) (-1430.604) [-1431.852] (-1432.645) -- 0:00:55
177500 -- (-1436.092) (-1432.577) (-1440.529) [-1431.011] * (-1435.037) (-1434.512) (-1435.029) [-1434.130] -- 0:00:55
178000 -- (-1432.750) (-1432.900) (-1435.262) [-1432.650] * (-1433.373) (-1434.223) [-1431.086] (-1429.800) -- 0:00:55
178500 -- (-1433.831) (-1432.680) [-1433.241] (-1432.553) * (-1436.602) (-1432.624) [-1431.973] (-1431.262) -- 0:00:55
179000 -- (-1434.206) [-1435.926] (-1432.097) (-1433.427) * (-1435.309) (-1430.988) (-1439.833) [-1435.145] -- 0:00:55
179500 -- [-1433.967] (-1432.395) (-1431.893) (-1432.596) * (-1432.011) (-1433.623) [-1431.973] (-1432.723) -- 0:00:54
180000 -- [-1432.476] (-1441.206) (-1439.901) (-1436.584) * (-1432.220) [-1432.801] (-1431.759) (-1433.412) -- 0:00:54
Average standard deviation of split frequencies: 0.015221
180500 -- [-1434.629] (-1434.591) (-1437.930) (-1433.978) * (-1433.346) (-1433.159) [-1432.223] (-1432.567) -- 0:00:54
181000 -- (-1434.874) (-1436.174) (-1434.277) [-1432.629] * (-1439.853) (-1433.028) (-1433.427) [-1431.927] -- 0:00:54
181500 -- (-1432.636) (-1433.158) [-1432.104] (-1433.923) * (-1433.583) [-1433.413] (-1435.957) (-1435.096) -- 0:00:58
182000 -- (-1431.835) (-1432.443) [-1434.262] (-1431.013) * (-1434.884) [-1436.339] (-1432.213) (-1440.151) -- 0:00:58
182500 -- (-1432.053) (-1431.294) (-1434.233) [-1433.946] * (-1433.716) (-1439.140) (-1434.052) [-1433.313] -- 0:00:58
183000 -- (-1432.998) [-1430.893] (-1436.575) (-1433.997) * (-1434.025) (-1436.853) (-1433.094) [-1434.083] -- 0:00:58
183500 -- (-1438.995) (-1430.454) (-1436.027) [-1432.458] * (-1434.055) (-1438.334) [-1430.662] (-1433.166) -- 0:00:57
184000 -- (-1435.110) [-1430.761] (-1437.570) (-1433.016) * (-1433.853) (-1434.653) (-1432.519) [-1433.360] -- 0:00:57
184500 -- (-1441.091) [-1432.205] (-1436.047) (-1435.606) * [-1437.450] (-1435.281) (-1431.369) (-1434.881) -- 0:00:57
185000 -- (-1442.228) [-1432.263] (-1433.995) (-1434.731) * (-1433.383) [-1435.347] (-1436.782) (-1433.840) -- 0:00:57
Average standard deviation of split frequencies: 0.014406
185500 -- (-1438.143) (-1435.568) (-1433.389) [-1434.040] * [-1433.434] (-1433.749) (-1437.770) (-1433.375) -- 0:00:57
186000 -- (-1434.275) (-1434.138) (-1432.410) [-1433.855] * [-1433.112] (-1435.742) (-1437.222) (-1431.473) -- 0:00:56
186500 -- (-1434.587) [-1431.568] (-1433.445) (-1436.580) * (-1434.204) (-1439.161) [-1429.833] (-1433.411) -- 0:00:56
187000 -- (-1434.623) [-1430.162] (-1433.201) (-1435.823) * (-1434.583) [-1433.029] (-1433.477) (-1435.373) -- 0:00:56
187500 -- (-1433.857) [-1432.813] (-1434.260) (-1434.788) * (-1435.319) (-1435.663) (-1433.770) [-1433.295] -- 0:00:56
188000 -- (-1432.013) [-1439.053] (-1436.795) (-1435.306) * (-1436.774) (-1433.921) (-1437.426) [-1435.568] -- 0:00:56
188500 -- (-1431.838) [-1430.357] (-1434.525) (-1436.521) * (-1434.679) [-1435.735] (-1434.633) (-1437.504) -- 0:00:55
189000 -- (-1432.518) (-1431.328) [-1437.560] (-1435.025) * (-1435.542) (-1435.773) [-1434.545] (-1435.564) -- 0:00:55
189500 -- (-1432.612) (-1433.352) (-1433.479) [-1433.408] * (-1436.706) (-1433.464) [-1434.095] (-1433.067) -- 0:00:55
190000 -- (-1432.485) [-1433.359] (-1433.383) (-1431.127) * (-1438.253) (-1437.736) [-1433.795] (-1431.507) -- 0:00:55
Average standard deviation of split frequencies: 0.013461
190500 -- (-1434.570) (-1432.339) (-1434.833) [-1436.248] * (-1432.844) [-1433.863] (-1436.923) (-1431.995) -- 0:00:55
191000 -- (-1434.243) (-1434.106) [-1433.965] (-1434.576) * (-1435.045) (-1433.809) [-1436.975] (-1433.331) -- 0:00:55
191500 -- [-1434.464] (-1433.038) (-1434.173) (-1435.555) * [-1433.721] (-1436.404) (-1434.037) (-1432.969) -- 0:00:54
192000 -- (-1434.525) (-1434.885) (-1438.081) [-1434.922] * [-1432.476] (-1435.831) (-1434.907) (-1433.789) -- 0:00:54
192500 -- (-1435.245) [-1435.516] (-1438.786) (-1434.847) * (-1434.059) (-1437.014) [-1437.058] (-1434.319) -- 0:00:54
193000 -- (-1434.603) [-1434.957] (-1436.768) (-1434.602) * (-1434.259) (-1437.648) (-1434.061) [-1431.440] -- 0:00:54
193500 -- (-1434.604) [-1433.079] (-1434.219) (-1432.417) * [-1434.198] (-1433.170) (-1433.740) (-1434.732) -- 0:00:54
194000 -- (-1437.756) [-1432.489] (-1437.963) (-1431.843) * (-1433.148) [-1437.163] (-1434.960) (-1434.833) -- 0:00:54
194500 -- [-1433.305] (-1436.751) (-1434.809) (-1434.142) * (-1431.644) (-1433.946) (-1434.791) [-1433.633] -- 0:00:53
195000 -- (-1434.146) [-1431.537] (-1433.438) (-1435.120) * [-1435.639] (-1432.607) (-1437.980) (-1431.105) -- 0:00:53
Average standard deviation of split frequencies: 0.015823
195500 -- [-1431.674] (-1431.971) (-1433.348) (-1433.366) * (-1432.304) (-1433.965) [-1440.698] (-1435.242) -- 0:00:53
196000 -- (-1433.017) (-1433.776) [-1434.708] (-1431.170) * [-1432.425] (-1434.538) (-1437.063) (-1433.855) -- 0:00:57
196500 -- [-1432.317] (-1433.614) (-1434.155) (-1433.795) * [-1433.056] (-1433.801) (-1431.025) (-1432.349) -- 0:00:57
197000 -- (-1431.699) [-1431.580] (-1435.448) (-1430.528) * (-1433.408) [-1432.856] (-1431.733) (-1433.640) -- 0:00:57
197500 -- (-1432.978) (-1436.296) (-1432.884) [-1434.664] * (-1437.614) (-1433.130) (-1433.318) [-1432.039] -- 0:00:56
198000 -- (-1434.065) [-1434.444] (-1431.756) (-1434.363) * (-1435.417) (-1432.356) [-1433.878] (-1433.463) -- 0:00:56
198500 -- (-1434.053) (-1436.995) (-1433.770) [-1437.613] * (-1437.635) (-1432.200) [-1433.208] (-1433.553) -- 0:00:56
199000 -- [-1431.976] (-1437.225) (-1434.632) (-1431.408) * (-1433.469) (-1435.018) (-1432.889) [-1431.216] -- 0:00:56
199500 -- (-1437.107) (-1435.967) (-1434.830) [-1433.315] * [-1435.348] (-1434.850) (-1435.837) (-1432.996) -- 0:00:56
200000 -- (-1433.130) [-1436.978] (-1431.641) (-1432.278) * (-1437.127) (-1434.176) [-1432.903] (-1432.213) -- 0:00:55
Average standard deviation of split frequencies: 0.014448
200500 -- [-1432.157] (-1437.792) (-1431.509) (-1433.411) * [-1431.490] (-1433.226) (-1431.752) (-1431.661) -- 0:00:55
201000 -- (-1434.602) (-1432.772) [-1433.821] (-1432.001) * (-1438.927) (-1438.340) (-1435.957) [-1432.359] -- 0:00:55
201500 -- (-1433.784) (-1433.770) [-1433.852] (-1437.445) * [-1432.634] (-1437.366) (-1434.120) (-1434.319) -- 0:00:55
202000 -- [-1434.268] (-1437.054) (-1432.603) (-1430.978) * [-1431.728] (-1434.661) (-1433.104) (-1438.499) -- 0:00:55
202500 -- [-1434.379] (-1434.231) (-1431.728) (-1432.998) * (-1433.459) (-1432.187) [-1431.079] (-1433.009) -- 0:00:55
203000 -- [-1432.034] (-1434.788) (-1435.658) (-1431.996) * (-1431.990) (-1433.768) [-1432.110] (-1431.525) -- 0:00:54
203500 -- (-1432.778) (-1435.270) (-1439.471) [-1431.440] * (-1431.820) [-1433.677] (-1430.840) (-1432.733) -- 0:00:54
204000 -- (-1432.105) (-1435.700) [-1432.267] (-1432.240) * (-1433.932) [-1435.553] (-1432.125) (-1434.119) -- 0:00:54
204500 -- (-1435.037) [-1437.504] (-1431.644) (-1432.938) * (-1433.674) (-1432.609) (-1432.600) [-1432.019] -- 0:00:54
205000 -- (-1434.229) (-1434.183) [-1431.068] (-1432.291) * [-1433.452] (-1434.041) (-1433.406) (-1432.615) -- 0:00:54
Average standard deviation of split frequencies: 0.015290
205500 -- (-1432.971) (-1433.328) (-1432.659) [-1429.940] * (-1431.332) (-1432.158) (-1431.400) [-1430.925] -- 0:00:54
206000 -- (-1433.292) (-1433.416) [-1431.688] (-1430.985) * (-1430.835) (-1433.286) [-1431.344] (-1430.573) -- 0:00:53
206500 -- (-1436.333) (-1431.999) [-1434.687] (-1432.661) * [-1431.320] (-1434.871) (-1433.453) (-1430.316) -- 0:00:53
207000 -- (-1435.543) (-1433.807) [-1432.081] (-1433.160) * (-1431.599) [-1434.473] (-1432.693) (-1431.588) -- 0:00:53
207500 -- (-1438.572) (-1434.605) (-1434.548) [-1432.428] * (-1432.254) (-1435.077) (-1434.519) [-1432.741] -- 0:00:53
208000 -- [-1434.016] (-1434.950) (-1432.582) (-1431.606) * [-1436.081] (-1438.289) (-1432.910) (-1433.386) -- 0:00:53
208500 -- (-1434.437) (-1434.938) [-1432.229] (-1432.014) * (-1433.526) (-1433.455) (-1434.254) [-1433.215] -- 0:00:53
209000 -- (-1433.367) (-1433.525) [-1431.604] (-1431.956) * (-1434.238) (-1431.943) [-1433.179] (-1431.679) -- 0:00:52
209500 -- (-1434.520) (-1434.400) [-1431.748] (-1433.149) * (-1433.594) (-1433.712) [-1434.853] (-1432.558) -- 0:00:52
210000 -- (-1435.185) (-1430.945) (-1430.476) [-1433.015] * (-1435.679) (-1432.886) [-1431.509] (-1434.719) -- 0:00:52
Average standard deviation of split frequencies: 0.012643
210500 -- (-1433.165) (-1435.171) [-1434.153] (-1435.523) * (-1434.376) (-1432.924) (-1433.134) [-1435.874] -- 0:00:56
211000 -- [-1433.973] (-1431.821) (-1436.591) (-1433.425) * [-1433.199] (-1432.821) (-1432.064) (-1433.406) -- 0:00:56
211500 -- (-1434.992) [-1435.751] (-1435.126) (-1433.614) * (-1432.494) [-1432.974] (-1433.438) (-1432.088) -- 0:00:55
212000 -- (-1437.715) [-1431.637] (-1432.446) (-1434.535) * (-1438.914) [-1433.014] (-1431.945) (-1436.216) -- 0:00:55
212500 -- (-1433.407) (-1435.061) [-1432.893] (-1433.865) * (-1437.838) (-1431.652) (-1433.356) [-1436.678] -- 0:00:55
213000 -- [-1432.371] (-1434.531) (-1439.548) (-1436.101) * (-1432.848) (-1435.316) [-1435.320] (-1432.369) -- 0:00:55
213500 -- (-1433.805) (-1435.430) (-1433.905) [-1436.662] * (-1437.217) (-1435.224) (-1435.365) [-1435.377] -- 0:00:55
214000 -- (-1434.062) [-1437.288] (-1436.366) (-1436.275) * (-1438.172) [-1437.466] (-1435.306) (-1432.960) -- 0:00:55
214500 -- [-1434.725] (-1438.096) (-1435.330) (-1432.875) * (-1431.098) (-1434.173) (-1438.185) [-1431.512] -- 0:00:54
215000 -- (-1435.367) (-1433.504) (-1434.656) [-1435.095] * [-1433.220] (-1432.907) (-1431.549) (-1431.097) -- 0:00:54
Average standard deviation of split frequencies: 0.011882
215500 -- (-1434.891) (-1439.254) (-1434.165) [-1433.176] * (-1431.569) (-1431.633) [-1433.877] (-1430.706) -- 0:00:54
216000 -- (-1434.660) [-1434.977] (-1433.780) (-1431.864) * (-1433.769) (-1434.835) [-1440.036] (-1430.635) -- 0:00:54
216500 -- [-1433.492] (-1438.066) (-1438.052) (-1432.075) * (-1433.457) (-1434.747) (-1433.598) [-1434.942] -- 0:00:54
217000 -- (-1433.686) (-1434.478) [-1436.480] (-1432.097) * (-1435.517) (-1434.505) [-1437.056] (-1432.416) -- 0:00:54
217500 -- (-1434.659) (-1433.644) [-1435.820] (-1434.384) * [-1431.200] (-1434.164) (-1433.928) (-1434.836) -- 0:00:53
218000 -- [-1435.047] (-1437.463) (-1435.067) (-1432.314) * (-1433.647) (-1433.721) (-1434.782) [-1432.116] -- 0:00:53
218500 -- (-1432.991) [-1433.954] (-1434.671) (-1433.440) * (-1437.770) [-1434.738] (-1434.087) (-1429.450) -- 0:00:53
219000 -- (-1435.101) (-1435.625) [-1438.304] (-1437.756) * (-1434.846) (-1432.246) (-1435.594) [-1430.959] -- 0:00:53
219500 -- (-1434.213) (-1432.805) [-1433.610] (-1430.783) * [-1431.811] (-1430.706) (-1436.723) (-1432.148) -- 0:00:53
220000 -- (-1433.514) (-1433.488) [-1437.218] (-1432.603) * (-1431.609) (-1432.423) (-1435.286) [-1435.738] -- 0:00:53
Average standard deviation of split frequencies: 0.010919
220500 -- (-1433.496) (-1432.477) (-1432.026) [-1433.816] * (-1431.646) [-1430.851] (-1436.032) (-1435.810) -- 0:00:53
221000 -- (-1435.939) (-1433.870) [-1431.477] (-1436.319) * [-1431.475] (-1432.784) (-1435.463) (-1434.105) -- 0:00:52
221500 -- [-1435.795] (-1434.010) (-1435.654) (-1435.152) * (-1430.467) (-1433.932) (-1433.635) [-1432.662] -- 0:00:52
222000 -- (-1435.966) (-1437.076) (-1434.589) [-1432.941] * (-1432.685) (-1435.216) (-1431.561) [-1430.338] -- 0:00:52
222500 -- (-1436.397) (-1430.614) (-1435.185) [-1430.883] * (-1433.733) (-1436.485) (-1433.888) [-1432.161] -- 0:00:52
223000 -- (-1436.915) [-1433.531] (-1435.812) (-1432.498) * [-1432.756] (-1435.039) (-1433.533) (-1437.580) -- 0:00:52
223500 -- (-1434.433) (-1433.724) [-1436.653] (-1440.922) * (-1436.793) (-1433.485) (-1432.597) [-1430.989] -- 0:00:52
224000 -- [-1433.840] (-1432.097) (-1436.687) (-1437.339) * (-1432.656) (-1436.561) [-1432.877] (-1431.703) -- 0:00:51
224500 -- (-1432.412) (-1432.134) (-1435.231) [-1439.463] * (-1434.702) [-1435.504] (-1431.780) (-1431.224) -- 0:00:51
225000 -- [-1432.327] (-1432.333) (-1434.403) (-1435.917) * (-1432.704) (-1435.149) (-1434.139) [-1434.716] -- 0:00:51
Average standard deviation of split frequencies: 0.010545
225500 -- (-1433.012) (-1435.399) (-1434.614) [-1434.077] * (-1433.557) (-1437.980) [-1433.984] (-1434.577) -- 0:00:54
226000 -- (-1436.496) [-1433.487] (-1432.609) (-1431.989) * [-1433.976] (-1433.003) (-1432.011) (-1432.466) -- 0:00:54
226500 -- (-1434.961) (-1431.894) (-1435.765) [-1430.923] * (-1434.333) (-1432.571) (-1430.573) [-1431.243] -- 0:00:54
227000 -- (-1434.282) (-1430.939) (-1436.453) [-1433.816] * (-1432.757) (-1431.280) [-1432.475] (-1435.092) -- 0:00:54
227500 -- [-1432.017] (-1434.642) (-1438.323) (-1434.206) * [-1434.296] (-1431.428) (-1432.915) (-1434.409) -- 0:00:54
228000 -- (-1435.159) (-1433.741) (-1434.502) [-1432.449] * (-1434.139) (-1433.043) (-1433.245) [-1433.710] -- 0:00:54
228500 -- (-1433.847) (-1441.514) (-1435.836) [-1432.387] * [-1433.885] (-1438.891) (-1433.952) (-1435.395) -- 0:00:54
229000 -- (-1432.671) (-1440.946) [-1434.281] (-1434.175) * (-1433.427) [-1434.967] (-1441.050) (-1433.412) -- 0:00:53
229500 -- (-1433.626) (-1432.985) [-1434.744] (-1432.740) * [-1429.703] (-1431.742) (-1437.117) (-1433.169) -- 0:00:53
230000 -- (-1431.523) (-1433.376) (-1436.824) [-1432.143] * (-1435.748) [-1432.534] (-1435.991) (-1433.688) -- 0:00:53
Average standard deviation of split frequencies: 0.011661
230500 -- [-1431.153] (-1434.546) (-1434.626) (-1435.543) * (-1438.546) (-1430.804) [-1435.697] (-1433.019) -- 0:00:53
231000 -- [-1434.504] (-1433.753) (-1435.412) (-1435.661) * (-1435.434) (-1435.323) (-1434.156) [-1432.529] -- 0:00:53
231500 -- [-1430.562] (-1434.702) (-1435.911) (-1434.142) * [-1434.907] (-1434.432) (-1436.270) (-1433.083) -- 0:00:53
232000 -- [-1430.696] (-1434.729) (-1432.400) (-1437.176) * [-1432.278] (-1432.967) (-1437.216) (-1435.263) -- 0:00:52
232500 -- (-1433.052) (-1437.186) [-1435.129] (-1434.634) * (-1433.886) [-1434.380] (-1436.398) (-1435.464) -- 0:00:52
233000 -- (-1434.165) (-1435.349) (-1433.365) [-1436.291] * (-1434.919) (-1437.034) (-1435.505) [-1434.710] -- 0:00:52
233500 -- (-1433.443) (-1433.478) (-1435.086) [-1434.846] * [-1431.877] (-1431.555) (-1435.839) (-1435.844) -- 0:00:52
234000 -- (-1433.487) (-1434.220) (-1434.586) [-1431.194] * [-1431.560] (-1431.059) (-1437.580) (-1433.785) -- 0:00:52
234500 -- (-1432.762) (-1431.346) (-1430.178) [-1433.872] * [-1432.286] (-1432.539) (-1435.182) (-1433.010) -- 0:00:52
235000 -- (-1433.598) (-1431.826) [-1431.737] (-1436.825) * (-1432.711) (-1433.960) [-1433.787] (-1431.855) -- 0:00:52
Average standard deviation of split frequencies: 0.012096
235500 -- (-1437.210) (-1433.238) (-1433.342) [-1435.571] * (-1432.556) (-1435.405) (-1438.476) [-1432.379] -- 0:00:51
236000 -- (-1432.909) (-1430.875) [-1434.999] (-1433.287) * (-1432.565) [-1432.694] (-1436.788) (-1434.953) -- 0:00:51
236500 -- (-1434.440) [-1431.192] (-1433.778) (-1432.726) * (-1433.303) [-1431.141] (-1434.279) (-1433.437) -- 0:00:51
237000 -- (-1435.016) [-1432.716] (-1432.823) (-1433.507) * [-1431.665] (-1433.434) (-1431.750) (-1437.372) -- 0:00:51
237500 -- (-1432.248) (-1431.451) (-1433.627) [-1433.609] * (-1432.509) (-1433.571) [-1432.099] (-1438.519) -- 0:00:51
238000 -- (-1431.758) (-1433.643) (-1432.604) [-1437.348] * (-1432.736) [-1432.217] (-1434.079) (-1432.740) -- 0:00:51
238500 -- [-1431.689] (-1434.420) (-1438.876) (-1431.961) * (-1433.195) (-1435.018) (-1432.186) [-1432.324] -- 0:00:51
239000 -- (-1434.218) (-1432.822) [-1431.831] (-1434.227) * (-1432.083) (-1433.398) (-1436.637) [-1435.693] -- 0:00:50
239500 -- (-1432.503) [-1433.639] (-1431.820) (-1435.110) * (-1432.442) (-1432.055) (-1432.879) [-1431.362] -- 0:00:50
240000 -- (-1432.618) (-1434.091) (-1431.299) [-1435.032] * [-1437.097] (-1433.249) (-1433.492) (-1435.635) -- 0:00:53
Average standard deviation of split frequencies: 0.011637
240500 -- [-1436.102] (-1434.454) (-1435.085) (-1433.253) * (-1432.511) [-1431.196] (-1434.012) (-1438.545) -- 0:00:53
241000 -- (-1434.252) (-1432.509) (-1434.165) [-1435.330] * (-1431.795) (-1432.063) [-1434.414] (-1434.108) -- 0:00:53
241500 -- [-1431.101] (-1435.215) (-1438.713) (-1437.648) * (-1434.162) (-1432.437) (-1433.892) [-1434.352] -- 0:00:53
242000 -- (-1433.409) [-1435.791] (-1434.517) (-1434.770) * (-1434.764) [-1433.486] (-1434.351) (-1431.358) -- 0:00:53
242500 -- (-1433.032) (-1440.126) (-1433.832) [-1433.407] * (-1438.289) (-1442.212) (-1434.668) [-1433.021] -- 0:00:53
243000 -- (-1433.561) (-1436.787) [-1432.732] (-1437.782) * (-1433.787) (-1432.549) [-1432.568] (-1431.003) -- 0:00:52
243500 -- (-1439.173) [-1431.174] (-1431.913) (-1436.171) * (-1436.954) (-1433.872) (-1432.165) [-1434.884] -- 0:00:52
244000 -- [-1432.779] (-1432.575) (-1434.435) (-1435.768) * (-1434.154) (-1431.119) [-1437.442] (-1435.806) -- 0:00:52
244500 -- (-1430.942) [-1434.060] (-1433.961) (-1435.548) * (-1431.900) (-1433.581) (-1431.821) [-1433.052] -- 0:00:52
245000 -- (-1430.917) [-1431.996] (-1435.626) (-1435.964) * (-1433.603) (-1433.578) [-1432.207] (-1435.199) -- 0:00:52
Average standard deviation of split frequencies: 0.012136
245500 -- (-1431.803) (-1433.247) [-1433.044] (-1434.340) * (-1431.226) (-1432.940) [-1430.672] (-1434.028) -- 0:00:52
246000 -- (-1431.971) [-1434.197] (-1433.836) (-1431.511) * [-1432.057] (-1430.970) (-1431.922) (-1433.791) -- 0:00:52
246500 -- (-1432.472) [-1431.251] (-1434.435) (-1431.825) * [-1431.065] (-1431.892) (-1436.265) (-1433.035) -- 0:00:51
247000 -- (-1432.864) (-1431.135) [-1433.847] (-1432.594) * (-1431.034) (-1432.075) (-1433.723) [-1431.565] -- 0:00:51
247500 -- (-1433.451) (-1433.974) (-1435.580) [-1433.187] * [-1432.644] (-1431.740) (-1435.280) (-1436.783) -- 0:00:51
248000 -- (-1433.096) [-1431.563] (-1433.247) (-1435.544) * [-1432.235] (-1439.158) (-1433.049) (-1434.955) -- 0:00:51
248500 -- (-1433.895) (-1435.360) (-1431.828) [-1434.347] * (-1431.759) (-1434.441) [-1432.516] (-1435.114) -- 0:00:51
249000 -- (-1432.787) (-1435.798) (-1434.571) [-1433.372] * (-1435.483) (-1433.660) [-1433.954] (-1434.420) -- 0:00:51
249500 -- (-1436.202) [-1431.706] (-1438.567) (-1433.285) * (-1439.095) (-1432.338) [-1433.982] (-1433.154) -- 0:00:51
250000 -- [-1433.543] (-1432.724) (-1433.260) (-1431.787) * (-1434.415) [-1435.318] (-1432.609) (-1434.476) -- 0:00:51
Average standard deviation of split frequencies: 0.010448
250500 -- [-1433.092] (-1432.702) (-1434.455) (-1433.730) * (-1434.318) (-1432.645) [-1432.484] (-1435.642) -- 0:00:50
251000 -- (-1433.469) [-1434.996] (-1433.573) (-1436.967) * (-1432.765) [-1431.837] (-1434.417) (-1436.112) -- 0:00:50
251500 -- (-1435.910) (-1433.379) [-1432.163] (-1436.873) * [-1431.747] (-1431.020) (-1438.983) (-1433.826) -- 0:00:50
252000 -- [-1433.559] (-1434.173) (-1434.150) (-1437.976) * (-1430.802) (-1435.717) [-1434.703] (-1433.509) -- 0:00:50
252500 -- (-1434.886) [-1433.631] (-1433.500) (-1433.652) * (-1433.372) [-1436.930] (-1432.769) (-1435.213) -- 0:00:50
253000 -- (-1436.312) (-1433.439) [-1434.418] (-1435.407) * [-1431.296] (-1435.767) (-1432.510) (-1435.498) -- 0:00:50
253500 -- (-1436.567) (-1433.839) [-1434.666] (-1434.462) * (-1433.490) (-1432.047) [-1433.937] (-1436.062) -- 0:00:50
254000 -- (-1435.866) [-1433.744] (-1434.886) (-1439.927) * (-1432.104) (-1432.185) (-1432.041) [-1438.852] -- 0:00:49
254500 -- (-1437.890) (-1430.509) (-1435.491) [-1434.997] * [-1432.229] (-1433.973) (-1435.166) (-1439.268) -- 0:00:52
255000 -- (-1436.709) [-1432.041] (-1437.366) (-1435.080) * (-1432.898) (-1432.298) (-1434.255) [-1437.337] -- 0:00:52
Average standard deviation of split frequencies: 0.010703
255500 -- (-1433.045) (-1434.848) (-1434.531) [-1433.932] * (-1432.927) (-1434.151) (-1434.433) [-1434.667] -- 0:00:52
256000 -- (-1433.893) (-1432.696) [-1433.059] (-1432.807) * (-1431.821) (-1433.124) (-1431.329) [-1434.350] -- 0:00:52
256500 -- [-1432.788] (-1431.428) (-1431.087) (-1433.746) * [-1430.776] (-1430.770) (-1436.414) (-1434.513) -- 0:00:52
257000 -- (-1433.536) (-1432.768) [-1433.368] (-1433.467) * (-1435.005) (-1434.810) (-1435.316) [-1431.385] -- 0:00:52
257500 -- (-1433.522) [-1433.087] (-1433.831) (-1432.581) * (-1431.996) (-1435.019) [-1438.659] (-1432.794) -- 0:00:51
258000 -- (-1433.674) (-1433.167) (-1435.834) [-1432.898] * (-1432.638) (-1432.467) (-1436.134) [-1432.774] -- 0:00:51
258500 -- (-1435.609) [-1433.952] (-1433.366) (-1434.354) * (-1432.203) (-1434.313) [-1434.461] (-1433.705) -- 0:00:51
259000 -- (-1433.248) (-1435.705) (-1432.192) [-1433.302] * [-1432.580] (-1438.407) (-1436.121) (-1433.074) -- 0:00:51
259500 -- (-1436.761) [-1436.269] (-1434.674) (-1433.659) * [-1432.767] (-1433.415) (-1432.072) (-1433.136) -- 0:00:51
260000 -- [-1437.503] (-1435.068) (-1436.228) (-1437.506) * (-1434.563) (-1431.727) [-1433.930] (-1432.887) -- 0:00:51
Average standard deviation of split frequencies: 0.012320
260500 -- (-1435.312) (-1434.720) (-1436.274) [-1431.513] * [-1437.212] (-1433.512) (-1431.551) (-1432.866) -- 0:00:51
261000 -- (-1436.823) (-1430.713) (-1433.608) [-1430.858] * (-1433.821) (-1432.096) [-1434.676] (-1432.866) -- 0:00:50
261500 -- (-1437.318) (-1432.855) [-1433.709] (-1434.257) * (-1433.071) (-1434.514) [-1436.312] (-1434.092) -- 0:00:50
262000 -- (-1435.808) [-1431.959] (-1433.279) (-1434.530) * [-1433.918] (-1435.686) (-1435.710) (-1435.978) -- 0:00:50
262500 -- (-1435.319) (-1432.850) (-1437.386) [-1436.188] * [-1433.776] (-1435.282) (-1434.208) (-1439.972) -- 0:00:50
263000 -- (-1433.638) (-1431.940) (-1437.178) [-1435.740] * [-1431.848] (-1436.074) (-1432.988) (-1437.511) -- 0:00:50
263500 -- (-1433.514) (-1431.942) (-1434.386) [-1432.348] * [-1433.274] (-1436.308) (-1431.731) (-1433.975) -- 0:00:50
264000 -- (-1433.449) [-1431.564] (-1437.239) (-1432.229) * (-1437.452) (-1435.045) [-1433.683] (-1433.882) -- 0:00:50
264500 -- [-1433.008] (-1432.769) (-1433.592) (-1433.802) * [-1433.586] (-1434.107) (-1431.552) (-1442.447) -- 0:00:50
265000 -- (-1432.409) (-1435.033) (-1433.826) [-1432.709] * (-1436.633) [-1431.881] (-1431.868) (-1438.854) -- 0:00:49
Average standard deviation of split frequencies: 0.011259
265500 -- [-1433.284] (-1432.190) (-1432.673) (-1435.341) * [-1434.994] (-1433.531) (-1432.336) (-1433.346) -- 0:00:49
266000 -- (-1433.547) (-1433.795) (-1432.672) [-1433.520] * (-1433.644) [-1432.552] (-1436.607) (-1434.288) -- 0:00:49
266500 -- (-1436.662) (-1433.638) (-1435.011) [-1439.195] * [-1432.440] (-1432.820) (-1431.841) (-1432.737) -- 0:00:49
267000 -- (-1432.694) (-1431.293) (-1433.088) [-1432.319] * (-1433.751) (-1436.126) (-1436.158) [-1434.544] -- 0:00:49
267500 -- (-1436.415) (-1432.715) (-1436.354) [-1433.694] * (-1435.593) [-1433.766] (-1432.132) (-1434.075) -- 0:00:49
268000 -- (-1434.838) (-1434.291) [-1432.882] (-1434.610) * (-1432.739) (-1430.463) [-1433.779] (-1435.497) -- 0:00:49
268500 -- (-1437.009) (-1431.454) [-1432.064] (-1435.521) * (-1436.137) [-1432.804] (-1434.836) (-1434.787) -- 0:00:49
269000 -- (-1434.389) (-1436.603) [-1434.840] (-1431.797) * [-1434.125] (-1430.568) (-1432.793) (-1433.851) -- 0:00:51
269500 -- (-1434.665) (-1433.608) [-1435.213] (-1437.828) * [-1432.214] (-1436.981) (-1434.755) (-1435.825) -- 0:00:51
270000 -- (-1435.002) (-1432.098) (-1436.151) [-1432.649] * [-1432.653] (-1435.878) (-1435.203) (-1438.362) -- 0:00:51
Average standard deviation of split frequencies: 0.010245
270500 -- (-1439.233) [-1433.837] (-1435.558) (-1433.393) * (-1434.605) (-1436.816) [-1434.500] (-1433.691) -- 0:00:51
271000 -- [-1433.718] (-1430.556) (-1435.304) (-1436.335) * [-1433.659] (-1434.018) (-1434.672) (-1433.744) -- 0:00:51
271500 -- (-1431.949) (-1431.182) [-1433.081] (-1436.966) * (-1434.029) (-1436.855) (-1434.417) [-1431.463] -- 0:00:50
272000 -- (-1433.649) [-1432.906] (-1437.030) (-1434.625) * [-1431.187] (-1433.803) (-1433.098) (-1433.269) -- 0:00:50
272500 -- (-1433.634) (-1433.084) [-1435.323] (-1432.455) * (-1432.686) (-1434.827) [-1430.488] (-1434.651) -- 0:00:50
273000 -- (-1433.033) (-1433.226) (-1435.279) [-1432.076] * (-1433.653) (-1434.242) [-1431.263] (-1433.083) -- 0:00:50
273500 -- (-1431.531) (-1432.954) [-1430.532] (-1433.009) * [-1435.518] (-1436.244) (-1433.229) (-1433.852) -- 0:00:50
274000 -- (-1432.494) (-1434.648) (-1432.771) [-1434.925] * (-1437.440) (-1434.664) (-1433.191) [-1433.257] -- 0:00:50
274500 -- (-1432.241) (-1437.235) (-1433.435) [-1431.510] * [-1431.614] (-1432.312) (-1438.293) (-1435.258) -- 0:00:50
275000 -- (-1436.448) [-1436.403] (-1436.422) (-1432.270) * [-1432.595] (-1432.758) (-1439.588) (-1433.380) -- 0:00:50
Average standard deviation of split frequencies: 0.010248
275500 -- (-1434.492) [-1433.259] (-1434.595) (-1433.658) * [-1433.404] (-1432.370) (-1440.898) (-1433.573) -- 0:00:49
276000 -- [-1431.907] (-1433.246) (-1433.135) (-1437.762) * [-1433.348] (-1431.633) (-1436.433) (-1434.680) -- 0:00:49
276500 -- [-1434.808] (-1434.803) (-1433.423) (-1437.193) * (-1434.382) (-1433.504) (-1434.299) [-1434.471] -- 0:00:49
277000 -- (-1433.539) [-1432.907] (-1433.456) (-1436.020) * (-1433.291) (-1432.571) (-1433.908) [-1435.115] -- 0:00:49
277500 -- [-1434.613] (-1433.053) (-1432.787) (-1434.225) * (-1432.857) (-1431.005) [-1433.416] (-1435.006) -- 0:00:49
278000 -- [-1432.793] (-1436.419) (-1435.107) (-1434.163) * (-1431.565) (-1431.439) [-1433.676] (-1433.168) -- 0:00:49
278500 -- [-1432.613] (-1436.162) (-1434.829) (-1432.907) * (-1434.431) (-1431.650) [-1437.740] (-1434.571) -- 0:00:49
279000 -- (-1434.683) (-1434.239) (-1436.344) [-1433.467] * (-1437.139) [-1432.500] (-1434.525) (-1433.882) -- 0:00:49
279500 -- [-1430.970] (-1436.567) (-1437.487) (-1434.823) * (-1434.980) (-1430.021) [-1431.228] (-1433.179) -- 0:00:48
280000 -- [-1432.723] (-1433.853) (-1436.990) (-1434.369) * (-1438.652) (-1431.046) (-1433.276) [-1435.709] -- 0:00:48
Average standard deviation of split frequencies: 0.010287
280500 -- [-1430.404] (-1434.345) (-1436.774) (-1434.727) * (-1431.980) [-1431.417] (-1438.105) (-1435.580) -- 0:00:48
281000 -- (-1434.818) [-1435.049] (-1434.861) (-1435.039) * (-1430.776) (-1432.019) (-1438.042) [-1432.592] -- 0:00:48
281500 -- (-1434.177) (-1434.269) (-1433.603) [-1435.415] * [-1433.021] (-1432.383) (-1434.971) (-1432.846) -- 0:00:48
282000 -- (-1435.229) (-1434.722) [-1434.362] (-1434.760) * (-1433.418) [-1435.020] (-1432.822) (-1433.431) -- 0:00:48
282500 -- (-1433.155) (-1435.029) (-1433.959) [-1430.324] * (-1434.712) [-1430.931] (-1433.356) (-1435.226) -- 0:00:48
283000 -- (-1434.017) (-1434.386) (-1434.318) [-1433.516] * (-1432.408) (-1431.686) [-1431.565] (-1435.370) -- 0:00:48
283500 -- [-1432.411] (-1435.181) (-1436.099) (-1432.360) * (-1432.331) (-1431.900) (-1433.186) [-1433.098] -- 0:00:50
284000 -- (-1442.427) (-1435.714) (-1439.147) [-1434.703] * (-1434.737) [-1432.420] (-1432.335) (-1434.036) -- 0:00:50
284500 -- (-1434.417) [-1432.887] (-1436.539) (-1434.596) * [-1432.421] (-1435.594) (-1433.412) (-1431.529) -- 0:00:50
285000 -- (-1434.699) (-1433.620) [-1435.515] (-1436.778) * [-1431.630] (-1434.824) (-1433.887) (-1433.985) -- 0:00:50
Average standard deviation of split frequencies: 0.008532
285500 -- (-1433.876) [-1431.759] (-1435.446) (-1435.943) * (-1439.114) [-1432.940] (-1433.648) (-1431.612) -- 0:00:50
286000 -- (-1437.001) (-1434.147) [-1432.476] (-1440.922) * [-1435.932] (-1437.971) (-1433.237) (-1435.319) -- 0:00:49
286500 -- (-1435.081) (-1432.870) [-1432.939] (-1437.549) * (-1434.870) [-1435.396] (-1435.720) (-1435.576) -- 0:00:49
287000 -- [-1434.543] (-1431.077) (-1430.726) (-1435.398) * (-1438.440) (-1432.259) [-1432.786] (-1434.559) -- 0:00:49
287500 -- (-1432.889) (-1434.574) (-1433.460) [-1432.636] * [-1437.528] (-1432.168) (-1432.616) (-1430.880) -- 0:00:49
288000 -- [-1432.747] (-1432.175) (-1441.860) (-1435.801) * (-1436.715) (-1433.933) (-1433.863) [-1438.955] -- 0:00:49
288500 -- [-1434.250] (-1436.263) (-1438.250) (-1434.527) * [-1433.743] (-1434.291) (-1432.784) (-1439.162) -- 0:00:49
289000 -- (-1437.740) (-1434.033) (-1438.575) [-1433.911] * (-1433.820) (-1432.065) (-1434.172) [-1432.283] -- 0:00:49
289500 -- (-1435.836) (-1434.173) (-1439.067) [-1433.591] * (-1432.042) (-1430.742) (-1431.788) [-1433.143] -- 0:00:49
290000 -- (-1438.580) [-1434.221] (-1437.454) (-1435.696) * (-1433.877) (-1431.552) (-1435.478) [-1433.738] -- 0:00:48
Average standard deviation of split frequencies: 0.007893
290500 -- (-1437.435) [-1434.885] (-1436.956) (-1436.105) * (-1433.804) [-1433.192] (-1432.922) (-1433.825) -- 0:00:48
291000 -- [-1435.371] (-1432.316) (-1436.181) (-1437.423) * (-1434.186) (-1432.864) (-1433.445) [-1433.201] -- 0:00:48
291500 -- [-1432.557] (-1434.450) (-1434.706) (-1433.909) * (-1433.555) (-1433.164) [-1433.668] (-1434.488) -- 0:00:48
292000 -- [-1433.015] (-1436.093) (-1432.525) (-1436.115) * (-1436.393) (-1436.413) [-1430.108] (-1432.472) -- 0:00:48
292500 -- [-1435.368] (-1438.522) (-1433.235) (-1441.207) * (-1437.379) (-1436.011) (-1430.304) [-1432.956] -- 0:00:48
293000 -- (-1434.192) (-1436.279) (-1435.126) [-1432.808] * (-1433.484) (-1440.103) (-1430.577) [-1434.016] -- 0:00:48
293500 -- (-1431.540) (-1434.510) (-1433.472) [-1433.357] * (-1432.676) [-1432.333] (-1432.978) (-1444.678) -- 0:00:48
294000 -- (-1435.387) (-1437.078) (-1433.046) [-1436.109] * (-1434.307) [-1436.150] (-1431.768) (-1431.558) -- 0:00:48
294500 -- [-1435.792] (-1437.494) (-1433.205) (-1433.317) * (-1434.315) [-1435.190] (-1433.447) (-1430.923) -- 0:00:47
295000 -- (-1434.506) [-1434.622] (-1433.657) (-1433.019) * (-1433.204) [-1434.666] (-1432.596) (-1432.171) -- 0:00:47
Average standard deviation of split frequencies: 0.009655
295500 -- [-1432.366] (-1435.525) (-1434.116) (-1433.018) * [-1431.176] (-1440.233) (-1433.473) (-1432.697) -- 0:00:47
296000 -- (-1435.564) [-1433.072] (-1435.052) (-1434.311) * (-1435.279) (-1431.848) (-1433.981) [-1432.217] -- 0:00:47
296500 -- (-1432.947) [-1435.854] (-1431.196) (-1432.519) * (-1437.085) (-1432.485) (-1433.248) [-1432.898] -- 0:00:47
297000 -- [-1431.683] (-1434.750) (-1435.681) (-1431.408) * (-1434.052) [-1432.465] (-1432.935) (-1433.266) -- 0:00:47
297500 -- (-1433.944) (-1439.985) [-1433.242] (-1432.179) * (-1433.045) (-1433.507) [-1432.484] (-1431.278) -- 0:00:47
298000 -- (-1434.445) (-1440.231) (-1433.486) [-1434.116] * (-1431.932) (-1433.216) [-1430.341] (-1432.498) -- 0:00:49
298500 -- (-1432.401) (-1432.922) (-1439.087) [-1431.764] * (-1436.839) [-1433.263] (-1434.159) (-1432.333) -- 0:00:49
299000 -- (-1435.104) (-1432.745) [-1431.294] (-1436.227) * [-1437.045] (-1433.478) (-1432.485) (-1432.598) -- 0:00:49
299500 -- (-1433.436) [-1434.406] (-1434.134) (-1433.043) * (-1431.378) (-1433.880) [-1430.373] (-1431.932) -- 0:00:49
300000 -- (-1430.712) [-1435.169] (-1437.076) (-1432.031) * (-1433.794) (-1434.376) [-1431.238] (-1431.553) -- 0:00:48
Average standard deviation of split frequencies: 0.010348
300500 -- [-1432.761] (-1436.168) (-1432.087) (-1435.524) * (-1434.034) (-1433.325) (-1432.157) [-1434.029] -- 0:00:48
301000 -- (-1434.648) (-1433.078) [-1430.657] (-1432.507) * (-1434.315) [-1433.499] (-1431.231) (-1430.705) -- 0:00:48
301500 -- (-1433.987) [-1435.298] (-1435.110) (-1432.517) * (-1433.944) (-1432.732) [-1432.773] (-1438.020) -- 0:00:48
302000 -- (-1433.229) (-1435.942) (-1440.747) [-1433.452] * (-1433.977) [-1433.917] (-1430.631) (-1431.660) -- 0:00:48
302500 -- (-1434.045) (-1435.047) (-1434.702) [-1434.335] * (-1432.722) (-1436.518) [-1430.726] (-1436.718) -- 0:00:48
303000 -- (-1435.238) (-1438.998) (-1436.273) [-1431.004] * (-1434.880) (-1441.329) (-1434.345) [-1432.554] -- 0:00:48
303500 -- (-1435.159) [-1438.234] (-1434.223) (-1434.699) * [-1436.909] (-1434.384) (-1431.197) (-1433.848) -- 0:00:48
304000 -- [-1432.822] (-1433.363) (-1434.798) (-1434.302) * (-1435.387) (-1435.740) [-1430.781] (-1431.660) -- 0:00:48
304500 -- (-1433.105) (-1435.618) (-1433.830) [-1435.137] * [-1434.792] (-1441.269) (-1430.940) (-1432.662) -- 0:00:47
305000 -- (-1430.921) [-1434.645] (-1434.308) (-1437.390) * (-1434.207) (-1434.431) (-1433.016) [-1434.304] -- 0:00:47
Average standard deviation of split frequencies: 0.009153
305500 -- (-1434.687) [-1435.976] (-1433.673) (-1432.438) * (-1434.365) (-1432.163) (-1433.296) [-1431.515] -- 0:00:47
306000 -- (-1433.703) (-1438.967) (-1434.249) [-1431.530] * (-1432.425) (-1433.032) [-1434.571] (-1433.454) -- 0:00:47
306500 -- (-1431.977) (-1433.901) (-1434.743) [-1432.094] * (-1432.110) [-1430.718] (-1433.453) (-1432.211) -- 0:00:47
307000 -- (-1436.675) (-1432.458) [-1431.712] (-1435.183) * (-1432.191) (-1433.013) [-1433.230] (-1433.015) -- 0:00:47
307500 -- [-1436.349] (-1430.286) (-1434.746) (-1436.420) * (-1432.348) [-1434.876] (-1435.304) (-1437.548) -- 0:00:47
308000 -- (-1434.008) (-1433.014) (-1434.921) [-1435.358] * (-1432.054) (-1433.282) [-1433.662] (-1434.203) -- 0:00:47
308500 -- (-1435.240) (-1431.745) (-1434.072) [-1433.963] * (-1435.051) (-1432.291) [-1433.407] (-1431.353) -- 0:00:47
309000 -- (-1434.722) [-1432.825] (-1435.542) (-1433.801) * (-1434.677) (-1433.476) [-1432.578] (-1435.729) -- 0:00:46
309500 -- [-1433.035] (-1438.748) (-1443.234) (-1435.860) * (-1431.985) (-1434.489) [-1433.239] (-1435.710) -- 0:00:46
310000 -- (-1437.580) (-1435.105) (-1434.748) [-1432.899] * (-1429.897) (-1436.000) [-1433.771] (-1433.815) -- 0:00:46
Average standard deviation of split frequencies: 0.009408
310500 -- (-1432.390) (-1434.247) [-1432.459] (-1432.076) * (-1435.191) [-1432.933] (-1435.296) (-1433.442) -- 0:00:46
311000 -- [-1431.757] (-1431.694) (-1433.013) (-1431.101) * [-1435.420] (-1433.866) (-1442.419) (-1431.242) -- 0:00:46
311500 -- (-1435.252) (-1433.525) (-1434.923) [-1431.263] * (-1432.673) (-1434.241) [-1437.521] (-1435.438) -- 0:00:48
312000 -- (-1435.176) (-1433.022) (-1432.558) [-1431.513] * [-1433.612] (-1437.207) (-1434.789) (-1435.574) -- 0:00:48
312500 -- [-1434.435] (-1430.361) (-1434.663) (-1430.901) * (-1431.030) (-1438.591) [-1433.933] (-1434.397) -- 0:00:48
313000 -- (-1433.258) [-1434.049] (-1435.194) (-1431.749) * [-1434.087] (-1436.912) (-1433.165) (-1432.770) -- 0:00:48
313500 -- (-1433.386) (-1431.477) [-1432.876] (-1431.896) * (-1431.911) [-1435.541] (-1431.561) (-1432.633) -- 0:00:48
314000 -- (-1434.193) [-1435.573] (-1439.603) (-1432.101) * (-1431.373) (-1434.845) (-1434.837) [-1429.989] -- 0:00:48
314500 -- [-1435.394] (-1433.326) (-1435.447) (-1437.060) * (-1431.565) (-1434.770) [-1431.446] (-1434.245) -- 0:00:47
315000 -- (-1431.246) (-1432.068) (-1433.811) [-1434.524] * (-1430.875) (-1433.198) [-1430.363] (-1433.832) -- 0:00:47
Average standard deviation of split frequencies: 0.009547
315500 -- (-1431.072) [-1435.966] (-1432.200) (-1434.583) * [-1434.578] (-1437.257) (-1433.024) (-1433.561) -- 0:00:47
316000 -- (-1432.974) [-1435.876] (-1432.656) (-1434.753) * (-1439.843) [-1434.557] (-1433.000) (-1432.990) -- 0:00:47
316500 -- (-1434.552) [-1435.658] (-1434.207) (-1433.419) * (-1439.162) (-1436.103) (-1434.826) [-1433.084] -- 0:00:47
317000 -- (-1431.897) (-1436.131) [-1431.571] (-1435.580) * (-1437.946) [-1434.941] (-1431.846) (-1431.596) -- 0:00:47
317500 -- (-1432.181) (-1439.834) [-1433.503] (-1442.485) * (-1432.806) [-1432.711] (-1432.713) (-1433.339) -- 0:00:47
318000 -- (-1431.322) [-1433.272] (-1430.725) (-1437.297) * [-1433.574] (-1434.776) (-1438.610) (-1431.817) -- 0:00:47
318500 -- (-1433.776) (-1434.934) [-1433.756] (-1431.559) * (-1432.779) (-1435.052) (-1438.705) [-1432.736] -- 0:00:47
319000 -- (-1432.871) [-1432.838] (-1431.485) (-1433.449) * (-1432.889) [-1433.719] (-1437.851) (-1434.427) -- 0:00:46
319500 -- [-1432.663] (-1436.490) (-1432.656) (-1431.845) * [-1433.859] (-1436.560) (-1435.836) (-1434.750) -- 0:00:46
320000 -- [-1434.282] (-1432.282) (-1438.278) (-1432.317) * [-1433.506] (-1435.057) (-1437.065) (-1434.599) -- 0:00:46
Average standard deviation of split frequencies: 0.009212
320500 -- (-1431.828) [-1434.106] (-1433.018) (-1431.854) * (-1436.316) [-1433.510] (-1433.831) (-1433.209) -- 0:00:46
321000 -- (-1435.553) (-1433.094) (-1433.411) [-1430.612] * (-1435.577) (-1436.852) [-1434.169] (-1432.488) -- 0:00:46
321500 -- (-1436.139) (-1435.193) (-1431.713) [-1431.532] * (-1433.223) (-1433.649) (-1430.796) [-1433.262] -- 0:00:46
322000 -- (-1433.581) (-1433.374) (-1434.203) [-1432.156] * (-1433.744) (-1433.975) (-1432.789) [-1432.616] -- 0:00:46
322500 -- [-1432.201] (-1430.911) (-1437.056) (-1437.137) * (-1434.319) (-1433.443) [-1431.538] (-1430.653) -- 0:00:46
323000 -- (-1433.542) (-1432.485) (-1435.195) [-1432.754] * (-1431.856) [-1432.538] (-1431.964) (-1433.010) -- 0:00:46
323500 -- (-1432.558) (-1435.355) (-1434.944) [-1432.578] * [-1433.278] (-1434.017) (-1432.170) (-1438.986) -- 0:00:46
324000 -- (-1433.296) (-1433.413) (-1434.473) [-1435.612] * (-1436.711) (-1438.201) [-1432.448] (-1435.333) -- 0:00:45
324500 -- (-1434.255) [-1432.872] (-1435.021) (-1433.893) * [-1435.549] (-1437.285) (-1433.168) (-1438.740) -- 0:00:45
325000 -- (-1431.147) (-1432.071) (-1432.998) [-1433.308] * (-1434.305) [-1436.703] (-1434.390) (-1433.453) -- 0:00:45
Average standard deviation of split frequencies: 0.009255
325500 -- (-1436.149) (-1434.867) (-1433.324) [-1432.917] * (-1432.261) [-1435.518] (-1431.861) (-1432.131) -- 0:00:45
326000 -- (-1434.201) [-1433.057] (-1440.268) (-1432.074) * (-1434.389) (-1437.087) (-1431.491) [-1432.656] -- 0:00:47
326500 -- (-1432.898) [-1432.592] (-1439.839) (-1435.461) * (-1433.232) (-1437.632) [-1433.124] (-1430.883) -- 0:00:47
327000 -- (-1436.331) [-1435.976] (-1435.139) (-1433.865) * (-1432.825) [-1434.001] (-1433.287) (-1435.047) -- 0:00:47
327500 -- (-1431.890) [-1433.004] (-1433.280) (-1435.266) * (-1434.915) (-1433.847) [-1434.943] (-1435.213) -- 0:00:47
328000 -- [-1432.420] (-1434.426) (-1435.361) (-1433.897) * (-1434.430) [-1431.266] (-1435.154) (-1439.647) -- 0:00:47
328500 -- (-1430.776) (-1434.333) [-1433.864] (-1432.241) * (-1432.738) (-1433.348) (-1433.621) [-1430.914] -- 0:00:47
329000 -- (-1432.818) (-1434.926) [-1434.504] (-1433.289) * (-1434.361) [-1431.856] (-1431.438) (-1432.521) -- 0:00:46
329500 -- (-1429.786) (-1433.352) (-1434.743) [-1433.795] * (-1432.971) (-1432.063) (-1433.996) [-1435.789] -- 0:00:46
330000 -- [-1433.609] (-1431.584) (-1434.161) (-1430.925) * [-1438.593] (-1431.693) (-1434.465) (-1441.416) -- 0:00:46
Average standard deviation of split frequencies: 0.009789
330500 -- (-1434.005) (-1439.415) [-1433.405] (-1434.221) * (-1435.855) [-1433.553] (-1434.810) (-1434.201) -- 0:00:46
331000 -- (-1433.271) [-1434.227] (-1432.853) (-1432.490) * [-1435.299] (-1433.386) (-1433.132) (-1435.588) -- 0:00:46
331500 -- [-1432.375] (-1433.690) (-1433.613) (-1432.416) * (-1435.041) (-1432.974) [-1434.104] (-1435.132) -- 0:00:46
332000 -- [-1432.108] (-1433.622) (-1432.550) (-1441.956) * (-1434.359) (-1434.453) [-1430.701] (-1433.660) -- 0:00:46
332500 -- (-1433.098) (-1434.641) [-1433.974] (-1432.815) * (-1433.286) (-1434.804) (-1431.706) [-1433.689] -- 0:00:46
333000 -- (-1436.987) (-1432.179) (-1432.963) [-1433.831] * (-1437.757) (-1440.912) [-1431.826] (-1431.501) -- 0:00:46
333500 -- (-1434.073) (-1433.393) (-1437.984) [-1435.653] * [-1434.777] (-1439.331) (-1432.784) (-1432.779) -- 0:00:45
334000 -- (-1434.881) (-1438.455) [-1432.308] (-1434.571) * (-1434.692) [-1435.426] (-1435.800) (-1433.034) -- 0:00:45
334500 -- [-1432.114] (-1432.030) (-1432.902) (-1436.135) * [-1433.329] (-1435.580) (-1436.162) (-1434.132) -- 0:00:45
335000 -- (-1432.928) (-1434.674) (-1435.780) [-1434.144] * (-1434.414) (-1434.934) [-1435.435] (-1434.879) -- 0:00:45
Average standard deviation of split frequencies: 0.009914
335500 -- (-1435.173) (-1433.114) (-1433.268) [-1433.920] * [-1435.042] (-1434.281) (-1436.101) (-1436.543) -- 0:00:45
336000 -- [-1434.345] (-1432.582) (-1435.297) (-1432.632) * (-1437.649) (-1437.684) (-1433.126) [-1433.745] -- 0:00:45
336500 -- (-1434.224) [-1433.354] (-1432.736) (-1434.198) * (-1436.252) (-1433.587) (-1431.478) [-1432.030] -- 0:00:45
337000 -- (-1433.847) (-1431.502) [-1432.210] (-1434.643) * (-1434.632) (-1433.317) [-1433.118] (-1433.779) -- 0:00:45
337500 -- (-1432.177) (-1433.478) (-1434.745) [-1431.213] * [-1432.641] (-1430.964) (-1432.516) (-1433.674) -- 0:00:45
338000 -- (-1432.760) [-1432.665] (-1432.673) (-1431.625) * (-1433.834) (-1435.721) (-1433.234) [-1434.859] -- 0:00:45
338500 -- (-1431.286) (-1432.464) (-1430.684) [-1431.641] * (-1436.278) (-1430.642) (-1432.822) [-1433.318] -- 0:00:44
339000 -- [-1432.466] (-1434.108) (-1433.546) (-1432.961) * [-1432.899] (-1432.757) (-1433.679) (-1435.370) -- 0:00:44
339500 -- (-1434.973) (-1436.401) [-1431.272] (-1432.870) * (-1433.437) [-1431.850] (-1435.285) (-1435.842) -- 0:00:44
340000 -- (-1431.772) (-1436.322) [-1432.548] (-1433.307) * (-1433.009) [-1430.916] (-1434.294) (-1432.986) -- 0:00:44
Average standard deviation of split frequencies: 0.010055
340500 -- (-1435.123) (-1434.062) (-1432.598) [-1433.053] * (-1435.873) [-1433.452] (-1432.458) (-1433.027) -- 0:00:44
341000 -- [-1434.393] (-1431.487) (-1435.920) (-1432.163) * (-1437.060) (-1432.893) [-1431.219] (-1433.356) -- 0:00:46
341500 -- (-1437.276) [-1431.744] (-1434.100) (-1431.783) * (-1436.763) (-1432.083) [-1433.686] (-1432.634) -- 0:00:46
342000 -- (-1432.533) (-1434.751) (-1433.745) [-1431.827] * (-1435.505) (-1431.190) (-1432.288) [-1432.445] -- 0:00:46
342500 -- (-1432.518) (-1433.310) [-1434.429] (-1431.747) * (-1434.662) (-1435.957) [-1434.271] (-1432.638) -- 0:00:46
343000 -- (-1435.218) (-1432.519) [-1432.400] (-1431.912) * (-1435.820) (-1433.179) (-1434.836) [-1432.869] -- 0:00:45
343500 -- (-1433.077) [-1433.773] (-1434.007) (-1436.028) * (-1433.787) [-1434.921] (-1432.942) (-1433.451) -- 0:00:45
344000 -- (-1432.700) (-1430.496) [-1435.791] (-1433.695) * (-1433.040) [-1435.523] (-1434.697) (-1433.331) -- 0:00:45
344500 -- (-1430.871) (-1432.279) (-1439.192) [-1433.910] * (-1434.647) (-1435.420) (-1433.345) [-1435.346] -- 0:00:45
345000 -- [-1432.085] (-1435.241) (-1437.088) (-1433.154) * (-1433.679) (-1434.033) (-1435.090) [-1433.007] -- 0:00:45
Average standard deviation of split frequencies: 0.010559
345500 -- [-1431.760] (-1438.282) (-1433.173) (-1433.716) * (-1431.712) (-1433.698) [-1430.867] (-1433.812) -- 0:00:45
346000 -- (-1434.707) (-1442.182) [-1433.530] (-1432.686) * (-1436.883) (-1433.580) [-1433.260] (-1432.999) -- 0:00:45
346500 -- [-1435.426] (-1435.712) (-1433.628) (-1436.465) * (-1430.700) (-1435.064) [-1434.064] (-1439.405) -- 0:00:45
347000 -- (-1435.187) [-1435.828] (-1435.289) (-1433.967) * (-1434.388) (-1434.695) (-1431.810) [-1434.627] -- 0:00:45
347500 -- (-1432.817) [-1435.480] (-1435.400) (-1431.932) * (-1434.135) (-1431.504) (-1431.749) [-1433.590] -- 0:00:45
348000 -- [-1433.763] (-1435.752) (-1431.499) (-1433.448) * (-1433.407) (-1432.508) [-1433.292] (-1435.201) -- 0:00:44
348500 -- [-1433.623] (-1437.906) (-1431.346) (-1430.086) * (-1434.651) (-1432.956) [-1436.170] (-1432.598) -- 0:00:44
349000 -- (-1434.256) (-1438.554) [-1433.043] (-1432.619) * (-1438.354) (-1430.890) [-1434.488] (-1431.248) -- 0:00:44
349500 -- (-1434.037) [-1435.090] (-1431.826) (-1432.845) * (-1432.583) [-1433.617] (-1433.780) (-1431.619) -- 0:00:44
350000 -- (-1435.829) (-1433.696) [-1435.988] (-1431.213) * (-1436.145) [-1433.712] (-1432.113) (-1431.147) -- 0:00:44
Average standard deviation of split frequencies: 0.009769
350500 -- (-1434.440) (-1432.839) (-1434.074) [-1435.242] * (-1438.907) (-1431.683) [-1436.739] (-1432.868) -- 0:00:44
351000 -- (-1431.772) (-1432.947) [-1431.802] (-1432.371) * [-1434.670] (-1430.700) (-1434.007) (-1433.176) -- 0:00:44
351500 -- [-1433.161] (-1434.165) (-1436.171) (-1433.278) * (-1432.675) [-1433.243] (-1434.396) (-1433.251) -- 0:00:44
352000 -- [-1432.929] (-1435.318) (-1432.117) (-1433.533) * (-1435.203) [-1433.553] (-1432.475) (-1433.278) -- 0:00:44
352500 -- [-1431.219] (-1432.951) (-1436.624) (-1432.150) * (-1434.621) (-1432.893) (-1433.046) [-1432.602] -- 0:00:44
353000 -- [-1434.991] (-1433.333) (-1433.874) (-1434.065) * (-1433.336) (-1433.642) (-1434.979) [-1433.251] -- 0:00:43
353500 -- [-1430.342] (-1431.887) (-1434.046) (-1435.443) * [-1434.729] (-1433.985) (-1432.900) (-1436.107) -- 0:00:43
354000 -- (-1435.861) (-1435.189) (-1432.208) [-1437.018] * (-1432.086) (-1432.138) (-1431.952) [-1434.304] -- 0:00:43
354500 -- (-1438.143) (-1435.141) (-1434.465) [-1431.959] * (-1432.864) [-1432.435] (-1433.994) (-1434.373) -- 0:00:43
355000 -- (-1434.319) (-1433.950) (-1432.421) [-1432.136] * (-1430.415) (-1434.395) (-1433.388) [-1432.057] -- 0:00:43
Average standard deviation of split frequencies: 0.009622
355500 -- (-1433.954) (-1434.636) [-1435.045] (-1430.260) * (-1433.371) (-1434.753) (-1430.048) [-1433.452] -- 0:00:45
356000 -- (-1433.765) (-1435.264) [-1433.711] (-1433.385) * (-1434.972) (-1434.132) (-1433.888) [-1431.545] -- 0:00:45
356500 -- (-1433.926) [-1433.416] (-1436.655) (-1432.109) * [-1434.306] (-1433.762) (-1433.821) (-1431.944) -- 0:00:45
357000 -- (-1436.477) (-1433.630) [-1433.159] (-1430.938) * (-1431.817) (-1432.623) [-1431.877] (-1431.551) -- 0:00:45
357500 -- (-1437.177) [-1434.452] (-1434.801) (-1431.195) * (-1430.137) [-1432.410] (-1433.476) (-1437.518) -- 0:00:44
358000 -- (-1434.640) (-1434.259) (-1435.036) [-1432.192] * (-1433.216) (-1434.955) [-1433.399] (-1434.370) -- 0:00:44
358500 -- (-1436.531) [-1433.684] (-1435.966) (-1437.099) * (-1433.057) [-1432.821] (-1435.272) (-1435.926) -- 0:00:44
359000 -- (-1436.517) (-1434.277) (-1434.915) [-1434.599] * [-1430.895] (-1434.026) (-1436.521) (-1434.279) -- 0:00:44
359500 -- (-1436.489) [-1433.647] (-1439.615) (-1436.329) * [-1431.326] (-1432.930) (-1434.770) (-1436.404) -- 0:00:44
360000 -- (-1438.012) (-1433.603) [-1434.178] (-1430.519) * (-1433.233) (-1432.848) (-1436.351) [-1431.608] -- 0:00:44
Average standard deviation of split frequencies: 0.009846
360500 -- (-1438.226) (-1433.405) (-1432.487) [-1430.315] * [-1431.431] (-1436.309) (-1434.463) (-1434.108) -- 0:00:44
361000 -- (-1438.122) [-1429.676] (-1432.937) (-1433.015) * (-1434.765) (-1434.680) [-1435.962] (-1439.350) -- 0:00:44
361500 -- (-1434.592) [-1432.717] (-1433.309) (-1433.153) * (-1434.208) [-1437.375] (-1434.425) (-1434.132) -- 0:00:44
362000 -- [-1435.089] (-1435.748) (-1432.951) (-1431.292) * (-1436.954) [-1430.420] (-1433.295) (-1431.903) -- 0:00:44
362500 -- [-1432.886] (-1432.812) (-1433.420) (-1432.657) * (-1433.962) [-1431.912] (-1433.240) (-1434.526) -- 0:00:43
363000 -- (-1432.813) (-1434.320) [-1433.525] (-1434.918) * (-1431.115) [-1430.890] (-1433.741) (-1434.596) -- 0:00:43
363500 -- [-1433.592] (-1432.169) (-1433.609) (-1436.306) * (-1431.885) (-1431.195) (-1436.921) [-1432.757] -- 0:00:43
364000 -- [-1433.289] (-1432.363) (-1433.226) (-1432.848) * (-1433.603) (-1431.671) (-1434.040) [-1432.652] -- 0:00:43
364500 -- (-1433.226) (-1433.509) (-1436.250) [-1432.995] * (-1433.125) (-1434.901) [-1430.755] (-1435.673) -- 0:00:43
365000 -- [-1431.950] (-1435.709) (-1434.507) (-1434.193) * (-1434.098) [-1431.680] (-1432.405) (-1431.807) -- 0:00:43
Average standard deviation of split frequencies: 0.010218
365500 -- (-1432.800) (-1433.178) [-1433.567] (-1436.683) * (-1434.661) (-1433.375) (-1432.720) [-1432.771] -- 0:00:43
366000 -- (-1437.619) [-1434.625] (-1435.641) (-1435.426) * (-1434.653) (-1436.039) [-1431.982] (-1433.936) -- 0:00:43
366500 -- (-1436.254) (-1434.953) [-1435.005] (-1432.860) * [-1433.404] (-1435.891) (-1432.882) (-1436.117) -- 0:00:43
367000 -- (-1435.979) (-1435.539) [-1432.392] (-1433.355) * [-1433.002] (-1432.999) (-1435.469) (-1441.071) -- 0:00:43
367500 -- (-1434.720) (-1433.014) (-1432.635) [-1433.857] * (-1430.805) (-1432.280) [-1430.230] (-1439.109) -- 0:00:43
368000 -- (-1434.474) (-1432.543) [-1431.601] (-1433.583) * (-1435.295) [-1436.510] (-1433.312) (-1437.110) -- 0:00:42
368500 -- [-1436.524] (-1435.326) (-1432.959) (-1433.754) * [-1431.927] (-1434.519) (-1435.306) (-1435.555) -- 0:00:42
369000 -- (-1435.858) [-1435.718] (-1434.452) (-1434.204) * [-1434.802] (-1434.950) (-1433.616) (-1432.779) -- 0:00:42
369500 -- [-1431.621] (-1435.647) (-1435.560) (-1435.727) * (-1437.330) [-1430.780] (-1431.322) (-1433.912) -- 0:00:42
370000 -- [-1433.773] (-1433.371) (-1434.222) (-1435.476) * (-1434.181) [-1430.855] (-1432.344) (-1433.773) -- 0:00:42
Average standard deviation of split frequencies: 0.010598
370500 -- [-1433.209] (-1431.083) (-1433.851) (-1433.444) * (-1434.033) (-1434.392) (-1433.458) [-1432.521] -- 0:00:44
371000 -- [-1434.849] (-1433.438) (-1438.033) (-1433.445) * (-1431.593) [-1431.597] (-1433.554) (-1434.657) -- 0:00:44
371500 -- (-1433.133) (-1432.887) (-1437.264) [-1433.374] * [-1432.426] (-1433.728) (-1430.769) (-1432.306) -- 0:00:43
372000 -- (-1431.423) [-1431.799] (-1435.789) (-1432.697) * [-1430.791] (-1435.563) (-1430.025) (-1432.327) -- 0:00:43
372500 -- (-1434.018) [-1434.332] (-1437.125) (-1434.053) * (-1431.049) (-1436.861) [-1430.664] (-1432.337) -- 0:00:43
373000 -- (-1436.048) [-1436.981] (-1434.106) (-1433.249) * (-1435.176) [-1435.900] (-1432.239) (-1439.400) -- 0:00:43
373500 -- [-1434.496] (-1437.223) (-1432.597) (-1433.141) * (-1442.347) [-1434.058] (-1429.781) (-1434.789) -- 0:00:43
374000 -- (-1431.756) [-1432.353] (-1431.615) (-1433.333) * (-1434.089) (-1432.836) (-1433.534) [-1434.439] -- 0:00:43
374500 -- (-1433.659) (-1435.604) [-1432.616] (-1436.574) * (-1433.579) (-1442.699) (-1433.917) [-1432.873] -- 0:00:43
375000 -- (-1434.257) [-1432.736] (-1435.276) (-1437.501) * (-1435.474) (-1433.816) [-1433.409] (-1432.821) -- 0:00:43
Average standard deviation of split frequencies: 0.010197
375500 -- (-1435.220) (-1434.021) [-1430.674] (-1434.523) * (-1434.289) (-1432.329) [-1434.199] (-1434.294) -- 0:00:43
376000 -- (-1432.692) (-1433.425) [-1430.513] (-1432.535) * [-1433.074] (-1433.873) (-1432.394) (-1434.379) -- 0:00:43
376500 -- (-1432.047) (-1436.471) (-1433.645) [-1433.635] * (-1434.428) (-1435.286) [-1431.405] (-1432.830) -- 0:00:43
377000 -- (-1432.486) (-1436.068) [-1435.777] (-1433.779) * (-1438.301) (-1432.373) (-1434.799) [-1434.152] -- 0:00:42
377500 -- (-1433.826) [-1434.143] (-1435.316) (-1433.071) * (-1435.588) (-1435.243) [-1433.345] (-1439.589) -- 0:00:42
378000 -- (-1433.869) (-1434.076) [-1434.666] (-1434.238) * (-1437.202) (-1434.218) (-1431.882) [-1431.223] -- 0:00:42
378500 -- [-1433.168] (-1433.246) (-1431.978) (-1436.884) * (-1432.319) (-1430.190) [-1432.902] (-1434.410) -- 0:00:42
379000 -- [-1432.588] (-1434.120) (-1431.663) (-1437.447) * [-1433.344] (-1432.197) (-1430.576) (-1435.040) -- 0:00:42
379500 -- [-1430.976] (-1434.558) (-1432.853) (-1438.797) * (-1434.295) [-1432.466] (-1431.257) (-1434.547) -- 0:00:42
380000 -- (-1432.446) [-1432.302] (-1431.907) (-1435.034) * (-1433.612) [-1431.861] (-1435.286) (-1431.561) -- 0:00:42
Average standard deviation of split frequencies: 0.011145
380500 -- (-1434.111) (-1433.590) [-1434.282] (-1432.952) * [-1433.062] (-1432.816) (-1434.861) (-1432.446) -- 0:00:42
381000 -- (-1435.504) [-1432.674] (-1430.112) (-1433.887) * [-1435.381] (-1435.274) (-1435.414) (-1430.663) -- 0:00:42
381500 -- [-1430.455] (-1436.954) (-1433.395) (-1432.438) * [-1431.717] (-1434.782) (-1432.520) (-1431.991) -- 0:00:42
382000 -- (-1434.201) (-1436.244) (-1438.706) [-1433.780] * (-1438.111) (-1435.832) [-1432.275] (-1434.161) -- 0:00:42
382500 -- (-1431.734) [-1433.060] (-1432.079) (-1435.383) * (-1431.316) [-1433.469] (-1435.545) (-1433.779) -- 0:00:41
383000 -- [-1431.773] (-1433.753) (-1434.333) (-1432.605) * (-1433.965) (-1435.173) (-1436.449) [-1432.627] -- 0:00:41
383500 -- (-1430.734) (-1438.300) (-1434.053) [-1436.281] * (-1434.531) [-1433.854] (-1436.536) (-1433.407) -- 0:00:41
384000 -- (-1432.798) (-1433.324) (-1436.387) [-1436.037] * (-1431.687) [-1431.349] (-1432.986) (-1433.142) -- 0:00:41
384500 -- [-1432.623] (-1433.062) (-1431.583) (-1436.033) * (-1432.757) (-1436.838) (-1432.315) [-1433.104] -- 0:00:41
385000 -- (-1435.879) [-1432.378] (-1433.505) (-1432.383) * (-1436.902) (-1436.611) [-1434.350] (-1434.482) -- 0:00:41
Average standard deviation of split frequencies: 0.010503
385500 -- (-1435.126) (-1432.220) [-1430.810] (-1433.240) * (-1434.027) (-1437.096) (-1434.441) [-1434.557] -- 0:00:43
386000 -- (-1434.711) [-1432.913] (-1432.023) (-1434.650) * (-1434.140) [-1434.980] (-1435.815) (-1433.504) -- 0:00:42
386500 -- (-1436.873) (-1433.578) [-1431.711] (-1436.911) * (-1430.951) (-1434.383) (-1430.631) [-1431.348] -- 0:00:42
387000 -- (-1432.235) (-1436.890) [-1433.107] (-1436.939) * (-1431.715) (-1434.937) (-1437.486) [-1432.658] -- 0:00:42
387500 -- (-1434.681) [-1436.389] (-1433.399) (-1434.642) * (-1435.291) (-1435.005) [-1432.924] (-1432.241) -- 0:00:42
388000 -- (-1437.198) (-1434.454) [-1430.850] (-1435.204) * (-1433.702) [-1432.535] (-1433.834) (-1438.162) -- 0:00:42
388500 -- (-1435.568) [-1432.304] (-1432.585) (-1433.942) * (-1433.036) [-1433.415] (-1432.632) (-1431.395) -- 0:00:42
389000 -- (-1434.914) [-1430.773] (-1432.860) (-1433.576) * [-1433.870] (-1432.282) (-1435.399) (-1434.187) -- 0:00:42
389500 -- (-1436.209) (-1432.552) [-1433.750] (-1434.050) * [-1431.867] (-1432.536) (-1433.179) (-1435.282) -- 0:00:42
390000 -- (-1437.383) [-1435.129] (-1434.387) (-1435.328) * (-1431.414) (-1432.904) [-1430.081] (-1432.774) -- 0:00:42
Average standard deviation of split frequencies: 0.010030
390500 -- (-1433.300) [-1436.154] (-1433.720) (-1433.616) * [-1432.659] (-1430.301) (-1433.900) (-1438.097) -- 0:00:42
391000 -- (-1431.338) (-1433.519) [-1431.895] (-1433.185) * (-1438.536) (-1434.087) [-1435.548] (-1437.833) -- 0:00:42
391500 -- [-1432.382] (-1434.685) (-1432.545) (-1432.651) * [-1433.014] (-1432.782) (-1435.101) (-1435.591) -- 0:00:41
392000 -- (-1431.858) (-1438.487) (-1432.273) [-1432.943] * (-1436.837) (-1435.168) (-1434.706) [-1432.138] -- 0:00:41
392500 -- (-1434.666) (-1431.417) (-1436.778) [-1431.253] * (-1434.639) (-1433.798) [-1433.320] (-1436.465) -- 0:00:41
393000 -- (-1431.912) [-1435.685] (-1432.751) (-1435.432) * (-1435.036) [-1432.295] (-1436.257) (-1433.764) -- 0:00:41
393500 -- [-1432.788] (-1433.795) (-1433.120) (-1433.744) * (-1434.619) (-1431.021) (-1431.501) [-1432.715] -- 0:00:41
394000 -- [-1429.995] (-1432.457) (-1432.997) (-1432.908) * [-1431.125] (-1437.812) (-1429.975) (-1432.010) -- 0:00:41
394500 -- [-1432.112] (-1437.317) (-1435.238) (-1430.856) * (-1430.212) (-1436.814) [-1437.686] (-1431.678) -- 0:00:41
395000 -- (-1433.384) [-1433.389] (-1432.803) (-1433.502) * [-1436.356] (-1431.886) (-1431.405) (-1435.376) -- 0:00:41
Average standard deviation of split frequencies: 0.009003
395500 -- [-1433.203] (-1434.789) (-1431.524) (-1434.242) * (-1438.062) (-1432.315) (-1434.653) [-1435.464] -- 0:00:41
396000 -- (-1432.724) (-1435.819) [-1434.165] (-1431.576) * (-1436.311) (-1431.279) (-1430.434) [-1433.501] -- 0:00:41
396500 -- (-1433.387) [-1437.059] (-1430.745) (-1432.355) * (-1433.995) [-1432.750] (-1434.455) (-1433.153) -- 0:00:41
397000 -- (-1434.914) [-1435.296] (-1437.413) (-1433.199) * [-1432.550] (-1430.415) (-1434.542) (-1431.572) -- 0:00:41
397500 -- (-1433.400) [-1437.913] (-1432.201) (-1430.819) * (-1432.507) (-1432.410) [-1435.865] (-1432.884) -- 0:00:40
398000 -- [-1431.772] (-1434.637) (-1434.290) (-1437.011) * [-1435.479] (-1433.780) (-1434.603) (-1433.237) -- 0:00:40
398500 -- (-1436.312) (-1432.899) (-1429.857) [-1434.061] * (-1435.691) [-1433.010] (-1430.342) (-1433.260) -- 0:00:40
399000 -- (-1437.657) (-1434.766) (-1433.167) [-1433.717] * (-1434.536) (-1433.779) (-1429.650) [-1429.179] -- 0:00:40
399500 -- (-1434.292) (-1433.675) [-1435.560] (-1431.741) * [-1437.364] (-1433.044) (-1432.899) (-1432.514) -- 0:00:40
400000 -- (-1431.910) (-1435.696) [-1433.903] (-1431.569) * (-1436.370) [-1430.811] (-1432.643) (-1434.074) -- 0:00:41
Average standard deviation of split frequencies: 0.010074
400500 -- (-1433.344) (-1434.088) (-1437.571) [-1434.960] * (-1437.734) (-1433.805) (-1437.472) [-1432.800] -- 0:00:41
401000 -- (-1432.755) [-1435.969] (-1431.032) (-1432.952) * (-1431.088) (-1434.863) [-1435.350] (-1430.321) -- 0:00:41
401500 -- [-1430.943] (-1432.639) (-1431.821) (-1434.461) * [-1430.890] (-1433.228) (-1431.395) (-1432.687) -- 0:00:41
402000 -- (-1432.128) (-1433.177) (-1431.591) [-1431.770] * (-1433.447) [-1431.973] (-1438.796) (-1432.468) -- 0:00:41
402500 -- [-1430.048] (-1435.127) (-1431.514) (-1433.083) * [-1433.757] (-1433.485) (-1433.421) (-1431.014) -- 0:00:41
403000 -- [-1434.454] (-1438.717) (-1439.258) (-1438.092) * (-1431.552) (-1435.172) [-1433.125] (-1435.082) -- 0:00:41
403500 -- (-1436.102) (-1434.810) [-1432.004] (-1433.344) * [-1430.731] (-1435.615) (-1433.130) (-1434.794) -- 0:00:41
404000 -- (-1435.168) (-1434.030) [-1432.414] (-1433.200) * [-1431.529] (-1434.198) (-1435.295) (-1430.957) -- 0:00:41
404500 -- (-1434.449) [-1435.210] (-1432.435) (-1434.657) * (-1433.915) [-1435.232] (-1433.959) (-1431.980) -- 0:00:41
405000 -- (-1433.240) [-1433.983] (-1436.903) (-1433.146) * (-1431.729) (-1439.103) [-1434.039] (-1433.693) -- 0:00:41
Average standard deviation of split frequencies: 0.009579
405500 -- (-1435.646) (-1432.262) [-1434.156] (-1439.115) * (-1432.307) (-1437.125) (-1436.256) [-1433.025] -- 0:00:41
406000 -- (-1433.005) [-1432.043] (-1434.644) (-1434.036) * (-1432.254) (-1433.603) (-1433.340) [-1433.117] -- 0:00:40
406500 -- (-1432.093) (-1434.537) (-1431.565) [-1433.564] * (-1431.485) (-1435.584) [-1434.874] (-1432.550) -- 0:00:40
407000 -- [-1434.870] (-1432.421) (-1432.560) (-1433.232) * (-1432.749) (-1437.967) [-1436.241] (-1436.391) -- 0:00:40
407500 -- (-1433.645) [-1434.997] (-1431.585) (-1432.688) * [-1434.670] (-1436.100) (-1435.757) (-1435.185) -- 0:00:40
408000 -- (-1433.683) [-1432.872] (-1433.215) (-1431.268) * [-1434.795] (-1436.142) (-1433.918) (-1432.758) -- 0:00:40
408500 -- (-1434.318) [-1430.451] (-1433.627) (-1433.572) * (-1430.879) [-1433.237] (-1435.989) (-1431.346) -- 0:00:40
409000 -- (-1437.216) (-1432.798) [-1433.212] (-1438.703) * [-1434.345] (-1431.701) (-1438.319) (-1430.519) -- 0:00:40
409500 -- (-1431.647) (-1433.200) [-1431.030] (-1435.365) * (-1434.027) (-1432.992) (-1434.651) [-1433.114] -- 0:00:40
410000 -- (-1431.017) [-1435.013] (-1433.396) (-1434.296) * (-1436.515) [-1431.294] (-1435.971) (-1432.503) -- 0:00:40
Average standard deviation of split frequencies: 0.009183
410500 -- (-1432.565) (-1437.651) (-1433.237) [-1434.637] * (-1434.601) (-1432.049) (-1435.922) [-1433.926] -- 0:00:40
411000 -- [-1433.015] (-1433.560) (-1433.967) (-1436.028) * (-1436.414) (-1431.359) [-1436.014] (-1433.216) -- 0:00:40
411500 -- (-1432.225) (-1431.502) (-1433.396) [-1432.735] * (-1434.076) [-1431.583] (-1435.473) (-1434.214) -- 0:00:40
412000 -- (-1433.062) [-1434.042] (-1431.547) (-1436.227) * (-1437.240) [-1432.876] (-1437.493) (-1436.767) -- 0:00:39
412500 -- [-1431.283] (-1433.773) (-1432.460) (-1435.954) * (-1433.445) (-1433.620) [-1433.465] (-1433.534) -- 0:00:39
413000 -- [-1430.509] (-1432.677) (-1436.193) (-1435.883) * (-1433.596) (-1433.815) (-1433.701) [-1433.339] -- 0:00:39
413500 -- (-1432.624) (-1431.384) [-1434.546] (-1433.135) * (-1433.535) (-1431.550) [-1434.773] (-1434.096) -- 0:00:39
414000 -- (-1433.416) (-1435.943) [-1433.632] (-1435.172) * (-1432.299) [-1433.135] (-1432.541) (-1437.367) -- 0:00:39
414500 -- (-1435.900) [-1432.940] (-1436.095) (-1433.376) * (-1436.100) [-1431.416] (-1435.317) (-1434.417) -- 0:00:40
415000 -- (-1438.077) (-1431.689) (-1437.989) [-1433.995] * (-1433.945) (-1432.165) (-1433.723) [-1435.107] -- 0:00:40
Average standard deviation of split frequencies: 0.008428
415500 -- (-1437.740) (-1434.443) (-1431.935) [-1432.653] * (-1439.770) [-1432.443] (-1433.668) (-1433.054) -- 0:00:40
416000 -- [-1433.584] (-1431.736) (-1433.376) (-1433.831) * (-1436.591) [-1431.477] (-1434.533) (-1432.151) -- 0:00:40
416500 -- [-1433.013] (-1435.613) (-1435.308) (-1433.612) * [-1433.235] (-1430.294) (-1434.353) (-1435.292) -- 0:00:40
417000 -- (-1435.847) (-1433.020) (-1434.056) [-1434.070] * [-1433.497] (-1435.283) (-1436.193) (-1433.579) -- 0:00:40
417500 -- (-1433.506) (-1436.438) (-1434.099) [-1433.169] * (-1433.785) [-1432.538] (-1433.340) (-1432.627) -- 0:00:40
418000 -- (-1434.986) (-1433.928) [-1430.932] (-1435.353) * (-1433.434) (-1432.701) [-1435.433] (-1435.997) -- 0:00:40
418500 -- (-1434.035) [-1433.777] (-1431.819) (-1432.362) * (-1433.155) (-1433.615) [-1440.458] (-1435.569) -- 0:00:40
419000 -- (-1435.192) (-1434.288) (-1435.880) [-1436.057] * (-1434.344) [-1435.719] (-1433.836) (-1435.959) -- 0:00:40
419500 -- (-1434.107) (-1435.634) (-1433.041) [-1436.135] * (-1434.203) (-1432.310) [-1433.502] (-1433.572) -- 0:00:40
420000 -- (-1434.348) (-1437.337) (-1430.493) [-1437.810] * (-1433.779) (-1434.197) (-1435.347) [-1434.603] -- 0:00:40
Average standard deviation of split frequencies: 0.008615
420500 -- (-1431.504) (-1433.005) (-1430.192) [-1439.642] * [-1432.989] (-1434.027) (-1434.308) (-1433.175) -- 0:00:39
421000 -- (-1433.797) [-1431.285] (-1431.044) (-1437.501) * [-1432.626] (-1435.305) (-1440.813) (-1433.054) -- 0:00:39
421500 -- [-1433.492] (-1431.747) (-1432.255) (-1436.854) * (-1433.087) [-1435.696] (-1437.310) (-1436.112) -- 0:00:39
422000 -- [-1432.984] (-1436.339) (-1433.197) (-1434.354) * (-1435.806) (-1434.106) (-1436.349) [-1437.337] -- 0:00:39
422500 -- (-1433.908) (-1435.225) [-1433.694] (-1436.203) * (-1432.998) (-1434.758) (-1433.817) [-1433.003] -- 0:00:39
423000 -- (-1433.536) (-1436.062) (-1431.037) [-1433.986] * (-1432.421) [-1433.659] (-1434.001) (-1436.275) -- 0:00:39
423500 -- (-1432.214) (-1433.392) [-1434.939] (-1434.536) * [-1433.034] (-1435.305) (-1435.209) (-1434.608) -- 0:00:39
424000 -- (-1436.648) [-1430.780] (-1433.647) (-1430.485) * [-1432.235] (-1433.214) (-1436.833) (-1435.574) -- 0:00:39
424500 -- (-1436.825) (-1435.198) [-1432.663] (-1433.699) * (-1432.163) (-1435.917) [-1432.373] (-1433.040) -- 0:00:39
425000 -- (-1433.766) (-1434.419) [-1432.622] (-1433.194) * [-1431.231] (-1433.859) (-1436.412) (-1432.841) -- 0:00:39
Average standard deviation of split frequencies: 0.008576
425500 -- (-1433.491) (-1432.536) (-1434.015) [-1434.607] * (-1435.688) [-1434.418] (-1435.935) (-1435.610) -- 0:00:39
426000 -- [-1433.760] (-1433.757) (-1437.820) (-1435.277) * (-1435.592) [-1432.920] (-1433.386) (-1436.602) -- 0:00:39
426500 -- (-1430.543) (-1436.018) (-1435.354) [-1435.896] * (-1436.109) (-1433.464) [-1431.407] (-1436.525) -- 0:00:38
427000 -- (-1433.070) (-1433.313) [-1434.664] (-1434.111) * (-1435.612) (-1433.115) (-1433.519) [-1437.685] -- 0:00:38
427500 -- (-1431.978) [-1433.378] (-1432.702) (-1437.604) * (-1431.145) (-1433.117) [-1434.820] (-1436.959) -- 0:00:38
428000 -- (-1436.908) (-1434.046) [-1432.376] (-1433.581) * (-1433.557) (-1433.667) [-1434.350] (-1436.432) -- 0:00:38
428500 -- (-1436.773) (-1432.994) (-1434.255) [-1434.894] * (-1435.271) (-1432.440) [-1433.075] (-1436.945) -- 0:00:38
429000 -- (-1434.832) [-1434.062] (-1433.329) (-1434.164) * [-1436.090] (-1431.994) (-1436.176) (-1435.696) -- 0:00:39
429500 -- [-1434.468] (-1433.239) (-1437.228) (-1438.777) * (-1434.380) [-1430.868] (-1434.621) (-1435.776) -- 0:00:39
430000 -- [-1433.257] (-1433.570) (-1430.928) (-1432.921) * [-1430.955] (-1431.954) (-1436.999) (-1433.180) -- 0:00:39
Average standard deviation of split frequencies: 0.007799
430500 -- (-1432.922) (-1436.170) (-1431.090) [-1433.854] * (-1431.540) (-1431.705) [-1433.302] (-1438.737) -- 0:00:39
431000 -- (-1432.729) [-1431.783] (-1435.332) (-1434.644) * (-1430.773) [-1433.224] (-1437.528) (-1433.095) -- 0:00:39
431500 -- (-1433.006) (-1434.711) (-1431.096) [-1434.192] * [-1433.626] (-1433.306) (-1434.849) (-1432.928) -- 0:00:39
432000 -- [-1432.785] (-1433.617) (-1431.729) (-1434.009) * (-1433.170) (-1434.002) [-1432.068] (-1433.415) -- 0:00:39
432500 -- (-1432.707) (-1435.660) (-1431.567) [-1432.968] * (-1433.709) (-1433.793) (-1433.459) [-1434.389] -- 0:00:39
433000 -- [-1432.731] (-1436.620) (-1430.337) (-1433.683) * (-1434.691) (-1432.215) (-1432.364) [-1434.253] -- 0:00:39
433500 -- [-1431.715] (-1435.539) (-1432.144) (-1432.588) * [-1431.002] (-1433.411) (-1435.203) (-1439.392) -- 0:00:39
434000 -- (-1436.617) (-1431.272) (-1433.785) [-1433.037] * [-1432.672] (-1435.108) (-1433.000) (-1432.936) -- 0:00:39
434500 -- (-1431.742) (-1435.057) (-1430.943) [-1432.563] * (-1432.469) [-1435.343] (-1434.414) (-1433.911) -- 0:00:39
435000 -- (-1431.238) (-1437.712) [-1433.350] (-1433.341) * (-1434.642) (-1436.170) [-1434.163] (-1432.737) -- 0:00:38
Average standard deviation of split frequencies: 0.007906
435500 -- (-1436.746) [-1436.086] (-1432.388) (-1435.065) * (-1431.848) [-1433.860] (-1435.921) (-1433.531) -- 0:00:38
436000 -- (-1436.453) (-1431.887) (-1430.264) [-1434.069] * (-1432.278) (-1436.037) [-1439.481] (-1435.629) -- 0:00:38
436500 -- (-1431.842) [-1434.293] (-1431.829) (-1432.771) * [-1434.954] (-1432.989) (-1435.111) (-1434.244) -- 0:00:38
437000 -- [-1433.864] (-1433.688) (-1431.457) (-1432.990) * (-1432.266) (-1434.808) [-1435.145] (-1433.254) -- 0:00:38
437500 -- (-1431.678) (-1432.035) [-1439.570] (-1434.667) * (-1435.410) (-1432.455) [-1433.234] (-1437.271) -- 0:00:38
438000 -- (-1432.766) [-1431.987] (-1433.383) (-1437.441) * (-1435.186) [-1432.137] (-1434.865) (-1430.736) -- 0:00:38
438500 -- [-1432.290] (-1433.501) (-1436.980) (-1434.346) * (-1431.770) [-1434.404] (-1436.727) (-1434.236) -- 0:00:38
439000 -- (-1432.530) (-1434.398) (-1431.532) [-1431.124] * [-1432.034] (-1433.108) (-1439.090) (-1433.487) -- 0:00:38
439500 -- (-1431.435) (-1432.118) (-1439.045) [-1433.740] * (-1433.575) (-1432.690) (-1437.411) [-1433.068] -- 0:00:38
440000 -- (-1432.835) [-1431.294] (-1431.241) (-1434.648) * [-1432.597] (-1435.870) (-1435.769) (-1434.664) -- 0:00:38
Average standard deviation of split frequencies: 0.007889
440500 -- [-1435.175] (-1435.736) (-1436.527) (-1432.023) * [-1431.381] (-1436.500) (-1437.201) (-1436.417) -- 0:00:38
441000 -- (-1433.705) (-1435.514) [-1432.449] (-1432.927) * (-1435.218) (-1438.382) [-1433.926] (-1433.604) -- 0:00:38
441500 -- (-1436.840) (-1433.318) (-1432.577) [-1431.310] * (-1437.602) (-1434.841) [-1435.950] (-1431.373) -- 0:00:37
442000 -- (-1431.823) (-1433.037) [-1433.667] (-1435.990) * (-1436.468) (-1436.349) [-1433.686] (-1434.461) -- 0:00:37
442500 -- [-1438.312] (-1431.946) (-1433.963) (-1434.206) * [-1436.765] (-1433.279) (-1433.133) (-1430.734) -- 0:00:37
443000 -- [-1436.912] (-1436.729) (-1434.502) (-1434.367) * [-1434.830] (-1432.960) (-1435.265) (-1431.535) -- 0:00:37
443500 -- (-1431.688) [-1435.362] (-1433.760) (-1434.543) * (-1430.890) (-1432.198) (-1433.489) [-1435.348] -- 0:00:38
444000 -- (-1434.307) (-1436.236) [-1434.426] (-1433.293) * (-1435.501) [-1434.396] (-1430.935) (-1432.375) -- 0:00:38
444500 -- [-1433.257] (-1431.878) (-1435.095) (-1431.920) * (-1430.236) [-1431.313] (-1434.546) (-1432.412) -- 0:00:38
445000 -- [-1431.573] (-1432.746) (-1440.162) (-1436.864) * (-1433.315) [-1434.425] (-1433.884) (-1431.717) -- 0:00:38
Average standard deviation of split frequencies: 0.007531
445500 -- (-1432.355) [-1432.344] (-1434.887) (-1434.244) * (-1432.426) [-1431.106] (-1434.293) (-1433.778) -- 0:00:38
446000 -- (-1431.482) [-1432.501] (-1432.822) (-1437.310) * [-1431.185] (-1431.883) (-1433.159) (-1435.057) -- 0:00:38
446500 -- (-1432.090) (-1431.685) [-1431.961] (-1444.061) * (-1434.839) [-1433.891] (-1432.299) (-1433.666) -- 0:00:38
447000 -- (-1433.157) [-1432.053] (-1431.689) (-1432.959) * (-1433.044) [-1433.564] (-1432.667) (-1436.680) -- 0:00:38
447500 -- (-1433.768) (-1431.991) [-1432.965] (-1433.465) * (-1432.102) (-1432.023) (-1430.949) [-1430.348] -- 0:00:38
448000 -- (-1432.776) [-1433.132] (-1432.669) (-1432.710) * (-1434.198) (-1434.410) (-1433.072) [-1435.078] -- 0:00:38
448500 -- [-1436.660] (-1435.512) (-1434.480) (-1431.838) * (-1435.639) (-1433.301) [-1433.182] (-1433.926) -- 0:00:38
449000 -- (-1432.598) (-1431.644) (-1437.380) [-1432.416] * (-1438.088) (-1430.874) (-1433.537) [-1435.912] -- 0:00:38
449500 -- (-1433.658) (-1434.387) (-1433.070) [-1433.031] * [-1434.866] (-1433.527) (-1434.591) (-1433.297) -- 0:00:37
450000 -- (-1434.234) [-1432.639] (-1433.284) (-1430.605) * (-1433.482) (-1435.790) [-1431.389] (-1435.173) -- 0:00:37
Average standard deviation of split frequencies: 0.006407
450500 -- [-1431.708] (-1431.419) (-1432.180) (-1433.534) * (-1434.073) (-1435.814) (-1435.160) [-1434.727] -- 0:00:37
451000 -- [-1432.098] (-1432.819) (-1436.812) (-1436.446) * [-1434.156] (-1431.947) (-1433.963) (-1435.217) -- 0:00:37
451500 -- (-1436.523) (-1432.119) [-1436.018] (-1434.028) * (-1433.992) (-1432.625) [-1433.185] (-1433.804) -- 0:00:37
452000 -- [-1431.852] (-1431.597) (-1433.095) (-1434.752) * (-1437.290) (-1435.513) (-1437.735) [-1431.085] -- 0:00:37
452500 -- (-1434.211) (-1430.817) [-1435.458] (-1433.608) * [-1434.678] (-1432.042) (-1432.021) (-1433.849) -- 0:00:37
453000 -- (-1432.216) [-1433.082] (-1432.785) (-1433.087) * (-1435.753) (-1431.715) [-1436.441] (-1432.906) -- 0:00:37
453500 -- [-1432.840] (-1435.331) (-1437.432) (-1433.967) * (-1434.648) [-1435.369] (-1432.887) (-1432.995) -- 0:00:37
454000 -- (-1435.480) [-1433.606] (-1438.136) (-1436.855) * (-1437.119) (-1434.947) [-1431.498] (-1432.385) -- 0:00:37
454500 -- (-1436.093) [-1431.930] (-1439.155) (-1432.783) * (-1434.901) [-1433.180] (-1433.020) (-1430.887) -- 0:00:37
455000 -- (-1432.164) [-1432.114] (-1434.466) (-1434.165) * [-1436.005] (-1435.539) (-1434.333) (-1432.885) -- 0:00:37
Average standard deviation of split frequencies: 0.006784
455500 -- [-1432.570] (-1432.707) (-1431.940) (-1434.443) * (-1432.419) (-1432.145) [-1432.791] (-1430.284) -- 0:00:37
456000 -- [-1432.277] (-1434.859) (-1439.577) (-1431.547) * (-1432.879) (-1431.777) [-1430.239] (-1432.368) -- 0:00:36
456500 -- [-1434.556] (-1435.063) (-1435.230) (-1432.320) * (-1439.084) (-1435.203) [-1430.927] (-1433.313) -- 0:00:36
457000 -- [-1433.134] (-1433.971) (-1432.363) (-1437.882) * (-1440.440) (-1433.499) (-1430.751) [-1434.048] -- 0:00:36
457500 -- (-1436.361) (-1433.568) (-1433.915) [-1435.221] * (-1438.646) (-1433.954) (-1437.078) [-1432.315] -- 0:00:36
458000 -- [-1430.950] (-1435.260) (-1433.600) (-1434.532) * (-1435.184) [-1433.766] (-1432.388) (-1437.185) -- 0:00:37
458500 -- [-1430.604] (-1432.913) (-1434.450) (-1432.386) * (-1434.726) (-1434.169) [-1432.713] (-1435.082) -- 0:00:37
459000 -- [-1433.827] (-1433.509) (-1433.104) (-1432.984) * (-1435.271) (-1435.239) (-1435.297) [-1434.066] -- 0:00:37
459500 -- (-1433.375) [-1432.276] (-1432.101) (-1430.486) * (-1434.212) (-1434.879) (-1436.944) [-1435.371] -- 0:00:37
460000 -- (-1431.126) [-1434.163] (-1431.025) (-1431.396) * (-1433.191) (-1434.489) [-1435.017] (-1435.840) -- 0:00:37
Average standard deviation of split frequencies: 0.006971
460500 -- (-1432.101) (-1437.292) (-1432.989) [-1430.512] * (-1432.560) (-1435.952) (-1433.477) [-1435.589] -- 0:00:37
461000 -- [-1431.463] (-1431.970) (-1433.995) (-1433.574) * [-1434.661] (-1435.437) (-1432.445) (-1435.321) -- 0:00:37
461500 -- (-1432.556) (-1431.042) [-1434.353] (-1433.319) * (-1434.223) (-1435.413) (-1435.100) [-1432.337] -- 0:00:37
462000 -- [-1431.529] (-1436.142) (-1436.215) (-1434.280) * (-1434.119) (-1435.379) (-1436.458) [-1432.007] -- 0:00:37
462500 -- (-1429.985) [-1435.559] (-1434.354) (-1433.990) * (-1435.917) [-1433.158] (-1433.922) (-1436.938) -- 0:00:37
463000 -- (-1431.459) (-1433.299) [-1431.077] (-1431.380) * (-1434.373) [-1437.872] (-1433.280) (-1435.721) -- 0:00:37
463500 -- (-1432.617) [-1432.755] (-1434.549) (-1431.768) * (-1434.232) (-1432.093) (-1432.900) [-1434.420] -- 0:00:37
464000 -- (-1433.613) [-1430.226] (-1432.454) (-1431.445) * (-1435.204) (-1438.578) [-1433.038] (-1434.671) -- 0:00:36
464500 -- (-1433.825) (-1434.350) [-1431.175] (-1435.509) * (-1434.485) [-1433.866] (-1434.674) (-1434.062) -- 0:00:36
465000 -- (-1432.230) (-1431.770) [-1434.719] (-1442.218) * (-1434.804) (-1434.936) [-1435.244] (-1432.852) -- 0:00:36
Average standard deviation of split frequencies: 0.006843
465500 -- (-1433.204) (-1430.662) [-1433.130] (-1434.260) * (-1432.270) [-1434.842] (-1432.775) (-1433.019) -- 0:00:36
466000 -- (-1432.887) [-1433.711] (-1434.766) (-1436.773) * [-1434.351] (-1435.075) (-1432.397) (-1433.746) -- 0:00:36
466500 -- (-1433.235) [-1433.191] (-1432.425) (-1440.609) * [-1434.670] (-1432.591) (-1433.403) (-1432.929) -- 0:00:36
467000 -- (-1435.456) [-1433.244] (-1434.063) (-1434.920) * [-1433.791] (-1433.983) (-1434.049) (-1436.136) -- 0:00:36
467500 -- (-1431.464) (-1432.801) [-1432.992] (-1434.284) * (-1431.855) [-1434.201] (-1433.454) (-1436.267) -- 0:00:36
468000 -- (-1433.501) [-1433.041] (-1432.070) (-1431.850) * [-1433.846] (-1433.731) (-1438.341) (-1433.264) -- 0:00:36
468500 -- [-1432.488] (-1435.985) (-1431.473) (-1435.758) * [-1433.291] (-1431.141) (-1433.890) (-1435.465) -- 0:00:36
469000 -- [-1431.437] (-1434.205) (-1433.058) (-1433.258) * (-1433.437) (-1432.138) (-1434.001) [-1434.724] -- 0:00:36
469500 -- (-1433.831) [-1431.972] (-1430.493) (-1432.191) * (-1435.446) [-1433.731] (-1433.999) (-1433.943) -- 0:00:36
470000 -- (-1433.660) (-1432.446) [-1433.041] (-1436.166) * (-1435.810) [-1433.746] (-1440.676) (-1437.042) -- 0:00:36
Average standard deviation of split frequencies: 0.007574
470500 -- [-1430.766] (-1430.982) (-1434.063) (-1435.517) * (-1433.592) (-1433.400) [-1443.314] (-1435.794) -- 0:00:36
471000 -- [-1430.693] (-1431.068) (-1430.350) (-1432.875) * (-1434.739) [-1433.383] (-1437.872) (-1435.920) -- 0:00:35
471500 -- (-1431.187) (-1438.027) [-1436.794] (-1435.350) * [-1433.564] (-1433.294) (-1434.769) (-1435.156) -- 0:00:35
472000 -- (-1432.565) (-1435.737) [-1431.582] (-1431.559) * (-1435.455) [-1433.847] (-1437.846) (-1434.279) -- 0:00:35
472500 -- (-1430.986) (-1436.327) (-1431.671) [-1432.054] * (-1433.648) (-1434.111) (-1434.155) [-1434.505] -- 0:00:36
473000 -- (-1434.681) (-1433.989) [-1430.145] (-1435.870) * (-1431.000) (-1435.869) [-1435.796] (-1438.936) -- 0:00:36
473500 -- [-1434.889] (-1438.583) (-1432.120) (-1434.154) * (-1431.823) (-1433.821) [-1433.788] (-1433.582) -- 0:00:36
474000 -- (-1434.059) [-1438.082] (-1433.451) (-1434.666) * [-1435.960] (-1435.010) (-1430.953) (-1437.444) -- 0:00:36
474500 -- (-1434.219) (-1433.637) [-1433.669] (-1432.238) * (-1434.617) [-1436.154] (-1431.483) (-1435.265) -- 0:00:36
475000 -- (-1434.450) (-1433.576) [-1435.935] (-1434.396) * [-1436.433] (-1435.744) (-1435.628) (-1433.405) -- 0:00:36
Average standard deviation of split frequencies: 0.007799
475500 -- [-1434.127] (-1436.164) (-1438.959) (-1433.205) * (-1432.499) (-1430.605) [-1432.200] (-1437.880) -- 0:00:36
476000 -- (-1436.023) (-1433.654) (-1436.633) [-1433.521] * (-1435.110) [-1430.697] (-1432.963) (-1433.118) -- 0:00:36
476500 -- [-1434.089] (-1433.020) (-1437.503) (-1432.676) * (-1431.387) [-1433.118] (-1435.112) (-1435.475) -- 0:00:36
477000 -- (-1436.356) [-1431.540] (-1436.824) (-1432.766) * (-1435.283) [-1432.867] (-1431.787) (-1437.980) -- 0:00:36
477500 -- (-1434.278) (-1431.322) [-1434.764] (-1433.569) * (-1434.143) (-1430.819) (-1431.635) [-1439.904] -- 0:00:36
478000 -- (-1435.010) [-1434.796] (-1435.272) (-1433.645) * (-1434.059) (-1431.894) (-1432.653) [-1434.595] -- 0:00:36
478500 -- (-1441.079) [-1435.523] (-1436.945) (-1431.391) * [-1432.813] (-1437.592) (-1430.308) (-1437.425) -- 0:00:35
479000 -- (-1435.579) [-1432.463] (-1438.095) (-1432.742) * (-1436.898) [-1433.162] (-1431.961) (-1431.989) -- 0:00:35
479500 -- [-1434.686] (-1433.875) (-1438.869) (-1433.752) * [-1429.582] (-1431.280) (-1432.796) (-1436.360) -- 0:00:35
480000 -- (-1438.469) [-1430.667] (-1435.033) (-1432.473) * (-1431.299) (-1434.717) (-1435.879) [-1434.274] -- 0:00:35
Average standard deviation of split frequencies: 0.008434
480500 -- (-1436.011) [-1433.532] (-1432.628) (-1433.607) * (-1430.747) (-1433.676) (-1431.652) [-1434.034] -- 0:00:35
481000 -- (-1432.421) [-1433.629] (-1434.803) (-1434.171) * [-1432.069] (-1431.733) (-1437.613) (-1433.234) -- 0:00:35
481500 -- (-1433.243) (-1433.443) (-1434.964) [-1434.560] * (-1434.795) (-1431.104) [-1435.747] (-1437.165) -- 0:00:35
482000 -- [-1436.468] (-1430.792) (-1437.592) (-1431.782) * (-1434.987) [-1434.343] (-1437.884) (-1437.405) -- 0:00:35
482500 -- (-1435.471) (-1431.227) [-1435.373] (-1433.488) * (-1431.259) (-1435.490) (-1435.015) [-1434.309] -- 0:00:35
483000 -- [-1433.066] (-1433.800) (-1435.022) (-1433.586) * (-1435.269) [-1434.353] (-1433.477) (-1434.707) -- 0:00:35
483500 -- [-1434.101] (-1431.717) (-1434.491) (-1436.730) * (-1431.844) [-1432.191] (-1433.408) (-1434.907) -- 0:00:35
484000 -- (-1433.894) (-1435.073) (-1433.258) [-1435.131] * [-1432.382] (-1436.848) (-1433.503) (-1434.957) -- 0:00:35
484500 -- (-1433.675) [-1433.434] (-1433.662) (-1439.040) * [-1432.539] (-1433.543) (-1434.536) (-1435.891) -- 0:00:35
485000 -- [-1433.818] (-1430.870) (-1433.713) (-1440.236) * (-1432.602) [-1432.339] (-1434.335) (-1433.974) -- 0:00:35
Average standard deviation of split frequencies: 0.007396
485500 -- (-1434.251) (-1431.719) (-1434.795) [-1435.403] * (-1438.180) (-1435.022) (-1431.996) [-1435.522] -- 0:00:34
486000 -- (-1435.568) (-1435.265) (-1434.679) [-1433.043] * (-1434.250) (-1435.186) (-1430.946) [-1433.001] -- 0:00:34
486500 -- (-1433.261) (-1432.910) (-1435.169) [-1434.138] * (-1434.970) (-1431.122) (-1441.432) [-1434.776] -- 0:00:34
487000 -- (-1435.640) [-1432.185] (-1433.190) (-1433.403) * (-1431.254) (-1431.384) (-1433.958) [-1434.902] -- 0:00:34
487500 -- [-1435.674] (-1430.926) (-1435.529) (-1436.813) * [-1431.828] (-1432.725) (-1433.162) (-1432.698) -- 0:00:35
488000 -- [-1433.197] (-1433.685) (-1433.607) (-1433.529) * (-1436.106) (-1437.602) [-1432.600] (-1435.881) -- 0:00:35
488500 -- [-1431.672] (-1433.603) (-1433.022) (-1435.720) * (-1438.344) (-1433.549) [-1436.805] (-1433.525) -- 0:00:35
489000 -- (-1432.282) (-1431.711) (-1432.273) [-1437.079] * (-1439.715) (-1431.893) [-1436.049] (-1434.187) -- 0:00:35
489500 -- [-1433.617] (-1435.893) (-1434.522) (-1436.776) * (-1433.488) [-1432.057] (-1443.074) (-1432.837) -- 0:00:35
490000 -- (-1435.193) (-1434.032) (-1432.754) [-1432.622] * [-1433.619] (-1431.818) (-1433.899) (-1432.852) -- 0:00:35
Average standard deviation of split frequencies: 0.008887
490500 -- (-1432.780) [-1432.178] (-1434.031) (-1430.539) * [-1432.054] (-1433.248) (-1431.931) (-1436.275) -- 0:00:35
491000 -- (-1432.856) (-1435.035) [-1438.070] (-1433.136) * (-1433.375) (-1432.942) (-1436.041) [-1433.468] -- 0:00:35
491500 -- (-1432.638) (-1432.403) [-1432.075] (-1433.080) * (-1433.630) [-1432.162] (-1435.450) (-1431.484) -- 0:00:35
492000 -- (-1433.972) [-1432.833] (-1432.995) (-1434.508) * (-1434.604) (-1438.327) [-1430.757] (-1432.983) -- 0:00:35
492500 -- [-1433.332] (-1433.528) (-1434.342) (-1432.971) * (-1434.685) (-1438.145) (-1431.567) [-1434.442] -- 0:00:35
493000 -- (-1436.377) (-1432.402) (-1432.408) [-1433.173] * [-1432.598] (-1436.994) (-1431.993) (-1434.636) -- 0:00:34
493500 -- (-1433.841) (-1433.349) (-1433.766) [-1436.435] * (-1434.580) (-1435.754) (-1432.453) [-1431.692] -- 0:00:34
494000 -- (-1433.561) (-1439.002) [-1431.855] (-1436.434) * (-1432.817) [-1431.084] (-1432.868) (-1433.715) -- 0:00:34
494500 -- (-1438.778) [-1432.686] (-1435.522) (-1433.862) * (-1436.420) [-1432.630] (-1434.328) (-1431.404) -- 0:00:34
495000 -- (-1433.155) (-1433.791) [-1435.557] (-1436.826) * (-1433.675) (-1433.207) (-1431.526) [-1432.037] -- 0:00:34
Average standard deviation of split frequencies: 0.009029
495500 -- (-1435.593) (-1433.910) (-1433.971) [-1436.219] * (-1434.664) (-1433.802) [-1434.014] (-1441.839) -- 0:00:34
496000 -- (-1434.127) [-1431.937] (-1434.950) (-1436.565) * (-1434.428) [-1432.743] (-1431.384) (-1435.514) -- 0:00:34
496500 -- (-1433.602) (-1433.591) [-1432.509] (-1441.440) * (-1435.675) (-1434.180) [-1430.629] (-1431.800) -- 0:00:34
497000 -- (-1435.175) [-1431.642] (-1431.417) (-1444.589) * (-1434.144) (-1435.713) (-1431.581) [-1431.179] -- 0:00:34
497500 -- [-1433.708] (-1432.329) (-1438.365) (-1435.667) * (-1436.098) [-1433.331] (-1436.941) (-1433.019) -- 0:00:34
498000 -- (-1432.532) (-1432.649) (-1434.556) [-1434.272] * (-1435.784) [-1433.102] (-1435.635) (-1434.641) -- 0:00:34
498500 -- (-1436.357) (-1437.327) [-1438.370] (-1435.090) * [-1435.528] (-1431.958) (-1432.339) (-1431.130) -- 0:00:34
499000 -- (-1438.314) (-1434.517) [-1437.454] (-1433.022) * (-1438.465) (-1434.028) [-1431.087] (-1432.080) -- 0:00:34
499500 -- (-1434.848) (-1434.415) (-1433.585) [-1433.471] * (-1434.553) (-1432.618) [-1432.054] (-1431.603) -- 0:00:34
500000 -- (-1433.936) (-1431.717) (-1434.679) [-1433.987] * (-1433.729) (-1430.147) (-1431.180) [-1433.273] -- 0:00:34
Average standard deviation of split frequencies: 0.008062
500500 -- (-1433.102) (-1429.839) (-1434.307) [-1432.972] * (-1433.286) (-1433.998) (-1433.902) [-1432.661] -- 0:00:33
501000 -- [-1434.945] (-1432.679) (-1435.214) (-1435.127) * [-1433.044] (-1433.208) (-1435.252) (-1435.496) -- 0:00:33
501500 -- (-1437.832) [-1431.894] (-1435.732) (-1437.802) * (-1432.825) (-1435.249) [-1431.988] (-1433.541) -- 0:00:33
502000 -- (-1435.690) (-1436.067) [-1432.120] (-1433.707) * (-1432.928) (-1433.477) [-1433.334] (-1433.821) -- 0:00:34
502500 -- (-1439.638) [-1433.905] (-1434.620) (-1432.212) * [-1435.120] (-1435.402) (-1433.567) (-1433.982) -- 0:00:34
503000 -- (-1433.530) [-1437.238] (-1436.358) (-1432.960) * (-1439.266) [-1437.853] (-1437.783) (-1434.835) -- 0:00:34
503500 -- (-1434.734) (-1438.352) (-1433.215) [-1432.133] * (-1437.745) (-1433.442) [-1433.279] (-1433.315) -- 0:00:34
504000 -- (-1433.368) (-1434.949) [-1433.737] (-1435.121) * (-1437.074) (-1436.976) (-1433.600) [-1435.665] -- 0:00:34
504500 -- (-1439.258) (-1433.959) [-1435.179] (-1432.484) * (-1434.141) (-1434.790) (-1432.803) [-1433.312] -- 0:00:34
505000 -- (-1434.757) (-1434.064) (-1435.940) [-1430.847] * (-1433.631) (-1433.776) (-1436.715) [-1432.386] -- 0:00:34
Average standard deviation of split frequencies: 0.007234
505500 -- (-1436.318) (-1434.821) (-1433.337) [-1430.602] * (-1433.451) [-1431.193] (-1435.968) (-1434.696) -- 0:00:34
506000 -- (-1436.425) [-1433.770] (-1434.770) (-1433.486) * (-1433.154) [-1430.920] (-1433.464) (-1430.140) -- 0:00:34
506500 -- (-1433.777) (-1433.039) (-1433.312) [-1431.686] * (-1433.555) (-1432.841) [-1434.230] (-1432.939) -- 0:00:34
507000 -- (-1432.522) (-1431.023) (-1433.365) [-1435.101] * (-1433.925) [-1431.406] (-1431.369) (-1433.615) -- 0:00:34
507500 -- (-1430.824) [-1432.498] (-1434.013) (-1430.020) * (-1434.605) (-1433.629) [-1433.335] (-1435.795) -- 0:00:33
508000 -- (-1433.311) (-1434.839) (-1433.975) [-1432.071] * (-1435.640) [-1432.041] (-1433.435) (-1434.581) -- 0:00:33
508500 -- (-1430.719) [-1433.438] (-1441.559) (-1433.962) * (-1435.390) (-1434.287) (-1430.962) [-1431.433] -- 0:00:33
509000 -- (-1433.313) [-1432.699] (-1432.647) (-1436.188) * (-1434.005) (-1430.061) [-1431.731] (-1435.377) -- 0:00:33
509500 -- [-1433.309] (-1433.718) (-1432.665) (-1433.326) * [-1432.073] (-1433.702) (-1434.265) (-1433.538) -- 0:00:33
510000 -- (-1436.163) (-1438.559) [-1434.162] (-1436.574) * [-1432.934] (-1433.747) (-1432.244) (-1433.649) -- 0:00:33
Average standard deviation of split frequencies: 0.007641
510500 -- (-1434.492) (-1434.048) (-1432.084) [-1432.823] * [-1435.361] (-1433.211) (-1433.522) (-1435.654) -- 0:00:33
511000 -- (-1436.111) (-1432.448) [-1432.527] (-1434.996) * (-1431.667) (-1432.413) (-1432.760) [-1432.391] -- 0:00:33
511500 -- (-1433.997) [-1433.615] (-1433.398) (-1433.996) * (-1435.581) (-1434.446) [-1433.295] (-1432.889) -- 0:00:33
512000 -- (-1434.101) (-1433.905) (-1434.251) [-1433.316] * (-1432.677) (-1435.418) [-1434.258] (-1432.684) -- 0:00:33
512500 -- [-1431.119] (-1431.572) (-1434.483) (-1433.372) * (-1435.064) [-1429.914] (-1433.837) (-1435.705) -- 0:00:33
513000 -- (-1431.679) (-1433.473) [-1432.963] (-1439.066) * (-1432.706) (-1435.718) [-1432.829] (-1435.039) -- 0:00:33
513500 -- (-1436.851) (-1431.247) [-1433.207] (-1434.367) * [-1433.637] (-1433.453) (-1433.062) (-1432.971) -- 0:00:33
514000 -- [-1431.300] (-1431.442) (-1432.190) (-1433.569) * [-1433.869] (-1435.572) (-1435.916) (-1432.189) -- 0:00:33
514500 -- [-1434.458] (-1431.150) (-1436.027) (-1432.133) * (-1434.604) (-1432.347) [-1430.940] (-1431.513) -- 0:00:33
515000 -- (-1438.106) (-1430.931) (-1433.653) [-1431.879] * (-1432.548) [-1432.174] (-1436.455) (-1436.267) -- 0:00:32
Average standard deviation of split frequencies: 0.007613
515500 -- [-1433.522] (-1440.158) (-1434.549) (-1431.313) * [-1435.524] (-1433.597) (-1430.446) (-1432.502) -- 0:00:32
516000 -- (-1432.547) [-1435.714] (-1437.333) (-1433.976) * (-1436.508) (-1433.271) (-1434.051) [-1430.871] -- 0:00:32
516500 -- [-1431.521] (-1431.861) (-1432.728) (-1433.617) * (-1432.170) [-1430.526] (-1433.519) (-1435.232) -- 0:00:33
517000 -- (-1434.946) (-1436.790) (-1434.642) [-1432.960] * (-1433.058) (-1432.175) [-1433.378] (-1430.953) -- 0:00:33
517500 -- (-1435.179) (-1433.916) [-1430.009] (-1433.700) * (-1435.169) [-1433.559] (-1435.711) (-1433.486) -- 0:00:33
518000 -- (-1432.707) (-1430.880) (-1433.085) [-1431.483] * (-1433.634) [-1434.938] (-1432.194) (-1434.005) -- 0:00:33
518500 -- (-1435.587) [-1433.837] (-1432.783) (-1432.914) * (-1435.444) [-1433.200] (-1431.664) (-1434.747) -- 0:00:33
519000 -- [-1434.181] (-1433.773) (-1431.937) (-1435.013) * (-1435.172) [-1432.651] (-1432.550) (-1434.299) -- 0:00:33
519500 -- (-1433.216) (-1432.766) (-1433.567) [-1434.147] * (-1434.240) (-1433.185) [-1432.880] (-1433.129) -- 0:00:33
520000 -- (-1433.932) (-1432.533) [-1433.502] (-1434.818) * (-1431.820) (-1433.963) [-1431.814] (-1430.734) -- 0:00:33
Average standard deviation of split frequencies: 0.007616
520500 -- (-1432.745) (-1433.203) (-1437.424) [-1432.691] * (-1431.656) [-1433.164] (-1432.750) (-1433.255) -- 0:00:33
521000 -- (-1441.433) [-1432.434] (-1438.067) (-1437.124) * [-1430.597] (-1432.345) (-1439.076) (-1431.322) -- 0:00:33
521500 -- (-1438.960) (-1431.865) [-1431.783] (-1433.242) * (-1438.351) (-1431.601) [-1432.422] (-1432.506) -- 0:00:33
522000 -- (-1434.179) (-1434.086) (-1433.739) [-1435.068] * (-1432.629) (-1432.001) (-1434.647) [-1434.631] -- 0:00:32
522500 -- (-1434.744) (-1432.097) (-1434.808) [-1434.682] * (-1432.545) (-1438.017) [-1431.373] (-1434.339) -- 0:00:32
523000 -- (-1436.624) (-1430.945) [-1432.888] (-1437.342) * (-1432.732) (-1436.192) [-1432.580] (-1434.967) -- 0:00:32
523500 -- (-1432.809) [-1431.069] (-1437.635) (-1435.593) * (-1431.298) (-1435.280) [-1431.499] (-1432.606) -- 0:00:32
524000 -- (-1434.617) [-1430.386] (-1435.118) (-1434.278) * (-1434.453) (-1434.714) (-1434.203) [-1433.756] -- 0:00:32
524500 -- (-1435.769) [-1436.022] (-1435.060) (-1433.979) * (-1434.603) [-1430.737] (-1430.955) (-1436.261) -- 0:00:32
525000 -- [-1431.111] (-1431.996) (-1432.963) (-1432.194) * (-1433.561) [-1431.231] (-1431.833) (-1432.328) -- 0:00:32
Average standard deviation of split frequencies: 0.007966
525500 -- (-1433.835) (-1431.185) (-1433.774) [-1432.732] * [-1433.849] (-1431.057) (-1433.229) (-1432.167) -- 0:00:32
526000 -- (-1435.934) [-1434.364] (-1436.573) (-1434.224) * [-1436.526] (-1432.657) (-1434.297) (-1432.703) -- 0:00:32
526500 -- (-1434.275) [-1433.825] (-1433.333) (-1435.781) * (-1432.528) [-1433.024] (-1431.702) (-1434.379) -- 0:00:32
527000 -- (-1433.610) (-1433.858) (-1437.193) [-1434.127] * (-1433.053) (-1433.190) (-1433.943) [-1431.860] -- 0:00:32
527500 -- [-1433.949] (-1433.176) (-1432.412) (-1431.416) * (-1436.971) (-1431.591) [-1434.987] (-1432.729) -- 0:00:32
528000 -- (-1433.135) (-1432.677) [-1431.534] (-1430.740) * (-1435.849) (-1433.089) [-1434.465] (-1433.918) -- 0:00:32
528500 -- [-1436.820] (-1433.005) (-1434.309) (-1435.024) * (-1431.908) (-1438.268) (-1434.370) [-1432.504] -- 0:00:32
529000 -- (-1436.704) (-1435.190) [-1434.335] (-1434.627) * [-1434.603] (-1433.005) (-1439.128) (-1433.665) -- 0:00:32
529500 -- [-1434.711] (-1432.109) (-1436.581) (-1434.007) * (-1433.220) (-1435.982) [-1433.420] (-1432.960) -- 0:00:31
530000 -- [-1435.625] (-1431.701) (-1436.984) (-1432.067) * (-1432.136) (-1432.017) (-1432.239) [-1433.051] -- 0:00:31
Average standard deviation of split frequencies: 0.006950
530500 -- [-1434.449] (-1434.558) (-1434.536) (-1431.732) * (-1434.111) (-1434.734) (-1434.667) [-1431.756] -- 0:00:31
531000 -- (-1436.249) (-1433.371) (-1433.298) [-1431.601] * (-1434.919) (-1432.615) (-1432.488) [-1432.780] -- 0:00:32
531500 -- (-1438.628) (-1433.204) (-1433.878) [-1433.240] * (-1433.072) [-1432.327] (-1434.117) (-1435.232) -- 0:00:32
532000 -- (-1433.201) (-1433.432) (-1431.290) [-1431.124] * (-1434.301) [-1430.693] (-1436.293) (-1433.751) -- 0:00:32
532500 -- (-1434.052) (-1432.323) [-1434.315] (-1430.982) * (-1433.952) [-1432.706] (-1434.913) (-1435.626) -- 0:00:32
533000 -- [-1433.427] (-1432.855) (-1433.540) (-1430.359) * [-1433.068] (-1435.996) (-1431.088) (-1432.604) -- 0:00:32
533500 -- (-1433.884) (-1435.293) (-1433.406) [-1437.299] * (-1433.600) (-1436.795) (-1435.483) [-1432.012] -- 0:00:32
534000 -- (-1434.596) [-1432.030] (-1440.861) (-1434.247) * [-1434.122] (-1432.142) (-1432.138) (-1430.534) -- 0:00:32
534500 -- (-1434.796) [-1430.280] (-1434.614) (-1432.582) * (-1433.058) (-1432.383) [-1431.132] (-1432.421) -- 0:00:32
535000 -- (-1433.194) [-1431.743] (-1434.006) (-1431.991) * [-1434.242] (-1433.029) (-1431.971) (-1435.978) -- 0:00:32
Average standard deviation of split frequencies: 0.007450
535500 -- (-1434.159) (-1435.068) (-1432.267) [-1434.564] * (-1434.542) (-1433.089) [-1431.585] (-1435.416) -- 0:00:32
536000 -- (-1434.724) [-1432.322] (-1436.171) (-1433.862) * (-1432.243) [-1431.876] (-1434.390) (-1434.863) -- 0:00:32
536500 -- [-1438.109] (-1431.794) (-1435.818) (-1433.800) * (-1440.032) [-1431.023] (-1436.684) (-1440.852) -- 0:00:31
537000 -- (-1433.440) (-1432.851) (-1432.254) [-1433.579] * (-1432.122) (-1433.409) (-1432.913) [-1435.040] -- 0:00:31
537500 -- (-1433.365) [-1433.778] (-1435.339) (-1432.064) * (-1433.900) (-1434.060) (-1435.003) [-1434.692] -- 0:00:31
538000 -- [-1432.261] (-1432.956) (-1433.690) (-1431.248) * [-1431.115] (-1435.607) (-1432.715) (-1436.586) -- 0:00:31
538500 -- (-1431.300) [-1432.107] (-1434.799) (-1433.345) * (-1433.571) (-1437.731) (-1433.180) [-1434.800] -- 0:00:31
539000 -- (-1434.290) (-1432.177) [-1431.530] (-1431.535) * (-1431.948) [-1434.216] (-1434.881) (-1433.556) -- 0:00:31
539500 -- [-1432.597] (-1431.777) (-1439.388) (-1429.267) * [-1433.771] (-1433.093) (-1435.080) (-1434.298) -- 0:00:31
540000 -- (-1433.517) (-1431.948) (-1440.112) [-1432.728] * (-1436.868) [-1432.729] (-1434.520) (-1433.693) -- 0:00:31
Average standard deviation of split frequencies: 0.007078
540500 -- (-1433.573) (-1432.779) (-1434.056) [-1434.083] * (-1437.311) [-1433.288] (-1433.664) (-1433.913) -- 0:00:31
541000 -- (-1432.848) (-1434.577) (-1440.522) [-1434.669] * (-1435.532) [-1433.093] (-1434.343) (-1434.159) -- 0:00:31
541500 -- [-1438.721] (-1434.912) (-1438.663) (-1434.473) * (-1436.730) [-1433.714] (-1432.992) (-1434.034) -- 0:00:31
542000 -- (-1433.995) [-1431.930] (-1433.300) (-1434.832) * (-1432.778) (-1435.641) [-1432.400] (-1434.413) -- 0:00:31
542500 -- (-1432.862) (-1433.100) (-1433.040) [-1432.945] * (-1432.302) [-1431.413] (-1432.494) (-1434.268) -- 0:00:31
543000 -- (-1433.201) (-1433.202) [-1430.982] (-1442.095) * [-1432.881] (-1433.464) (-1434.019) (-1433.856) -- 0:00:31
543500 -- (-1435.808) [-1432.588] (-1432.425) (-1435.705) * [-1431.556] (-1434.814) (-1434.798) (-1434.886) -- 0:00:31
544000 -- (-1434.132) [-1432.031] (-1432.943) (-1432.916) * (-1432.631) [-1431.737] (-1435.446) (-1431.935) -- 0:00:31
544500 -- (-1433.184) (-1433.260) [-1433.834] (-1430.902) * [-1432.483] (-1433.576) (-1431.673) (-1434.755) -- 0:00:30
545000 -- (-1433.243) [-1435.657] (-1437.419) (-1430.806) * (-1435.671) (-1433.967) [-1433.720] (-1435.609) -- 0:00:30
Average standard deviation of split frequencies: 0.007009
545500 -- (-1433.364) (-1432.747) [-1432.646] (-1431.227) * (-1437.709) (-1432.368) (-1432.748) [-1433.559] -- 0:00:30
546000 -- (-1431.830) (-1434.521) [-1431.580] (-1431.982) * (-1432.431) [-1433.498] (-1434.805) (-1436.578) -- 0:00:31
546500 -- (-1430.983) (-1438.958) [-1432.425] (-1433.459) * (-1433.770) [-1432.135] (-1435.143) (-1431.502) -- 0:00:31
547000 -- (-1431.048) (-1435.995) [-1433.302] (-1432.089) * [-1432.098] (-1434.495) (-1433.278) (-1433.764) -- 0:00:31
547500 -- (-1432.418) [-1433.049] (-1433.390) (-1430.645) * (-1434.145) (-1431.846) [-1435.362] (-1433.091) -- 0:00:31
548000 -- (-1432.517) (-1434.844) (-1432.164) [-1433.643] * (-1431.992) (-1434.265) [-1434.466] (-1434.825) -- 0:00:31
548500 -- (-1432.306) (-1435.120) (-1437.097) [-1432.701] * (-1434.090) (-1434.473) (-1434.050) [-1434.590] -- 0:00:31
549000 -- [-1436.462] (-1433.743) (-1437.291) (-1439.638) * (-1436.731) (-1437.567) [-1433.434] (-1431.913) -- 0:00:31
549500 -- [-1437.250] (-1435.990) (-1435.378) (-1435.889) * (-1435.806) (-1433.354) [-1434.404] (-1434.611) -- 0:00:31
550000 -- [-1440.220] (-1435.163) (-1432.804) (-1435.817) * [-1432.896] (-1433.621) (-1433.584) (-1435.914) -- 0:00:31
Average standard deviation of split frequencies: 0.006647
550500 -- (-1433.167) [-1433.498] (-1433.390) (-1435.961) * (-1435.693) (-1434.759) (-1433.469) [-1432.468] -- 0:00:31
551000 -- (-1434.418) (-1438.561) [-1435.137] (-1431.893) * (-1434.653) (-1434.034) [-1434.539] (-1431.786) -- 0:00:30
551500 -- [-1430.854] (-1433.200) (-1433.055) (-1433.266) * (-1433.435) (-1432.046) (-1436.386) [-1431.482] -- 0:00:30
552000 -- (-1438.098) (-1432.974) (-1440.762) [-1433.863] * (-1433.096) (-1433.270) (-1433.757) [-1434.299] -- 0:00:30
552500 -- (-1433.182) (-1432.848) (-1434.662) [-1430.767] * (-1431.168) (-1433.241) [-1432.928] (-1431.842) -- 0:00:30
553000 -- (-1439.105) [-1433.635] (-1433.728) (-1441.127) * (-1429.514) [-1432.795] (-1434.849) (-1432.929) -- 0:00:30
553500 -- (-1433.044) (-1432.908) (-1433.426) [-1431.355] * (-1436.017) [-1434.329] (-1436.629) (-1433.506) -- 0:00:30
554000 -- (-1434.094) [-1434.580] (-1435.633) (-1431.994) * (-1434.715) [-1432.990] (-1434.587) (-1431.064) -- 0:00:30
554500 -- (-1433.834) [-1436.492] (-1434.061) (-1431.278) * (-1432.755) [-1433.810] (-1435.837) (-1434.029) -- 0:00:30
555000 -- (-1433.733) [-1434.061] (-1432.935) (-1435.308) * [-1432.953] (-1435.846) (-1436.167) (-1433.250) -- 0:00:30
Average standard deviation of split frequencies: 0.006359
555500 -- [-1434.592] (-1440.028) (-1435.503) (-1435.920) * (-1433.982) [-1433.461] (-1436.980) (-1437.932) -- 0:00:30
556000 -- [-1435.067] (-1437.867) (-1433.752) (-1441.179) * [-1433.316] (-1434.952) (-1433.608) (-1434.387) -- 0:00:30
556500 -- [-1435.801] (-1434.156) (-1434.327) (-1434.700) * [-1433.983] (-1435.004) (-1440.285) (-1432.173) -- 0:00:30
557000 -- (-1438.080) [-1432.883] (-1435.887) (-1437.102) * (-1434.075) (-1432.819) [-1434.300] (-1433.538) -- 0:00:30
557500 -- [-1433.912] (-1433.516) (-1432.459) (-1435.397) * [-1432.120] (-1434.466) (-1434.784) (-1433.966) -- 0:00:30
558000 -- (-1433.060) (-1433.934) [-1433.178] (-1433.326) * (-1434.224) (-1435.611) (-1431.230) [-1436.266] -- 0:00:30
558500 -- (-1432.940) [-1432.245] (-1434.717) (-1434.364) * [-1436.350] (-1433.605) (-1431.835) (-1433.557) -- 0:00:30
559000 -- (-1432.723) (-1438.646) [-1432.095] (-1432.937) * (-1432.059) (-1433.110) (-1430.429) [-1432.843] -- 0:00:29
559500 -- [-1433.904] (-1436.727) (-1437.375) (-1432.821) * (-1432.455) (-1431.682) [-1435.680] (-1431.117) -- 0:00:29
560000 -- (-1433.703) (-1434.430) [-1434.127] (-1433.128) * (-1433.466) (-1438.376) (-1432.796) [-1433.840] -- 0:00:29
Average standard deviation of split frequencies: 0.006779
560500 -- (-1433.683) (-1432.397) (-1435.406) [-1431.685] * (-1433.478) (-1436.482) (-1431.639) [-1433.803] -- 0:00:30
561000 -- (-1432.907) (-1436.745) (-1434.371) [-1434.030] * (-1432.306) [-1433.746] (-1435.287) (-1433.792) -- 0:00:30
561500 -- (-1435.013) (-1436.976) (-1435.697) [-1435.046] * (-1433.219) (-1432.433) (-1435.302) [-1430.253] -- 0:00:30
562000 -- (-1435.439) (-1436.755) [-1433.876] (-1432.360) * (-1432.560) (-1433.642) (-1432.539) [-1433.025] -- 0:00:30
562500 -- (-1432.126) [-1433.061] (-1432.084) (-1434.294) * (-1433.227) (-1430.370) [-1430.336] (-1432.377) -- 0:00:30
563000 -- (-1433.959) (-1431.799) [-1431.595] (-1433.515) * (-1435.944) [-1432.475] (-1436.815) (-1432.560) -- 0:00:30
563500 -- [-1432.614] (-1431.484) (-1431.504) (-1431.019) * (-1439.143) (-1435.274) (-1436.127) [-1432.607] -- 0:00:30
564000 -- (-1435.625) (-1432.332) [-1432.445] (-1432.092) * (-1435.669) (-1430.924) (-1432.686) [-1432.421] -- 0:00:30
564500 -- (-1432.931) [-1434.872] (-1432.256) (-1433.835) * (-1432.903) (-1430.782) [-1431.807] (-1431.018) -- 0:00:30
565000 -- [-1431.734] (-1435.289) (-1433.242) (-1432.667) * (-1433.250) (-1432.450) (-1433.204) [-1432.071] -- 0:00:30
Average standard deviation of split frequencies: 0.007444
565500 -- (-1433.541) (-1435.544) [-1433.475] (-1433.387) * (-1434.599) [-1431.651] (-1432.450) (-1432.931) -- 0:00:29
566000 -- (-1435.394) (-1434.654) [-1432.656] (-1433.206) * (-1435.333) (-1431.787) [-1433.141] (-1432.803) -- 0:00:29
566500 -- (-1431.737) (-1434.140) (-1430.982) [-1432.812] * (-1434.630) [-1434.305] (-1436.257) (-1434.676) -- 0:00:29
567000 -- (-1434.115) (-1435.358) (-1433.743) [-1433.062] * (-1432.717) [-1431.785] (-1435.736) (-1433.717) -- 0:00:29
567500 -- [-1433.063] (-1438.206) (-1435.657) (-1434.576) * (-1433.142) (-1434.731) (-1436.958) [-1433.528] -- 0:00:29
568000 -- (-1434.441) (-1435.927) [-1430.530] (-1433.644) * (-1435.191) (-1431.948) [-1434.418] (-1432.014) -- 0:00:29
568500 -- (-1436.702) (-1433.232) (-1435.252) [-1431.520] * (-1434.422) (-1432.478) [-1436.088] (-1432.211) -- 0:00:29
569000 -- (-1433.919) [-1433.776] (-1431.557) (-1433.788) * (-1437.374) (-1435.030) [-1432.095] (-1432.748) -- 0:00:29
569500 -- (-1438.592) (-1434.027) (-1433.428) [-1433.629] * (-1434.158) (-1438.742) [-1432.558] (-1434.709) -- 0:00:29
570000 -- (-1433.504) (-1434.108) (-1434.256) [-1433.956] * [-1430.950] (-1432.408) (-1432.361) (-1436.945) -- 0:00:29
Average standard deviation of split frequencies: 0.007280
570500 -- (-1434.644) (-1435.120) (-1433.733) [-1430.553] * (-1437.118) [-1432.711] (-1434.769) (-1431.519) -- 0:00:29
571000 -- (-1431.481) (-1434.857) (-1436.704) [-1433.207] * [-1431.911] (-1431.454) (-1431.487) (-1433.475) -- 0:00:29
571500 -- (-1433.638) (-1432.708) (-1435.175) [-1431.017] * (-1436.126) [-1430.709] (-1432.632) (-1430.738) -- 0:00:29
572000 -- (-1432.760) (-1434.368) [-1431.926] (-1435.766) * (-1436.505) (-1433.355) (-1433.785) [-1433.152] -- 0:00:29
572500 -- (-1432.868) (-1432.505) [-1435.725] (-1434.858) * (-1436.529) (-1430.073) (-1432.101) [-1430.738] -- 0:00:29
573000 -- (-1432.514) [-1433.624] (-1436.800) (-1436.429) * [-1436.742] (-1431.404) (-1434.141) (-1432.299) -- 0:00:29
573500 -- (-1434.829) [-1435.394] (-1433.199) (-1430.877) * (-1434.735) (-1432.756) (-1433.190) [-1435.317] -- 0:00:29
574000 -- (-1433.780) (-1432.542) [-1430.591] (-1439.020) * (-1433.087) [-1433.113] (-1435.719) (-1438.301) -- 0:00:28
574500 -- (-1434.956) (-1431.516) [-1431.972] (-1433.625) * [-1432.989] (-1434.305) (-1433.240) (-1435.196) -- 0:00:28
575000 -- (-1437.450) [-1433.961] (-1436.564) (-1433.664) * (-1432.459) (-1433.674) (-1433.116) [-1435.399] -- 0:00:29
Average standard deviation of split frequencies: 0.007212
575500 -- (-1429.780) [-1432.613] (-1433.685) (-1432.851) * (-1433.328) (-1431.095) (-1432.422) [-1430.608] -- 0:00:29
576000 -- (-1435.045) (-1432.634) [-1432.768] (-1433.305) * (-1436.037) (-1431.116) [-1432.446] (-1431.951) -- 0:00:29
576500 -- (-1435.540) [-1431.657] (-1433.755) (-1433.142) * (-1433.826) (-1430.946) (-1432.019) [-1432.362] -- 0:00:29
577000 -- [-1434.900] (-1432.998) (-1431.353) (-1430.851) * (-1432.733) [-1434.230] (-1433.333) (-1435.966) -- 0:00:29
577500 -- (-1436.584) (-1433.121) [-1433.127] (-1433.733) * (-1435.773) (-1432.188) (-1433.600) [-1433.649] -- 0:00:29
578000 -- (-1433.980) [-1432.764] (-1433.995) (-1433.852) * (-1436.613) [-1432.961] (-1433.859) (-1430.923) -- 0:00:29
578500 -- [-1432.766] (-1432.374) (-1433.123) (-1434.273) * (-1433.008) [-1434.879] (-1433.181) (-1432.421) -- 0:00:29
579000 -- (-1435.967) (-1438.538) (-1432.978) [-1434.945] * (-1433.325) (-1434.365) [-1435.805] (-1430.986) -- 0:00:29
579500 -- (-1441.310) (-1434.118) [-1431.239] (-1433.471) * (-1432.058) (-1435.658) (-1435.117) [-1433.825] -- 0:00:29
580000 -- (-1442.112) [-1434.834] (-1433.626) (-1437.584) * [-1434.193] (-1433.217) (-1435.084) (-1431.418) -- 0:00:28
Average standard deviation of split frequencies: 0.007915
580500 -- [-1432.444] (-1440.751) (-1435.261) (-1433.129) * (-1436.424) [-1431.841] (-1438.154) (-1432.664) -- 0:00:28
581000 -- (-1432.649) [-1437.499] (-1436.316) (-1437.089) * [-1434.854] (-1432.404) (-1434.235) (-1432.605) -- 0:00:28
581500 -- (-1432.777) [-1432.723] (-1430.405) (-1436.865) * (-1433.824) (-1432.120) [-1432.771] (-1436.661) -- 0:00:28
582000 -- (-1434.401) (-1437.078) [-1431.612] (-1435.178) * (-1432.035) (-1433.403) [-1431.411] (-1433.419) -- 0:00:28
582500 -- [-1436.951] (-1435.671) (-1432.669) (-1433.446) * (-1433.435) (-1432.699) (-1432.781) [-1431.644] -- 0:00:28
583000 -- (-1436.849) (-1435.541) [-1432.391] (-1432.502) * (-1435.046) (-1431.994) (-1433.992) [-1432.999] -- 0:00:28
583500 -- (-1431.724) [-1433.937] (-1433.592) (-1433.920) * (-1433.892) (-1435.129) (-1438.385) [-1433.903] -- 0:00:28
584000 -- (-1433.861) [-1434.159] (-1433.264) (-1434.506) * (-1434.001) (-1434.900) [-1432.563] (-1431.715) -- 0:00:28
584500 -- (-1431.237) (-1432.212) [-1433.269] (-1435.886) * (-1432.083) [-1430.846] (-1433.667) (-1434.399) -- 0:00:28
585000 -- (-1435.764) (-1434.267) [-1432.714] (-1434.301) * (-1431.008) [-1433.029] (-1433.931) (-1435.000) -- 0:00:28
Average standard deviation of split frequencies: 0.007592
585500 -- (-1435.774) [-1432.474] (-1429.652) (-1432.933) * (-1432.961) (-1431.805) (-1434.253) [-1432.004] -- 0:00:28
586000 -- (-1433.789) (-1436.696) [-1434.485] (-1434.025) * (-1429.795) [-1432.069] (-1432.927) (-1431.747) -- 0:00:28
586500 -- (-1432.721) (-1430.671) (-1434.615) [-1432.662] * (-1430.842) (-1433.011) (-1431.074) [-1435.876] -- 0:00:28
587000 -- (-1433.464) [-1432.413] (-1431.688) (-1435.285) * [-1432.548] (-1431.156) (-1430.688) (-1431.994) -- 0:00:28
587500 -- (-1437.690) [-1433.838] (-1435.830) (-1431.732) * [-1432.917] (-1435.073) (-1430.127) (-1431.727) -- 0:00:28
588000 -- [-1433.683] (-1434.848) (-1434.629) (-1431.623) * (-1433.201) [-1431.212] (-1433.152) (-1433.219) -- 0:00:28
588500 -- (-1431.126) (-1433.154) (-1431.729) [-1431.323] * (-1431.349) [-1431.811] (-1432.275) (-1436.006) -- 0:00:27
589000 -- (-1431.638) [-1434.803] (-1435.843) (-1430.565) * (-1432.425) (-1432.745) (-1431.972) [-1432.468] -- 0:00:27
589500 -- (-1437.051) [-1432.946] (-1433.038) (-1433.264) * [-1430.643] (-1430.400) (-1434.550) (-1436.232) -- 0:00:27
590000 -- (-1440.241) [-1437.885] (-1431.801) (-1430.821) * [-1432.662] (-1432.139) (-1433.088) (-1435.632) -- 0:00:28
Average standard deviation of split frequencies: 0.007532
590500 -- (-1431.377) [-1435.004] (-1436.372) (-1436.886) * (-1429.862) [-1434.734] (-1432.762) (-1434.930) -- 0:00:28
591000 -- [-1432.250] (-1436.963) (-1433.073) (-1433.719) * (-1433.066) [-1430.226] (-1432.814) (-1435.438) -- 0:00:28
591500 -- (-1433.016) (-1435.168) [-1431.379] (-1432.166) * (-1434.147) (-1431.982) [-1433.154] (-1434.401) -- 0:00:28
592000 -- (-1432.916) (-1434.035) (-1433.680) [-1433.644] * (-1433.430) (-1432.160) (-1429.838) [-1432.705] -- 0:00:28
592500 -- [-1437.316] (-1433.972) (-1434.411) (-1432.232) * (-1431.834) (-1434.165) [-1430.863] (-1438.082) -- 0:00:28
593000 -- (-1431.477) (-1433.210) (-1434.762) [-1433.227] * (-1433.374) (-1436.177) [-1436.486] (-1432.069) -- 0:00:28
593500 -- (-1435.421) (-1436.539) [-1433.565] (-1434.524) * (-1432.639) (-1432.642) (-1437.270) [-1432.134] -- 0:00:28
594000 -- (-1435.388) (-1431.707) (-1432.417) [-1432.367] * (-1437.207) (-1432.537) (-1432.335) [-1430.396] -- 0:00:28
594500 -- [-1433.026] (-1431.818) (-1433.510) (-1432.746) * (-1436.485) (-1434.145) (-1432.162) [-1430.649] -- 0:00:27
595000 -- [-1433.215] (-1432.196) (-1435.045) (-1432.758) * (-1433.325) (-1436.841) (-1431.995) [-1430.134] -- 0:00:27
Average standard deviation of split frequencies: 0.007366
595500 -- [-1434.377] (-1433.371) (-1434.361) (-1435.695) * (-1432.954) [-1435.041] (-1431.060) (-1431.412) -- 0:00:27
596000 -- (-1435.776) (-1433.253) [-1433.268] (-1433.537) * (-1430.920) (-1434.979) (-1430.229) [-1435.063] -- 0:00:27
596500 -- (-1433.065) (-1429.475) (-1434.840) [-1430.328] * (-1435.177) (-1430.532) (-1431.975) [-1432.600] -- 0:00:27
597000 -- (-1432.064) (-1431.347) (-1435.644) [-1432.332] * (-1432.351) (-1436.512) [-1433.598] (-1431.906) -- 0:00:27
597500 -- [-1433.233] (-1433.251) (-1432.080) (-1430.995) * (-1433.545) (-1436.829) [-1434.860] (-1431.616) -- 0:00:27
598000 -- [-1433.991] (-1435.999) (-1433.413) (-1434.719) * (-1434.212) [-1435.396] (-1432.301) (-1431.095) -- 0:00:27
598500 -- [-1433.398] (-1435.137) (-1430.565) (-1434.707) * (-1433.911) [-1434.628] (-1433.786) (-1435.482) -- 0:00:27
599000 -- (-1436.229) (-1435.487) [-1434.418] (-1436.749) * (-1436.607) (-1431.860) [-1435.260] (-1434.418) -- 0:00:27
599500 -- (-1434.872) [-1432.505] (-1439.210) (-1431.925) * (-1435.001) (-1435.351) (-1436.419) [-1431.682] -- 0:00:27
600000 -- (-1433.616) (-1434.467) (-1432.630) [-1433.820] * [-1435.849] (-1435.559) (-1435.103) (-1431.210) -- 0:00:27
Average standard deviation of split frequencies: 0.007358
600500 -- (-1432.983) [-1432.928] (-1433.466) (-1432.972) * [-1434.375] (-1433.075) (-1435.742) (-1433.438) -- 0:00:27
601000 -- (-1433.114) (-1433.906) [-1435.026] (-1434.320) * [-1433.745] (-1436.577) (-1435.232) (-1434.498) -- 0:00:27
601500 -- (-1430.501) (-1434.012) [-1433.323] (-1435.387) * (-1436.688) [-1431.825] (-1433.001) (-1432.717) -- 0:00:27
602000 -- (-1436.838) (-1433.354) (-1436.253) [-1435.390] * (-1437.248) [-1431.218] (-1430.697) (-1434.077) -- 0:00:27
602500 -- (-1434.830) (-1434.223) [-1436.325] (-1437.090) * (-1434.285) [-1433.325] (-1432.595) (-1432.748) -- 0:00:27
603000 -- [-1431.477] (-1433.136) (-1435.517) (-1433.030) * (-1432.763) (-1434.927) [-1435.442] (-1432.871) -- 0:00:26
603500 -- (-1430.419) (-1433.548) [-1432.360] (-1434.837) * [-1431.688] (-1434.554) (-1437.940) (-1430.802) -- 0:00:26
604000 -- (-1434.123) (-1432.844) [-1433.128] (-1432.137) * (-1433.134) (-1432.061) (-1434.928) [-1434.383] -- 0:00:26
604500 -- (-1433.243) [-1431.619] (-1434.599) (-1433.341) * (-1432.415) (-1434.087) (-1432.806) [-1434.442] -- 0:00:27
605000 -- (-1433.973) (-1435.254) (-1434.472) [-1432.381] * (-1433.246) (-1431.263) (-1434.593) [-1433.630] -- 0:00:27
Average standard deviation of split frequencies: 0.007633
605500 -- [-1433.501] (-1434.475) (-1433.505) (-1435.470) * (-1436.855) (-1433.128) (-1438.997) [-1431.652] -- 0:00:27
606000 -- [-1440.066] (-1435.887) (-1434.124) (-1432.960) * (-1432.933) (-1435.302) [-1434.997] (-1434.024) -- 0:00:27
606500 -- (-1439.104) [-1433.421] (-1433.417) (-1431.688) * (-1434.840) (-1433.235) [-1435.514] (-1433.327) -- 0:00:27
607000 -- [-1431.339] (-1436.700) (-1431.989) (-1434.698) * (-1434.507) [-1430.658] (-1440.488) (-1434.871) -- 0:00:27
607500 -- (-1433.726) (-1433.352) (-1434.851) [-1436.116] * (-1435.634) (-1432.928) [-1434.876] (-1435.868) -- 0:00:27
608000 -- [-1432.614] (-1433.450) (-1436.119) (-1435.941) * (-1434.164) (-1432.245) (-1434.847) [-1434.637] -- 0:00:27
608500 -- (-1430.290) (-1433.231) (-1432.740) [-1433.328] * (-1433.223) [-1432.611] (-1435.711) (-1432.300) -- 0:00:27
609000 -- (-1432.620) (-1431.730) (-1431.669) [-1431.588] * (-1430.684) (-1435.802) (-1435.815) [-1433.100] -- 0:00:26
609500 -- (-1433.766) [-1432.819] (-1433.059) (-1429.624) * [-1432.196] (-1433.144) (-1432.697) (-1434.152) -- 0:00:26
610000 -- (-1433.892) (-1436.064) [-1433.016] (-1436.436) * (-1431.403) [-1432.768] (-1435.890) (-1433.268) -- 0:00:26
Average standard deviation of split frequencies: 0.006755
610500 -- (-1433.051) [-1433.509] (-1433.194) (-1433.369) * (-1435.306) (-1437.232) (-1433.371) [-1432.536] -- 0:00:26
611000 -- [-1431.613] (-1434.676) (-1432.447) (-1433.030) * (-1433.870) (-1434.136) [-1434.935] (-1432.667) -- 0:00:26
611500 -- [-1435.771] (-1431.964) (-1431.957) (-1433.510) * [-1431.762] (-1434.531) (-1435.852) (-1434.116) -- 0:00:26
612000 -- [-1433.066] (-1432.332) (-1435.474) (-1433.634) * (-1433.273) (-1432.728) [-1433.236] (-1432.934) -- 0:00:26
612500 -- (-1432.741) (-1432.492) [-1435.865] (-1434.894) * (-1433.024) (-1432.490) (-1433.663) [-1432.403] -- 0:00:26
613000 -- (-1434.178) (-1435.194) [-1433.524] (-1434.845) * (-1434.870) (-1432.926) [-1433.930] (-1432.165) -- 0:00:26
613500 -- (-1431.029) (-1433.511) [-1434.182] (-1433.238) * (-1435.495) (-1433.450) [-1433.422] (-1438.874) -- 0:00:26
614000 -- (-1435.218) (-1435.634) (-1434.330) [-1433.893] * [-1432.074] (-1439.217) (-1433.756) (-1434.378) -- 0:00:26
614500 -- [-1433.927] (-1434.393) (-1433.122) (-1437.471) * [-1430.798] (-1434.780) (-1435.643) (-1432.591) -- 0:00:26
615000 -- [-1435.407] (-1433.427) (-1435.274) (-1435.627) * (-1431.050) (-1433.951) [-1434.646] (-1432.368) -- 0:00:26
Average standard deviation of split frequencies: 0.006074
615500 -- (-1437.615) [-1433.109] (-1437.125) (-1434.245) * (-1431.467) [-1430.327] (-1438.393) (-1437.257) -- 0:00:26
616000 -- (-1435.048) [-1434.160] (-1435.940) (-1432.744) * (-1433.545) [-1434.029] (-1433.216) (-1434.205) -- 0:00:26
616500 -- (-1435.884) [-1431.796] (-1431.742) (-1431.895) * (-1433.111) [-1430.726] (-1432.607) (-1434.927) -- 0:00:26
617000 -- (-1434.353) (-1433.024) [-1432.734] (-1436.484) * [-1433.887] (-1435.963) (-1435.802) (-1434.015) -- 0:00:26
617500 -- (-1433.025) (-1434.138) (-1431.278) [-1431.968] * (-1433.066) [-1433.100] (-1432.696) (-1434.061) -- 0:00:26
618000 -- (-1436.212) (-1434.186) (-1431.828) [-1432.696] * [-1431.567] (-1432.720) (-1434.280) (-1432.254) -- 0:00:25
618500 -- (-1436.619) (-1437.798) [-1430.840] (-1433.377) * (-1432.866) (-1437.944) (-1435.030) [-1432.446] -- 0:00:25
619000 -- (-1431.805) [-1433.717] (-1434.515) (-1432.261) * (-1433.626) (-1440.505) (-1432.706) [-1432.449] -- 0:00:26
619500 -- [-1431.392] (-1432.676) (-1430.321) (-1432.947) * (-1435.852) (-1439.791) [-1433.901] (-1434.030) -- 0:00:26
620000 -- [-1433.086] (-1434.353) (-1434.205) (-1433.979) * (-1437.056) [-1433.136] (-1433.340) (-1432.175) -- 0:00:26
Average standard deviation of split frequencies: 0.006171
620500 -- [-1432.524] (-1433.813) (-1432.671) (-1432.456) * (-1433.094) [-1430.767] (-1435.045) (-1431.959) -- 0:00:26
621000 -- (-1435.482) [-1432.875] (-1433.056) (-1434.540) * (-1433.506) (-1432.403) (-1434.406) [-1432.454] -- 0:00:26
621500 -- [-1433.336] (-1433.813) (-1432.312) (-1434.282) * (-1431.049) [-1434.028] (-1436.624) (-1432.294) -- 0:00:26
622000 -- [-1432.263] (-1437.779) (-1432.612) (-1436.123) * (-1432.808) (-1432.942) (-1433.775) [-1431.948] -- 0:00:26
622500 -- (-1431.211) (-1436.717) [-1431.723] (-1432.719) * (-1430.832) (-1434.969) (-1432.444) [-1431.410] -- 0:00:26
623000 -- (-1430.282) (-1434.442) (-1436.181) [-1431.557] * (-1436.435) (-1436.584) (-1433.344) [-1434.678] -- 0:00:26
623500 -- (-1436.862) (-1434.656) [-1435.554] (-1429.625) * (-1433.903) [-1434.286] (-1432.984) (-1432.213) -- 0:00:25
624000 -- (-1432.400) (-1434.080) [-1432.408] (-1433.069) * (-1438.300) (-1431.748) (-1433.188) [-1431.434] -- 0:00:25
624500 -- (-1433.667) (-1434.415) (-1434.143) [-1431.398] * (-1435.568) (-1433.290) [-1433.758] (-1434.413) -- 0:00:25
625000 -- [-1434.156] (-1431.916) (-1437.203) (-1436.459) * [-1433.605] (-1432.972) (-1434.075) (-1434.908) -- 0:00:25
Average standard deviation of split frequencies: 0.006166
625500 -- (-1434.738) (-1433.496) (-1433.082) [-1431.332] * [-1436.083] (-1432.930) (-1433.455) (-1439.775) -- 0:00:25
626000 -- (-1432.810) (-1435.793) [-1434.629] (-1432.032) * (-1436.636) [-1435.050] (-1434.406) (-1433.551) -- 0:00:25
626500 -- (-1433.290) (-1431.158) (-1432.688) [-1434.792] * (-1432.505) [-1432.780] (-1433.940) (-1432.044) -- 0:00:25
627000 -- (-1433.815) [-1434.793] (-1432.512) (-1432.502) * (-1433.709) [-1431.887] (-1431.763) (-1436.961) -- 0:00:25
627500 -- [-1430.572] (-1437.016) (-1433.885) (-1432.411) * [-1434.369] (-1434.960) (-1435.118) (-1433.546) -- 0:00:25
628000 -- [-1435.003] (-1433.859) (-1432.371) (-1431.610) * (-1432.514) (-1432.444) (-1434.087) [-1434.884] -- 0:00:25
628500 -- (-1433.195) (-1431.289) (-1435.721) [-1431.533] * (-1433.715) [-1435.431] (-1439.908) (-1434.906) -- 0:00:25
629000 -- [-1433.658] (-1434.378) (-1437.878) (-1433.481) * [-1433.789] (-1431.281) (-1431.886) (-1435.719) -- 0:00:25
629500 -- [-1431.836] (-1431.816) (-1434.038) (-1434.361) * (-1436.232) (-1429.883) (-1435.307) [-1431.878] -- 0:00:25
630000 -- (-1431.715) [-1429.917] (-1435.739) (-1434.401) * (-1430.700) (-1433.098) [-1434.148] (-1437.044) -- 0:00:25
Average standard deviation of split frequencies: 0.006400
630500 -- (-1434.019) (-1433.661) (-1436.264) [-1431.443] * (-1431.680) (-1435.478) [-1433.061] (-1434.538) -- 0:00:25
631000 -- [-1433.797] (-1435.782) (-1436.345) (-1433.017) * (-1432.587) (-1440.427) [-1433.383] (-1435.816) -- 0:00:25
631500 -- (-1433.588) (-1435.848) [-1433.431] (-1433.435) * [-1435.217] (-1434.945) (-1434.204) (-1435.962) -- 0:00:25
632000 -- (-1432.403) (-1432.437) [-1435.531] (-1432.541) * [-1433.026] (-1437.299) (-1432.789) (-1432.602) -- 0:00:25
632500 -- (-1431.268) [-1434.018] (-1431.346) (-1433.889) * [-1432.708] (-1437.933) (-1430.672) (-1432.008) -- 0:00:24
633000 -- [-1435.529] (-1438.305) (-1431.289) (-1435.062) * (-1438.639) [-1433.205] (-1432.570) (-1433.311) -- 0:00:24
633500 -- (-1433.237) (-1433.819) [-1432.436] (-1432.205) * [-1435.285] (-1431.570) (-1439.343) (-1432.966) -- 0:00:24
634000 -- (-1434.012) (-1432.041) (-1434.025) [-1433.084] * (-1435.251) (-1432.850) [-1436.107] (-1433.876) -- 0:00:25
634500 -- [-1431.761] (-1432.102) (-1432.825) (-1435.174) * (-1433.431) (-1433.747) [-1433.509] (-1433.412) -- 0:00:25
635000 -- (-1433.752) (-1438.469) [-1432.941] (-1435.931) * (-1433.322) [-1434.275] (-1433.303) (-1431.859) -- 0:00:25
Average standard deviation of split frequencies: 0.005930
635500 -- (-1433.451) (-1435.144) (-1432.891) [-1434.306] * [-1435.260] (-1433.302) (-1435.321) (-1436.059) -- 0:00:25
636000 -- (-1430.888) (-1434.125) [-1435.039] (-1433.405) * (-1432.907) (-1435.064) (-1435.832) [-1434.793] -- 0:00:25
636500 -- (-1433.109) (-1433.585) (-1431.536) [-1433.177] * (-1434.901) (-1433.979) (-1433.017) [-1434.189] -- 0:00:25
637000 -- (-1434.958) (-1435.090) [-1430.496] (-1432.310) * [-1435.903] (-1435.869) (-1433.426) (-1435.111) -- 0:00:25
637500 -- [-1433.489] (-1432.961) (-1439.551) (-1430.806) * (-1437.779) (-1432.433) (-1431.509) [-1433.438] -- 0:00:25
638000 -- (-1433.626) [-1432.353] (-1433.558) (-1433.466) * (-1433.082) (-1432.808) (-1435.387) [-1432.456] -- 0:00:24
638500 -- (-1431.730) (-1433.583) (-1434.522) [-1435.578] * (-1433.663) (-1437.724) [-1433.400] (-1433.766) -- 0:00:24
639000 -- (-1432.451) (-1434.964) (-1435.536) [-1431.580] * [-1436.673] (-1436.046) (-1435.662) (-1434.451) -- 0:00:24
639500 -- [-1434.680] (-1435.843) (-1432.187) (-1433.707) * (-1436.254) [-1434.586] (-1431.298) (-1437.633) -- 0:00:24
640000 -- [-1433.111] (-1432.037) (-1433.723) (-1436.125) * (-1435.828) (-1433.223) [-1432.853] (-1433.833) -- 0:00:24
Average standard deviation of split frequencies: 0.005978
640500 -- (-1432.934) (-1430.650) [-1431.690] (-1436.249) * [-1432.755] (-1435.984) (-1433.515) (-1434.893) -- 0:00:24
641000 -- [-1431.738] (-1434.832) (-1435.691) (-1434.014) * [-1435.996] (-1432.975) (-1432.618) (-1433.694) -- 0:00:24
641500 -- (-1430.788) [-1434.055] (-1433.641) (-1436.536) * (-1432.901) (-1435.396) [-1435.336] (-1433.847) -- 0:00:24
642000 -- (-1430.363) (-1434.787) [-1434.864] (-1437.229) * (-1435.318) (-1433.633) [-1433.318] (-1437.910) -- 0:00:24
642500 -- (-1431.980) (-1433.850) [-1433.157] (-1435.453) * (-1433.034) (-1435.650) [-1431.186] (-1438.940) -- 0:00:24
643000 -- (-1433.549) (-1431.365) (-1434.281) [-1436.226] * (-1434.705) (-1433.006) [-1432.438] (-1437.632) -- 0:00:24
643500 -- (-1434.130) (-1434.411) [-1435.400] (-1438.560) * (-1439.222) [-1435.582] (-1431.404) (-1437.656) -- 0:00:24
644000 -- (-1434.800) (-1432.282) [-1434.778] (-1431.379) * (-1436.326) (-1433.400) (-1435.115) [-1433.767] -- 0:00:24
644500 -- (-1440.471) (-1434.139) [-1432.915] (-1431.908) * (-1435.017) (-1438.355) [-1434.282] (-1432.865) -- 0:00:24
645000 -- (-1437.680) [-1433.248] (-1435.578) (-1433.511) * [-1432.994] (-1434.916) (-1434.368) (-1433.324) -- 0:00:24
Average standard deviation of split frequencies: 0.005701
645500 -- [-1433.919] (-1437.605) (-1433.591) (-1430.346) * (-1434.436) (-1434.284) [-1436.092] (-1430.427) -- 0:00:24
646000 -- (-1432.806) (-1434.956) (-1435.015) [-1430.114] * (-1434.737) (-1437.031) [-1431.548] (-1432.450) -- 0:00:24
646500 -- (-1431.724) (-1433.357) [-1433.799] (-1435.959) * (-1434.328) (-1435.432) [-1435.839] (-1433.784) -- 0:00:24
647000 -- (-1433.351) [-1433.587] (-1434.382) (-1436.591) * (-1431.448) [-1431.928] (-1435.416) (-1434.891) -- 0:00:24
647500 -- (-1432.916) (-1432.870) (-1432.947) [-1436.427] * (-1440.293) [-1433.444] (-1434.122) (-1433.281) -- 0:00:23
648000 -- (-1431.033) (-1433.176) (-1437.404) [-1434.204] * (-1436.907) [-1432.267] (-1431.387) (-1433.409) -- 0:00:23
648500 -- (-1430.303) (-1432.397) [-1438.172] (-1435.743) * [-1433.802] (-1433.275) (-1432.203) (-1430.742) -- 0:00:24
649000 -- [-1431.518] (-1434.182) (-1436.141) (-1430.966) * (-1433.756) [-1434.597] (-1433.146) (-1431.834) -- 0:00:24
649500 -- (-1432.258) (-1432.844) [-1431.132] (-1432.742) * [-1433.299] (-1434.340) (-1435.179) (-1431.833) -- 0:00:24
650000 -- (-1433.816) (-1434.416) (-1432.929) [-1432.634] * (-1434.896) [-1433.433] (-1431.390) (-1435.207) -- 0:00:24
Average standard deviation of split frequencies: 0.006113
650500 -- (-1432.783) (-1432.928) [-1435.875] (-1430.592) * [-1434.963] (-1437.090) (-1432.612) (-1435.809) -- 0:00:24
651000 -- [-1436.294] (-1433.481) (-1438.153) (-1438.586) * [-1434.144] (-1436.462) (-1435.748) (-1434.233) -- 0:00:24
651500 -- (-1435.878) (-1434.404) (-1435.225) [-1432.712] * (-1435.748) (-1436.316) [-1434.401] (-1435.896) -- 0:00:24
652000 -- [-1433.856] (-1435.101) (-1434.380) (-1432.023) * [-1439.423] (-1432.207) (-1433.134) (-1431.871) -- 0:00:24
652500 -- (-1433.781) (-1433.744) [-1432.964] (-1430.582) * [-1434.571] (-1432.804) (-1434.430) (-1433.836) -- 0:00:23
653000 -- (-1433.099) (-1434.102) (-1431.088) [-1433.661] * [-1432.555] (-1432.100) (-1434.917) (-1430.579) -- 0:00:23
653500 -- (-1432.835) [-1436.231] (-1431.586) (-1435.049) * [-1435.832] (-1432.537) (-1434.663) (-1432.363) -- 0:00:23
654000 -- [-1432.012] (-1435.838) (-1434.376) (-1434.529) * (-1437.882) (-1433.904) [-1433.014] (-1432.178) -- 0:00:23
654500 -- (-1434.391) (-1435.757) [-1432.464] (-1435.623) * (-1435.493) (-1433.295) (-1434.737) [-1431.164] -- 0:00:23
655000 -- (-1434.107) (-1435.118) (-1437.835) [-1435.139] * [-1435.438] (-1433.055) (-1435.142) (-1430.734) -- 0:00:23
Average standard deviation of split frequencies: 0.005973
655500 -- (-1433.654) (-1433.540) [-1433.979] (-1434.162) * (-1432.611) (-1434.438) (-1432.632) [-1435.803] -- 0:00:23
656000 -- (-1433.873) [-1432.849] (-1435.057) (-1431.695) * [-1432.047] (-1432.834) (-1432.845) (-1431.193) -- 0:00:23
656500 -- (-1432.099) (-1432.397) [-1435.695] (-1435.614) * [-1436.213] (-1434.697) (-1433.746) (-1433.222) -- 0:00:23
657000 -- (-1434.580) [-1431.344] (-1435.265) (-1433.948) * [-1432.749] (-1431.974) (-1434.778) (-1434.972) -- 0:00:23
657500 -- (-1435.556) [-1434.860] (-1431.009) (-1432.459) * (-1433.312) (-1434.348) (-1434.697) [-1431.835] -- 0:00:23
658000 -- (-1434.475) (-1435.094) [-1433.408] (-1436.494) * [-1436.213] (-1434.651) (-1435.347) (-1433.168) -- 0:00:23
658500 -- (-1434.422) (-1434.767) [-1432.998] (-1440.559) * (-1434.367) (-1433.037) [-1432.881] (-1436.886) -- 0:00:23
659000 -- [-1432.627] (-1434.384) (-1434.295) (-1440.352) * (-1431.607) (-1433.858) (-1433.563) [-1432.437] -- 0:00:23
659500 -- (-1434.573) (-1436.208) (-1434.585) [-1433.444] * (-1436.023) (-1433.330) [-1434.510] (-1439.260) -- 0:00:23
660000 -- (-1433.545) [-1433.772] (-1432.934) (-1434.563) * (-1437.225) [-1435.728] (-1434.492) (-1433.472) -- 0:00:23
Average standard deviation of split frequencies: 0.006110
660500 -- [-1434.485] (-1435.585) (-1433.996) (-1433.600) * [-1437.594] (-1431.560) (-1434.844) (-1433.011) -- 0:00:23
661000 -- (-1434.611) (-1435.749) (-1433.748) [-1434.287] * [-1432.574] (-1433.983) (-1442.404) (-1434.727) -- 0:00:23
661500 -- (-1434.081) (-1434.624) [-1436.383] (-1439.479) * (-1434.397) (-1433.605) [-1431.343] (-1431.650) -- 0:00:23
662000 -- [-1436.607] (-1434.892) (-1434.723) (-1437.890) * [-1432.575] (-1433.529) (-1433.826) (-1431.709) -- 0:00:22
662500 -- (-1432.605) (-1435.519) (-1436.891) [-1433.131] * (-1433.876) (-1433.275) [-1432.962] (-1432.013) -- 0:00:22
663000 -- (-1431.449) [-1434.471] (-1433.276) (-1432.805) * [-1435.463] (-1433.513) (-1436.902) (-1431.715) -- 0:00:22
663500 -- (-1432.475) (-1434.899) (-1434.145) [-1433.700] * (-1439.616) (-1433.073) (-1436.977) [-1431.987] -- 0:00:23
664000 -- (-1433.708) (-1435.728) [-1432.030] (-1432.811) * (-1434.971) [-1432.943] (-1435.402) (-1431.112) -- 0:00:23
664500 -- (-1432.292) (-1431.410) [-1429.967] (-1434.383) * (-1436.213) [-1434.195] (-1433.627) (-1430.365) -- 0:00:23
665000 -- [-1433.850] (-1432.462) (-1434.174) (-1436.989) * [-1433.227] (-1434.011) (-1435.170) (-1433.384) -- 0:00:23
Average standard deviation of split frequencies: 0.006105
665500 -- (-1434.121) (-1431.467) [-1430.602] (-1432.728) * [-1433.480] (-1434.181) (-1436.305) (-1433.871) -- 0:00:23
666000 -- [-1430.736] (-1431.563) (-1431.854) (-1436.243) * [-1435.135] (-1431.701) (-1439.473) (-1435.681) -- 0:00:23
666500 -- (-1430.924) (-1432.873) [-1431.648] (-1440.066) * (-1435.474) [-1432.672] (-1433.795) (-1435.925) -- 0:00:23
667000 -- [-1431.832] (-1436.776) (-1434.125) (-1433.211) * (-1434.550) [-1436.650] (-1433.573) (-1433.462) -- 0:00:22
667500 -- (-1432.488) (-1438.467) (-1432.222) [-1434.422] * (-1435.688) (-1431.195) [-1432.370] (-1433.063) -- 0:00:22
668000 -- (-1432.477) (-1431.512) [-1433.312] (-1433.926) * (-1434.529) (-1433.462) (-1434.136) [-1433.759] -- 0:00:22
668500 -- (-1434.238) [-1434.005] (-1432.651) (-1431.000) * (-1432.779) (-1434.396) (-1431.277) [-1432.300] -- 0:00:22
669000 -- (-1435.277) [-1433.376] (-1434.267) (-1434.176) * (-1431.432) (-1436.856) [-1434.329] (-1434.384) -- 0:00:22
669500 -- (-1432.667) (-1436.939) [-1433.904] (-1432.465) * (-1432.119) (-1434.664) [-1430.871] (-1435.661) -- 0:00:22
670000 -- (-1431.897) [-1432.954] (-1435.392) (-1436.130) * [-1433.304] (-1432.507) (-1433.066) (-1435.921) -- 0:00:22
Average standard deviation of split frequencies: 0.006194
670500 -- (-1432.015) (-1434.319) (-1436.448) [-1436.665] * (-1430.835) [-1434.414] (-1431.979) (-1438.015) -- 0:00:22
671000 -- [-1432.632] (-1433.899) (-1430.826) (-1432.276) * (-1432.812) [-1431.869] (-1433.751) (-1433.220) -- 0:00:22
671500 -- (-1434.858) (-1436.083) (-1431.527) [-1434.216] * (-1434.331) [-1430.717] (-1434.070) (-1433.394) -- 0:00:22
672000 -- [-1432.830] (-1433.014) (-1431.668) (-1437.137) * (-1432.562) [-1434.965] (-1433.455) (-1433.315) -- 0:00:22
672500 -- [-1431.886] (-1434.697) (-1431.521) (-1434.223) * (-1432.655) (-1434.778) [-1432.524] (-1435.873) -- 0:00:22
673000 -- (-1431.551) (-1432.212) (-1435.534) [-1433.500] * [-1435.962] (-1434.721) (-1434.237) (-1438.780) -- 0:00:22
673500 -- [-1433.583] (-1432.856) (-1433.208) (-1435.157) * (-1432.668) [-1431.675] (-1432.543) (-1433.965) -- 0:00:22
674000 -- (-1433.110) (-1433.638) [-1432.357] (-1434.497) * (-1433.202) [-1433.618] (-1437.448) (-1430.417) -- 0:00:22
674500 -- [-1436.167] (-1438.354) (-1431.413) (-1433.692) * (-1431.951) (-1432.942) [-1431.729] (-1433.601) -- 0:00:22
675000 -- (-1434.092) (-1432.750) (-1434.140) [-1432.764] * (-1434.736) (-1434.002) [-1432.953] (-1432.160) -- 0:00:22
Average standard deviation of split frequencies: 0.006625
675500 -- (-1433.670) (-1433.529) (-1430.091) [-1433.495] * (-1436.092) [-1431.889] (-1436.558) (-1431.456) -- 0:00:22
676000 -- (-1433.501) (-1434.074) [-1435.409] (-1433.835) * [-1432.774] (-1430.692) (-1432.286) (-1436.817) -- 0:00:22
676500 -- (-1433.262) (-1436.425) [-1435.361] (-1432.177) * [-1432.391] (-1433.347) (-1433.667) (-1435.871) -- 0:00:21
677000 -- (-1432.994) (-1434.055) [-1433.380] (-1434.055) * (-1435.480) [-1432.477] (-1432.198) (-1433.348) -- 0:00:21
677500 -- (-1434.410) (-1431.929) [-1433.713] (-1433.239) * (-1432.825) (-1432.323) [-1432.756] (-1433.994) -- 0:00:21
678000 -- (-1432.215) (-1431.881) (-1433.107) [-1433.344] * (-1437.161) (-1436.020) [-1431.538] (-1432.060) -- 0:00:22
678500 -- [-1432.901] (-1431.028) (-1435.105) (-1434.613) * (-1432.406) (-1436.378) (-1431.258) [-1433.821] -- 0:00:22
679000 -- (-1435.613) (-1431.590) [-1434.265] (-1434.839) * [-1435.167] (-1433.644) (-1431.767) (-1435.240) -- 0:00:22
679500 -- [-1441.452] (-1431.094) (-1437.308) (-1434.652) * (-1434.592) (-1434.827) (-1431.132) [-1433.491] -- 0:00:22
680000 -- [-1436.803] (-1433.829) (-1433.664) (-1436.407) * (-1434.592) (-1432.674) [-1433.688] (-1435.843) -- 0:00:22
Average standard deviation of split frequencies: 0.006233
680500 -- [-1434.055] (-1434.614) (-1435.181) (-1435.789) * [-1433.495] (-1436.195) (-1433.321) (-1433.589) -- 0:00:22
681000 -- (-1431.186) (-1433.115) (-1434.344) [-1433.483] * (-1439.032) (-1439.755) (-1433.850) [-1435.508] -- 0:00:22
681500 -- (-1433.964) (-1431.414) (-1433.190) [-1436.323] * (-1432.924) [-1439.715] (-1436.714) (-1434.758) -- 0:00:21
682000 -- [-1436.464] (-1433.013) (-1436.046) (-1435.808) * (-1431.733) (-1438.575) (-1432.407) [-1431.805] -- 0:00:21
682500 -- [-1436.031] (-1431.260) (-1434.642) (-1436.646) * (-1432.784) (-1435.421) [-1433.651] (-1431.627) -- 0:00:21
683000 -- (-1432.752) [-1437.169] (-1437.067) (-1436.538) * (-1433.126) [-1433.309] (-1434.310) (-1431.641) -- 0:00:21
683500 -- (-1434.880) [-1433.029] (-1434.892) (-1434.129) * (-1431.710) (-1432.331) [-1433.810] (-1433.745) -- 0:00:21
684000 -- (-1433.373) (-1432.298) [-1435.531] (-1434.818) * (-1433.493) (-1433.467) (-1437.785) [-1436.806] -- 0:00:21
684500 -- [-1433.848] (-1431.087) (-1436.253) (-1436.280) * [-1434.238] (-1433.327) (-1435.066) (-1434.604) -- 0:00:21
685000 -- (-1435.037) (-1432.402) (-1431.570) [-1432.108] * (-1439.930) [-1430.588] (-1434.097) (-1432.491) -- 0:00:21
Average standard deviation of split frequencies: 0.006442
685500 -- [-1431.326] (-1435.541) (-1431.074) (-1435.089) * [-1433.217] (-1434.880) (-1434.376) (-1435.342) -- 0:00:21
686000 -- (-1431.238) [-1433.692] (-1432.407) (-1433.540) * [-1433.057] (-1435.869) (-1432.761) (-1435.656) -- 0:00:21
686500 -- [-1434.539] (-1436.882) (-1434.393) (-1432.750) * (-1434.539) (-1436.304) [-1434.602] (-1432.066) -- 0:00:21
687000 -- (-1432.140) (-1433.928) [-1433.440] (-1433.469) * (-1433.905) (-1435.573) (-1436.429) [-1433.514] -- 0:00:21
687500 -- (-1435.002) [-1431.307] (-1432.902) (-1434.528) * (-1432.485) [-1433.830] (-1430.816) (-1432.276) -- 0:00:21
688000 -- (-1431.860) (-1433.342) [-1435.464] (-1436.774) * [-1433.139] (-1439.709) (-1435.371) (-1431.818) -- 0:00:21
688500 -- (-1433.399) (-1434.691) (-1431.576) [-1433.802] * (-1433.305) (-1434.990) (-1432.632) [-1432.064] -- 0:00:21
689000 -- (-1434.722) [-1434.669] (-1431.571) (-1433.316) * (-1433.594) [-1432.231] (-1430.650) (-1431.837) -- 0:00:21
689500 -- (-1433.285) (-1434.966) [-1431.146] (-1432.175) * (-1431.615) [-1434.107] (-1432.751) (-1433.255) -- 0:00:21
690000 -- (-1433.243) (-1434.528) (-1433.230) [-1431.682] * (-1433.616) (-1435.747) (-1433.572) [-1433.254] -- 0:00:21
Average standard deviation of split frequencies: 0.006783
690500 -- (-1434.862) (-1433.165) (-1432.998) [-1431.216] * [-1432.225] (-1434.273) (-1433.287) (-1430.976) -- 0:00:21
691000 -- (-1434.085) [-1431.364] (-1435.771) (-1432.406) * (-1434.554) (-1434.795) [-1434.430] (-1431.608) -- 0:00:21
691500 -- (-1434.660) (-1434.009) (-1433.533) [-1433.650] * (-1431.939) (-1436.377) (-1435.717) [-1430.400] -- 0:00:20
692000 -- (-1432.778) (-1436.873) [-1431.587] (-1432.261) * (-1434.288) (-1436.043) (-1433.515) [-1434.738] -- 0:00:20
692500 -- (-1432.420) (-1435.744) (-1435.751) [-1432.221] * (-1439.088) (-1434.233) (-1433.403) [-1430.457] -- 0:00:21
693000 -- (-1434.210) (-1433.826) [-1433.937] (-1433.956) * [-1432.223] (-1437.292) (-1435.666) (-1433.681) -- 0:00:21
693500 -- [-1432.798] (-1433.684) (-1437.544) (-1433.014) * [-1431.515] (-1437.693) (-1430.574) (-1434.066) -- 0:00:21
694000 -- (-1432.696) (-1432.495) [-1431.893] (-1430.874) * [-1440.187] (-1437.152) (-1433.195) (-1429.505) -- 0:00:21
694500 -- [-1433.505] (-1433.858) (-1431.491) (-1431.459) * (-1438.375) (-1433.916) [-1431.999] (-1436.350) -- 0:00:21
695000 -- (-1435.180) (-1432.211) (-1432.932) [-1431.569] * (-1438.270) (-1433.944) (-1432.793) [-1433.433] -- 0:00:21
Average standard deviation of split frequencies: 0.006773
695500 -- [-1432.780] (-1433.392) (-1433.622) (-1433.224) * (-1437.287) [-1437.296] (-1432.093) (-1434.128) -- 0:00:21
696000 -- (-1432.497) (-1433.792) [-1433.385] (-1432.233) * (-1434.466) [-1433.563] (-1433.641) (-1433.972) -- 0:00:20
696500 -- (-1434.822) [-1432.567] (-1432.781) (-1430.719) * (-1436.793) [-1432.766] (-1432.352) (-1431.757) -- 0:00:20
697000 -- (-1437.467) [-1432.685] (-1432.281) (-1433.090) * (-1433.326) (-1435.865) [-1434.900] (-1436.706) -- 0:00:20
697500 -- (-1433.627) [-1434.088] (-1432.801) (-1432.574) * (-1440.487) [-1434.205] (-1433.928) (-1435.285) -- 0:00:20
698000 -- [-1434.216] (-1436.755) (-1433.853) (-1433.182) * [-1433.491] (-1434.488) (-1432.250) (-1435.769) -- 0:00:20
698500 -- [-1433.215] (-1434.690) (-1434.525) (-1433.002) * (-1434.330) (-1436.063) (-1435.020) [-1432.157] -- 0:00:20
699000 -- (-1435.243) [-1434.069] (-1434.698) (-1432.953) * (-1432.204) [-1435.201] (-1435.255) (-1433.362) -- 0:00:20
699500 -- [-1431.561] (-1433.193) (-1438.265) (-1431.834) * [-1433.552] (-1437.886) (-1434.805) (-1430.560) -- 0:00:20
700000 -- (-1430.637) (-1434.148) (-1437.651) [-1433.946] * (-1432.481) [-1432.865] (-1434.127) (-1433.808) -- 0:00:20
Average standard deviation of split frequencies: 0.007485
700500 -- (-1437.110) [-1435.764] (-1434.317) (-1432.004) * [-1432.715] (-1433.069) (-1434.655) (-1433.846) -- 0:00:20
701000 -- (-1436.643) (-1435.046) (-1431.505) [-1435.656] * (-1434.771) [-1431.687] (-1434.626) (-1431.901) -- 0:00:20
701500 -- [-1431.746] (-1432.650) (-1432.552) (-1432.899) * (-1433.694) [-1434.476] (-1434.054) (-1433.422) -- 0:00:20
702000 -- (-1437.644) (-1435.741) [-1435.157] (-1436.152) * (-1437.427) (-1433.592) [-1432.928] (-1432.838) -- 0:00:20
702500 -- (-1437.685) [-1432.835] (-1433.422) (-1433.567) * (-1436.002) (-1433.487) [-1431.705] (-1433.152) -- 0:00:20
703000 -- (-1433.478) (-1432.504) [-1431.595] (-1438.665) * (-1436.826) (-1433.078) (-1431.695) [-1432.468] -- 0:00:20
703500 -- [-1433.081] (-1431.483) (-1431.749) (-1430.742) * (-1434.010) (-1434.222) (-1437.071) [-1431.970] -- 0:00:20
704000 -- [-1434.383] (-1430.423) (-1431.357) (-1435.081) * (-1433.140) [-1435.413] (-1433.331) (-1433.495) -- 0:00:20
704500 -- (-1438.804) [-1433.253] (-1433.695) (-1435.719) * [-1431.899] (-1436.998) (-1432.878) (-1433.167) -- 0:00:20
705000 -- (-1434.958) (-1430.949) [-1430.014] (-1435.993) * (-1433.759) (-1435.874) (-1435.241) [-1433.397] -- 0:00:20
Average standard deviation of split frequencies: 0.007929
705500 -- (-1430.965) [-1433.807] (-1434.357) (-1439.215) * (-1432.877) [-1432.256] (-1430.864) (-1434.559) -- 0:00:20
706000 -- (-1435.617) [-1431.799] (-1439.751) (-1438.393) * [-1435.635] (-1432.660) (-1431.900) (-1433.017) -- 0:00:19
706500 -- (-1433.936) (-1432.843) [-1433.371] (-1432.698) * (-1437.044) (-1431.173) [-1433.768] (-1434.376) -- 0:00:19
707000 -- (-1432.890) (-1435.005) (-1434.196) [-1430.046] * (-1433.749) [-1437.807] (-1435.769) (-1435.340) -- 0:00:19
707500 -- (-1436.532) (-1433.535) (-1435.181) [-1433.010] * [-1432.643] (-1438.906) (-1435.206) (-1432.385) -- 0:00:20
708000 -- (-1432.246) (-1434.757) [-1435.320] (-1435.666) * [-1431.811] (-1436.009) (-1432.898) (-1434.716) -- 0:00:20
708500 -- (-1435.520) (-1437.142) (-1434.700) [-1435.498] * (-1434.508) (-1432.168) [-1431.509] (-1432.487) -- 0:00:20
709000 -- (-1437.525) (-1437.398) (-1432.385) [-1432.618] * [-1432.739] (-1435.805) (-1433.407) (-1430.874) -- 0:00:20
709500 -- (-1433.943) (-1434.589) (-1433.568) [-1433.976] * (-1431.419) (-1431.852) [-1434.635] (-1432.790) -- 0:00:20
710000 -- (-1435.692) [-1433.345] (-1433.534) (-1436.498) * (-1433.037) (-1433.714) [-1432.721] (-1431.215) -- 0:00:20
Average standard deviation of split frequencies: 0.008084
710500 -- (-1434.294) [-1433.791] (-1432.955) (-1439.420) * [-1434.122] (-1434.136) (-1431.111) (-1432.458) -- 0:00:19
711000 -- (-1433.570) (-1433.054) [-1432.204] (-1433.892) * (-1434.181) [-1436.513] (-1432.625) (-1431.606) -- 0:00:19
711500 -- [-1432.477] (-1433.467) (-1434.029) (-1435.632) * (-1432.909) (-1431.197) [-1431.145] (-1433.929) -- 0:00:19
712000 -- (-1435.462) [-1435.943] (-1434.774) (-1432.309) * (-1432.743) (-1433.710) (-1433.025) [-1435.115] -- 0:00:19
712500 -- (-1434.441) [-1435.328] (-1434.506) (-1435.132) * [-1432.026] (-1430.017) (-1433.501) (-1436.325) -- 0:00:19
713000 -- (-1431.403) (-1432.122) (-1434.889) [-1433.722] * (-1432.364) (-1434.026) (-1431.985) [-1430.834] -- 0:00:19
713500 -- [-1432.576] (-1434.285) (-1435.331) (-1432.197) * (-1432.485) (-1432.717) (-1434.335) [-1431.545] -- 0:00:19
714000 -- [-1434.251] (-1434.010) (-1433.364) (-1435.217) * (-1432.408) (-1435.214) [-1435.595] (-1430.369) -- 0:00:19
714500 -- (-1435.495) [-1431.648] (-1432.783) (-1433.532) * (-1431.913) [-1434.140] (-1435.871) (-1431.574) -- 0:00:19
715000 -- [-1433.042] (-1432.434) (-1438.979) (-1433.315) * (-1434.722) (-1432.749) (-1435.555) [-1430.695] -- 0:00:19
Average standard deviation of split frequencies: 0.007983
715500 -- (-1434.200) (-1434.836) (-1440.089) [-1431.610] * (-1432.085) (-1434.261) (-1437.851) [-1431.109] -- 0:00:19
716000 -- (-1434.447) (-1432.326) (-1436.473) [-1432.694] * (-1432.945) [-1433.746] (-1438.549) (-1433.118) -- 0:00:19
716500 -- (-1432.870) [-1432.457] (-1434.500) (-1435.897) * (-1434.228) [-1433.432] (-1434.881) (-1430.829) -- 0:00:19
717000 -- (-1434.236) [-1432.570] (-1437.088) (-1434.141) * (-1432.757) (-1434.944) [-1436.080] (-1437.536) -- 0:00:19
717500 -- (-1433.902) (-1436.082) (-1433.473) [-1431.021] * [-1433.546] (-1432.334) (-1432.164) (-1435.169) -- 0:00:19
718000 -- [-1434.200] (-1431.524) (-1432.161) (-1433.603) * [-1435.621] (-1434.193) (-1434.029) (-1432.293) -- 0:00:19
718500 -- (-1433.216) (-1433.354) (-1432.101) [-1431.585] * (-1433.298) (-1431.221) [-1434.474] (-1434.971) -- 0:00:19
719000 -- (-1433.340) (-1434.849) [-1435.122] (-1435.042) * (-1431.957) (-1435.609) [-1438.500] (-1433.152) -- 0:00:19
719500 -- (-1434.977) [-1432.200] (-1435.310) (-1432.328) * [-1433.550] (-1435.549) (-1435.048) (-1434.742) -- 0:00:19
720000 -- (-1437.318) (-1432.866) [-1432.954] (-1434.557) * (-1432.544) [-1431.232] (-1442.900) (-1433.614) -- 0:00:19
Average standard deviation of split frequencies: 0.007482
720500 -- [-1436.525] (-1432.117) (-1436.046) (-1433.619) * (-1431.879) (-1435.338) [-1433.546] (-1431.182) -- 0:00:19
721000 -- (-1432.863) (-1431.607) (-1433.304) [-1431.133] * (-1430.886) (-1437.869) [-1433.653] (-1432.781) -- 0:00:18
721500 -- [-1435.183] (-1435.429) (-1434.909) (-1433.442) * (-1431.107) [-1433.064] (-1435.948) (-1433.820) -- 0:00:18
722000 -- [-1433.139] (-1437.466) (-1441.143) (-1432.064) * [-1435.115] (-1433.494) (-1434.308) (-1433.485) -- 0:00:19
722500 -- (-1432.700) [-1432.317] (-1436.207) (-1433.962) * (-1437.292) [-1434.524] (-1431.882) (-1433.578) -- 0:00:19
723000 -- (-1435.335) [-1434.715] (-1436.700) (-1432.718) * (-1433.367) (-1433.521) (-1434.278) [-1434.480] -- 0:00:19
723500 -- (-1438.149) (-1436.472) [-1435.157] (-1432.869) * [-1432.788] (-1435.043) (-1435.002) (-1433.784) -- 0:00:19
724000 -- (-1437.405) (-1434.649) [-1432.937] (-1434.180) * (-1435.437) (-1434.310) [-1433.067] (-1432.213) -- 0:00:19
724500 -- (-1435.320) (-1436.315) (-1433.915) [-1434.660] * (-1434.071) [-1431.954] (-1435.477) (-1439.194) -- 0:00:19
725000 -- (-1433.427) [-1433.089] (-1435.368) (-1432.890) * (-1429.950) [-1433.720] (-1435.204) (-1434.874) -- 0:00:18
Average standard deviation of split frequencies: 0.008238
725500 -- (-1434.796) (-1431.896) (-1435.084) [-1434.092] * (-1433.337) (-1435.784) [-1431.727] (-1432.583) -- 0:00:18
726000 -- (-1432.278) [-1433.021] (-1433.304) (-1437.591) * (-1433.833) [-1431.924] (-1434.906) (-1430.645) -- 0:00:18
726500 -- (-1432.985) (-1431.561) (-1431.587) [-1439.992] * (-1433.916) [-1432.173] (-1435.062) (-1433.504) -- 0:00:18
727000 -- (-1433.110) (-1431.247) (-1437.321) [-1438.659] * (-1437.886) (-1431.716) [-1433.329] (-1432.432) -- 0:00:18
727500 -- (-1431.957) (-1433.313) [-1436.290] (-1436.533) * [-1434.094] (-1434.270) (-1432.301) (-1436.949) -- 0:00:18
728000 -- [-1430.998] (-1435.043) (-1434.324) (-1431.594) * (-1437.535) [-1433.776] (-1432.211) (-1433.211) -- 0:00:18
728500 -- (-1430.788) [-1432.613] (-1435.880) (-1434.686) * (-1435.651) (-1435.975) [-1432.436] (-1433.112) -- 0:00:18
729000 -- (-1433.834) (-1430.673) [-1433.793] (-1433.445) * (-1434.534) (-1433.434) (-1431.104) [-1434.302] -- 0:00:18
729500 -- [-1433.522] (-1433.241) (-1433.760) (-1433.989) * [-1433.284] (-1435.596) (-1432.814) (-1435.415) -- 0:00:18
730000 -- (-1431.490) (-1432.669) [-1433.472] (-1433.643) * (-1432.940) (-1434.655) [-1432.322] (-1433.128) -- 0:00:18
Average standard deviation of split frequencies: 0.007823
730500 -- (-1431.017) [-1434.060] (-1430.271) (-1432.439) * (-1432.445) (-1435.619) (-1433.621) [-1432.272] -- 0:00:18
731000 -- (-1431.722) [-1432.034] (-1437.317) (-1438.796) * (-1434.726) (-1434.493) [-1433.644] (-1430.565) -- 0:00:18
731500 -- (-1432.137) [-1431.555] (-1436.862) (-1431.012) * (-1433.665) (-1435.259) (-1432.789) [-1433.889] -- 0:00:18
732000 -- [-1431.773] (-1436.574) (-1430.666) (-1435.733) * (-1431.930) (-1434.418) [-1432.208] (-1437.662) -- 0:00:18
732500 -- (-1432.305) (-1434.491) [-1432.200] (-1436.111) * (-1434.345) [-1432.539] (-1436.410) (-1440.042) -- 0:00:18
733000 -- [-1431.751] (-1433.933) (-1435.176) (-1434.600) * [-1434.614] (-1435.186) (-1436.082) (-1441.881) -- 0:00:18
733500 -- (-1432.052) (-1434.287) [-1434.456] (-1437.346) * (-1433.943) (-1437.094) [-1432.635] (-1432.833) -- 0:00:18
734000 -- (-1433.972) (-1434.840) (-1437.831) [-1432.621] * (-1432.337) (-1435.413) [-1433.527] (-1434.172) -- 0:00:18
734500 -- (-1437.229) [-1437.222] (-1433.632) (-1435.730) * (-1436.828) (-1434.963) (-1433.075) [-1434.688] -- 0:00:18
735000 -- (-1433.204) [-1433.447] (-1433.578) (-1434.778) * [-1433.809] (-1436.002) (-1437.034) (-1431.483) -- 0:00:18
Average standard deviation of split frequencies: 0.007726
735500 -- (-1432.432) [-1432.384] (-1433.657) (-1436.642) * (-1432.556) (-1431.149) (-1434.633) [-1431.949] -- 0:00:17
736000 -- (-1431.191) (-1431.410) [-1434.379] (-1435.007) * [-1434.279] (-1438.524) (-1433.692) (-1432.769) -- 0:00:17
736500 -- (-1431.219) [-1436.806] (-1431.404) (-1431.886) * [-1431.809] (-1436.244) (-1434.442) (-1432.103) -- 0:00:18
737000 -- [-1433.307] (-1435.183) (-1433.650) (-1435.770) * [-1431.163] (-1435.176) (-1432.871) (-1431.413) -- 0:00:18
737500 -- [-1434.067] (-1430.799) (-1431.912) (-1433.236) * (-1433.076) (-1436.813) (-1431.440) [-1433.792] -- 0:00:18
738000 -- [-1432.828] (-1432.784) (-1435.165) (-1432.913) * (-1437.329) [-1433.805] (-1432.498) (-1433.180) -- 0:00:18
738500 -- (-1432.736) (-1431.102) [-1433.223] (-1433.761) * (-1433.423) [-1434.406] (-1437.145) (-1432.639) -- 0:00:18
739000 -- [-1434.800] (-1432.627) (-1432.055) (-1434.902) * (-1434.648) (-1433.659) (-1432.842) [-1433.951] -- 0:00:18
739500 -- (-1432.442) (-1434.177) [-1430.650] (-1433.591) * (-1438.935) (-1431.769) [-1432.724] (-1435.422) -- 0:00:17
740000 -- (-1435.462) (-1430.821) (-1434.659) [-1430.883] * (-1436.699) (-1432.404) [-1431.242] (-1433.594) -- 0:00:17
Average standard deviation of split frequencies: 0.007638
740500 -- (-1433.830) (-1433.847) (-1437.143) [-1432.344] * (-1433.275) (-1434.962) [-1431.179] (-1435.721) -- 0:00:17
741000 -- (-1432.137) (-1431.036) (-1437.278) [-1430.188] * (-1435.638) (-1435.821) (-1434.183) [-1432.035] -- 0:00:17
741500 -- (-1432.930) [-1433.412] (-1442.114) (-1438.687) * (-1433.044) [-1434.730] (-1431.466) (-1432.862) -- 0:00:17
742000 -- (-1434.187) (-1435.067) (-1436.672) [-1433.205] * (-1438.595) [-1435.045] (-1433.290) (-1431.839) -- 0:00:17
742500 -- (-1437.526) (-1435.021) [-1436.493] (-1432.450) * (-1434.883) (-1433.837) [-1431.646] (-1444.204) -- 0:00:17
743000 -- (-1432.105) (-1435.017) [-1433.847] (-1434.860) * [-1433.536] (-1437.171) (-1430.605) (-1444.129) -- 0:00:17
743500 -- (-1432.511) [-1433.266] (-1434.483) (-1436.952) * [-1437.379] (-1438.682) (-1432.135) (-1436.356) -- 0:00:17
744000 -- (-1431.290) (-1433.257) [-1430.862] (-1437.554) * (-1435.891) (-1438.925) (-1437.256) [-1432.373] -- 0:00:17
744500 -- (-1431.672) (-1435.622) [-1431.934] (-1434.954) * (-1433.495) [-1435.855] (-1436.737) (-1430.551) -- 0:00:17
745000 -- (-1431.097) [-1433.286] (-1432.959) (-1434.100) * (-1434.236) (-1434.643) [-1434.458] (-1432.177) -- 0:00:17
Average standard deviation of split frequencies: 0.007859
745500 -- (-1433.145) (-1434.101) (-1433.765) [-1438.011] * (-1433.553) (-1435.292) [-1432.167] (-1432.630) -- 0:00:17
746000 -- (-1434.165) (-1433.338) [-1435.395] (-1435.088) * (-1431.807) [-1434.804] (-1436.389) (-1431.271) -- 0:00:17
746500 -- (-1435.650) [-1433.726] (-1430.594) (-1433.180) * (-1435.582) (-1433.455) (-1432.159) [-1435.908] -- 0:00:17
747000 -- (-1435.631) [-1432.719] (-1433.256) (-1433.343) * [-1434.352] (-1434.833) (-1437.940) (-1434.165) -- 0:00:17
747500 -- [-1432.976] (-1430.533) (-1432.508) (-1433.492) * (-1432.485) (-1435.977) [-1431.599] (-1434.735) -- 0:00:17
748000 -- (-1432.500) (-1437.550) [-1431.563] (-1432.506) * (-1434.527) (-1433.385) (-1432.676) [-1432.919] -- 0:00:17
748500 -- (-1433.355) (-1433.171) (-1432.239) [-1434.019] * [-1433.038] (-1432.822) (-1433.712) (-1433.971) -- 0:00:17
749000 -- (-1432.707) (-1431.198) [-1432.336] (-1432.987) * [-1432.378] (-1434.355) (-1432.461) (-1435.855) -- 0:00:17
749500 -- (-1434.521) (-1434.731) (-1432.077) [-1434.173] * (-1432.719) (-1432.927) (-1432.120) [-1431.836] -- 0:00:17
750000 -- [-1434.142] (-1431.863) (-1436.085) (-1434.265) * (-1436.214) (-1432.647) (-1434.335) [-1431.658] -- 0:00:17
Average standard deviation of split frequencies: 0.007693
750500 -- (-1429.892) (-1433.453) [-1435.569] (-1434.204) * [-1433.924] (-1432.224) (-1434.541) (-1434.549) -- 0:00:16
751000 -- [-1433.542] (-1433.374) (-1433.605) (-1431.899) * [-1431.294] (-1434.583) (-1434.020) (-1434.894) -- 0:00:16
751500 -- (-1440.124) [-1430.526] (-1433.238) (-1432.765) * (-1433.547) [-1432.743] (-1433.518) (-1433.238) -- 0:00:17
752000 -- [-1435.026] (-1431.026) (-1432.600) (-1431.381) * (-1437.869) [-1434.467] (-1434.948) (-1432.804) -- 0:00:17
752500 -- [-1435.261] (-1432.686) (-1432.599) (-1433.191) * [-1433.263] (-1432.399) (-1434.396) (-1433.790) -- 0:00:17
753000 -- [-1433.271] (-1437.360) (-1432.812) (-1434.911) * [-1434.854] (-1433.913) (-1432.435) (-1431.537) -- 0:00:17
753500 -- [-1431.654] (-1436.525) (-1432.783) (-1434.899) * (-1433.245) [-1433.210] (-1432.572) (-1436.184) -- 0:00:17
754000 -- [-1431.883] (-1439.523) (-1432.876) (-1433.968) * (-1433.259) (-1430.973) [-1434.748] (-1434.493) -- 0:00:16
754500 -- (-1431.061) [-1438.325] (-1431.773) (-1433.556) * (-1433.193) [-1436.154] (-1435.603) (-1435.605) -- 0:00:16
755000 -- (-1440.885) (-1432.790) [-1430.960] (-1432.598) * (-1433.526) [-1432.746] (-1433.934) (-1433.088) -- 0:00:16
Average standard deviation of split frequencies: 0.007950
755500 -- (-1435.830) [-1433.581] (-1431.333) (-1435.104) * (-1432.032) [-1433.483] (-1431.206) (-1432.309) -- 0:00:16
756000 -- (-1433.440) (-1434.480) [-1432.871] (-1432.473) * (-1437.177) [-1432.540] (-1431.647) (-1434.897) -- 0:00:16
756500 -- [-1432.368] (-1436.338) (-1434.785) (-1433.970) * (-1431.740) (-1433.620) [-1435.895] (-1432.319) -- 0:00:16
757000 -- [-1433.995] (-1433.623) (-1435.035) (-1434.807) * (-1434.863) (-1433.922) [-1433.018] (-1433.045) -- 0:00:16
757500 -- (-1434.386) (-1434.571) (-1431.911) [-1433.623] * (-1436.293) (-1432.715) (-1430.227) [-1432.257] -- 0:00:16
758000 -- (-1431.630) (-1437.679) (-1436.854) [-1432.958] * (-1433.292) (-1431.552) (-1433.127) [-1430.420] -- 0:00:16
758500 -- [-1432.260] (-1437.796) (-1430.592) (-1431.611) * [-1432.399] (-1432.624) (-1437.529) (-1431.447) -- 0:00:16
759000 -- (-1433.700) (-1435.865) [-1433.004] (-1433.396) * (-1432.915) (-1436.930) [-1433.421] (-1436.426) -- 0:00:16
759500 -- [-1431.638] (-1432.273) (-1433.460) (-1432.954) * [-1433.257] (-1433.791) (-1431.542) (-1434.667) -- 0:00:16
760000 -- (-1433.480) (-1434.108) (-1436.072) [-1436.505] * [-1434.825] (-1433.735) (-1431.897) (-1435.557) -- 0:00:16
Average standard deviation of split frequencies: 0.008211
760500 -- (-1432.074) [-1433.383] (-1437.981) (-1433.214) * (-1435.564) (-1435.590) (-1431.416) [-1434.886] -- 0:00:16
761000 -- (-1436.947) (-1436.572) [-1432.328] (-1437.056) * [-1437.416] (-1435.943) (-1437.733) (-1433.235) -- 0:00:16
761500 -- [-1434.628] (-1436.000) (-1432.755) (-1435.611) * [-1433.524] (-1434.442) (-1432.252) (-1433.542) -- 0:00:16
762000 -- (-1433.817) [-1432.237] (-1432.457) (-1433.054) * (-1434.436) (-1435.370) (-1432.803) [-1436.201] -- 0:00:16
762500 -- (-1433.829) [-1432.030] (-1432.322) (-1437.490) * (-1433.285) [-1434.570] (-1436.096) (-1434.992) -- 0:00:16
763000 -- (-1434.587) (-1442.926) (-1433.604) [-1429.949] * (-1433.954) (-1435.574) (-1435.570) [-1430.844] -- 0:00:16
763500 -- (-1435.357) [-1433.833] (-1433.587) (-1432.459) * [-1436.022] (-1437.514) (-1435.520) (-1435.251) -- 0:00:16
764000 -- (-1432.193) (-1434.854) (-1432.085) [-1433.054] * [-1433.306] (-1431.996) (-1432.164) (-1433.190) -- 0:00:16
764500 -- [-1432.262] (-1433.087) (-1433.699) (-1435.484) * (-1433.882) (-1433.061) (-1432.708) [-1433.247] -- 0:00:16
765000 -- (-1432.638) [-1434.260] (-1431.266) (-1433.469) * (-1435.558) (-1432.718) [-1432.084] (-1434.138) -- 0:00:15
Average standard deviation of split frequencies: 0.008039
765500 -- (-1433.400) (-1437.394) [-1432.434] (-1432.597) * (-1435.077) (-1433.014) (-1433.919) [-1431.789] -- 0:00:15
766000 -- (-1438.754) (-1440.064) (-1432.706) [-1431.554] * [-1434.846] (-1438.020) (-1436.285) (-1434.068) -- 0:00:16
766500 -- (-1434.264) (-1437.519) [-1432.775] (-1435.121) * (-1436.049) (-1436.353) [-1438.075] (-1431.455) -- 0:00:16
767000 -- [-1431.033] (-1434.731) (-1431.038) (-1433.129) * [-1431.809] (-1434.820) (-1441.023) (-1434.774) -- 0:00:16
767500 -- [-1433.948] (-1430.842) (-1431.264) (-1434.752) * (-1431.695) (-1431.865) [-1431.377] (-1437.478) -- 0:00:16
768000 -- (-1434.151) [-1433.368] (-1433.164) (-1431.135) * [-1432.717] (-1436.055) (-1436.047) (-1432.753) -- 0:00:16
768500 -- [-1437.122] (-1432.204) (-1436.268) (-1430.599) * (-1437.105) [-1432.432] (-1435.022) (-1433.602) -- 0:00:15
769000 -- (-1433.732) (-1436.831) [-1433.623] (-1431.316) * [-1431.406] (-1434.609) (-1431.386) (-1432.634) -- 0:00:15
769500 -- (-1434.043) (-1433.746) [-1433.659] (-1434.304) * (-1433.247) (-1430.443) [-1430.625] (-1433.009) -- 0:00:15
770000 -- (-1440.102) (-1430.859) [-1432.785] (-1433.867) * (-1432.080) (-1433.429) (-1431.524) [-1432.590] -- 0:00:15
Average standard deviation of split frequencies: 0.008564
770500 -- (-1434.627) (-1434.015) (-1434.672) [-1432.633] * (-1437.288) [-1430.539] (-1432.326) (-1432.551) -- 0:00:15
771000 -- [-1431.928] (-1431.194) (-1431.560) (-1432.903) * (-1437.377) (-1434.618) (-1438.001) [-1432.205] -- 0:00:15
771500 -- (-1432.841) (-1430.825) [-1433.131] (-1433.479) * [-1430.514] (-1433.662) (-1433.167) (-1434.789) -- 0:00:15
772000 -- (-1432.218) (-1437.249) (-1432.995) [-1431.420] * [-1434.622] (-1432.701) (-1432.953) (-1435.739) -- 0:00:15
772500 -- (-1432.587) (-1434.530) (-1433.705) [-1431.706] * (-1434.673) (-1430.950) (-1433.313) [-1431.895] -- 0:00:15
773000 -- (-1436.394) (-1433.139) (-1434.009) [-1434.915] * (-1438.102) (-1431.208) (-1434.585) [-1436.811] -- 0:00:15
773500 -- (-1436.120) (-1435.335) [-1433.441] (-1436.154) * (-1433.013) [-1431.145] (-1434.860) (-1434.661) -- 0:00:15
774000 -- (-1435.956) (-1431.931) (-1432.713) [-1431.082] * (-1432.833) [-1432.995] (-1436.009) (-1433.337) -- 0:00:15
774500 -- (-1434.497) [-1432.881] (-1436.453) (-1431.248) * [-1434.139] (-1431.279) (-1434.418) (-1435.541) -- 0:00:15
775000 -- (-1434.104) [-1432.569] (-1430.346) (-1431.163) * (-1434.755) [-1431.186] (-1434.396) (-1433.484) -- 0:00:15
Average standard deviation of split frequencies: 0.009148
775500 -- (-1435.472) [-1432.883] (-1430.228) (-1432.890) * (-1435.206) [-1433.130] (-1435.045) (-1434.408) -- 0:00:15
776000 -- (-1435.240) (-1435.220) [-1433.001] (-1435.235) * (-1431.330) (-1435.253) (-1433.693) [-1431.101] -- 0:00:15
776500 -- (-1436.081) (-1438.374) [-1432.893] (-1431.397) * [-1431.629] (-1437.825) (-1433.696) (-1432.288) -- 0:00:15
777000 -- [-1432.707] (-1432.663) (-1433.254) (-1433.218) * (-1433.901) [-1435.481] (-1432.822) (-1440.625) -- 0:00:15
777500 -- (-1433.290) (-1432.511) (-1431.057) [-1433.397] * (-1436.609) (-1435.027) (-1433.900) [-1432.524] -- 0:00:15
778000 -- [-1432.402] (-1432.806) (-1431.967) (-1433.537) * (-1432.442) [-1434.472] (-1433.998) (-1435.539) -- 0:00:15
778500 -- (-1434.423) [-1433.348] (-1431.602) (-1432.056) * (-1433.624) (-1431.276) (-1434.321) [-1433.714] -- 0:00:15
779000 -- (-1432.934) (-1430.934) [-1434.134] (-1434.070) * (-1434.264) [-1432.750] (-1434.443) (-1431.742) -- 0:00:15
779500 -- [-1431.691] (-1433.989) (-1431.863) (-1434.172) * [-1432.411] (-1439.754) (-1437.887) (-1433.641) -- 0:00:14
780000 -- (-1432.914) (-1433.729) [-1433.818] (-1434.173) * (-1433.624) [-1433.645] (-1434.211) (-1434.273) -- 0:00:14
Average standard deviation of split frequencies: 0.009246
780500 -- [-1431.830] (-1434.394) (-1432.640) (-1434.604) * (-1435.776) [-1433.752] (-1434.779) (-1437.164) -- 0:00:15
781000 -- (-1433.767) (-1437.673) [-1430.072] (-1433.968) * (-1436.805) (-1433.367) (-1432.506) [-1433.118] -- 0:00:15
781500 -- [-1437.405] (-1432.822) (-1431.007) (-1434.300) * [-1432.202] (-1434.004) (-1433.040) (-1436.470) -- 0:00:15
782000 -- (-1437.434) [-1432.356] (-1433.431) (-1435.067) * (-1431.672) [-1432.949] (-1432.672) (-1431.612) -- 0:00:15
782500 -- (-1434.369) [-1434.767] (-1431.200) (-1436.445) * (-1432.225) [-1431.217] (-1435.737) (-1431.542) -- 0:00:15
783000 -- [-1433.742] (-1433.339) (-1434.564) (-1436.049) * (-1434.219) (-1434.839) (-1434.842) [-1434.425] -- 0:00:14
783500 -- (-1434.218) (-1432.072) [-1433.343] (-1432.137) * (-1432.858) [-1435.251] (-1433.123) (-1432.357) -- 0:00:14
784000 -- (-1432.810) (-1434.034) [-1431.364] (-1433.580) * [-1432.047] (-1435.434) (-1434.152) (-1431.681) -- 0:00:14
784500 -- (-1433.946) (-1434.984) (-1436.542) [-1433.036] * [-1434.158] (-1433.147) (-1434.237) (-1431.957) -- 0:00:14
785000 -- (-1435.154) [-1435.060] (-1434.343) (-1433.123) * (-1432.366) (-1432.341) [-1434.042] (-1432.631) -- 0:00:14
Average standard deviation of split frequencies: 0.009243
785500 -- (-1434.010) (-1438.180) (-1431.758) [-1432.748] * (-1431.610) [-1432.607] (-1433.355) (-1433.268) -- 0:00:14
786000 -- [-1434.427] (-1435.326) (-1433.008) (-1433.988) * (-1434.361) (-1435.455) [-1433.041] (-1432.765) -- 0:00:14
786500 -- (-1435.407) (-1433.302) [-1433.055] (-1434.598) * (-1431.480) (-1434.444) (-1431.808) [-1431.523] -- 0:00:14
787000 -- [-1434.482] (-1432.261) (-1434.936) (-1434.193) * (-1435.040) [-1431.369] (-1436.339) (-1439.696) -- 0:00:14
787500 -- (-1434.122) (-1431.764) [-1435.073] (-1433.689) * (-1431.375) [-1433.344] (-1435.258) (-1436.219) -- 0:00:14
788000 -- (-1433.801) [-1433.266] (-1435.970) (-1434.306) * (-1433.095) (-1432.334) [-1432.375] (-1431.447) -- 0:00:14
788500 -- (-1433.225) [-1434.540] (-1436.684) (-1437.302) * (-1434.310) [-1432.384] (-1432.974) (-1432.881) -- 0:00:14
789000 -- [-1433.321] (-1432.531) (-1434.234) (-1436.233) * (-1435.266) (-1434.411) (-1432.555) [-1431.856] -- 0:00:14
789500 -- (-1432.855) (-1433.870) [-1433.732] (-1435.586) * (-1433.525) (-1431.599) [-1431.066] (-1432.650) -- 0:00:14
790000 -- (-1436.463) (-1432.389) (-1433.770) [-1434.297] * [-1434.776] (-1430.876) (-1435.408) (-1432.557) -- 0:00:14
Average standard deviation of split frequencies: 0.009502
790500 -- (-1436.643) (-1437.457) (-1434.802) [-1433.023] * (-1435.049) [-1434.209] (-1431.010) (-1433.525) -- 0:00:14
791000 -- (-1430.701) (-1436.494) [-1432.468] (-1433.821) * [-1433.405] (-1430.597) (-1433.366) (-1431.461) -- 0:00:14
791500 -- (-1434.814) (-1435.575) (-1435.372) [-1432.642] * [-1431.212] (-1435.016) (-1433.364) (-1432.704) -- 0:00:14
792000 -- (-1432.446) (-1435.313) [-1431.737] (-1430.628) * (-1434.792) (-1436.137) [-1432.893] (-1432.483) -- 0:00:14
792500 -- [-1433.086] (-1440.078) (-1433.334) (-1433.283) * (-1434.003) (-1431.841) (-1432.505) [-1432.081] -- 0:00:14
793000 -- (-1438.955) (-1435.058) (-1432.568) [-1432.440] * (-1434.313) (-1433.896) (-1432.214) [-1434.936] -- 0:00:14
793500 -- [-1434.281] (-1435.533) (-1432.871) (-1431.708) * (-1433.199) (-1435.225) (-1432.920) [-1433.467] -- 0:00:14
794000 -- (-1433.001) (-1432.705) [-1433.373] (-1432.778) * (-1434.511) (-1433.816) [-1431.164] (-1434.439) -- 0:00:14
794500 -- (-1432.545) (-1432.341) [-1433.623] (-1436.794) * (-1433.266) (-1432.596) [-1435.596] (-1430.991) -- 0:00:13
795000 -- (-1434.589) [-1432.534] (-1432.892) (-1433.530) * (-1434.000) (-1434.088) [-1432.003] (-1434.090) -- 0:00:13
Average standard deviation of split frequencies: 0.009475
795500 -- (-1433.035) [-1434.748] (-1430.983) (-1433.338) * (-1433.272) (-1433.401) [-1433.020] (-1436.437) -- 0:00:14
796000 -- (-1433.602) [-1431.477] (-1434.063) (-1434.802) * (-1436.191) (-1430.490) (-1433.468) [-1434.952] -- 0:00:14
796500 -- (-1434.169) (-1433.940) (-1433.164) [-1435.091] * [-1436.767] (-1437.061) (-1431.443) (-1434.533) -- 0:00:14
797000 -- (-1433.923) [-1436.093] (-1433.540) (-1434.460) * [-1432.736] (-1431.614) (-1432.279) (-1435.022) -- 0:00:14
797500 -- (-1433.567) (-1432.241) (-1431.614) [-1436.160] * (-1433.272) [-1435.619] (-1431.610) (-1432.791) -- 0:00:13
798000 -- (-1431.587) (-1431.908) (-1433.672) [-1436.771] * (-1433.440) (-1435.400) [-1433.818] (-1432.186) -- 0:00:13
798500 -- [-1432.315] (-1432.879) (-1432.810) (-1435.665) * (-1434.840) (-1438.275) [-1431.290] (-1435.881) -- 0:00:13
799000 -- (-1432.392) (-1429.762) [-1431.513] (-1434.444) * (-1442.351) (-1434.229) [-1432.236] (-1431.735) -- 0:00:13
799500 -- (-1431.697) (-1431.017) [-1432.394] (-1435.112) * (-1435.598) [-1438.034] (-1434.699) (-1430.738) -- 0:00:13
800000 -- (-1435.114) (-1439.571) [-1432.246] (-1434.055) * (-1435.270) (-1432.189) [-1430.939] (-1432.220) -- 0:00:13
Average standard deviation of split frequencies: 0.009199
800500 -- (-1433.229) (-1431.730) (-1432.764) [-1433.493] * (-1437.758) (-1433.450) (-1431.667) [-1432.495] -- 0:00:13
801000 -- [-1431.989] (-1437.095) (-1435.074) (-1433.251) * (-1435.033) (-1432.361) [-1432.918] (-1432.422) -- 0:00:13
801500 -- (-1438.875) [-1434.919] (-1433.791) (-1432.260) * (-1435.197) [-1432.351] (-1434.660) (-1433.281) -- 0:00:13
802000 -- (-1433.211) (-1430.267) (-1435.186) [-1433.111] * [-1433.791] (-1431.918) (-1435.222) (-1433.865) -- 0:00:13
802500 -- (-1433.533) [-1431.046] (-1434.510) (-1434.249) * (-1437.169) [-1434.480] (-1435.791) (-1438.236) -- 0:00:13
803000 -- (-1433.476) (-1434.160) [-1431.855] (-1432.925) * (-1438.903) (-1431.766) [-1434.356] (-1432.718) -- 0:00:13
803500 -- (-1431.826) [-1434.728] (-1432.092) (-1432.471) * (-1433.457) (-1433.731) (-1434.089) [-1431.788] -- 0:00:13
804000 -- (-1432.235) [-1430.205] (-1432.900) (-1435.752) * (-1432.789) (-1435.411) (-1432.209) [-1432.248] -- 0:00:13
804500 -- (-1433.145) (-1433.906) (-1434.098) [-1432.984] * [-1433.858] (-1439.558) (-1431.560) (-1434.099) -- 0:00:13
805000 -- (-1433.037) [-1431.836] (-1432.663) (-1433.043) * [-1431.737] (-1435.319) (-1435.474) (-1435.807) -- 0:00:13
Average standard deviation of split frequencies: 0.009285
805500 -- [-1434.727] (-1435.148) (-1431.246) (-1434.985) * (-1434.191) (-1432.945) [-1432.069] (-1432.894) -- 0:00:13
806000 -- (-1433.127) (-1430.591) (-1434.440) [-1439.759] * (-1432.077) [-1437.091] (-1433.878) (-1435.677) -- 0:00:13
806500 -- (-1433.305) (-1432.987) (-1433.013) [-1433.501] * (-1432.910) (-1433.853) [-1432.573] (-1435.489) -- 0:00:13
807000 -- (-1433.490) [-1431.946] (-1431.416) (-1434.156) * (-1431.552) (-1436.315) (-1431.715) [-1432.577] -- 0:00:13
807500 -- [-1431.740] (-1432.701) (-1434.359) (-1433.320) * (-1432.787) [-1436.428] (-1432.913) (-1434.637) -- 0:00:13
808000 -- (-1431.870) (-1432.821) [-1433.384] (-1433.811) * (-1433.708) (-1433.090) [-1432.544] (-1435.301) -- 0:00:13
808500 -- (-1436.155) (-1430.476) [-1433.183] (-1433.274) * (-1434.884) [-1432.381] (-1434.969) (-1433.553) -- 0:00:13
809000 -- (-1433.308) [-1434.490] (-1431.957) (-1431.396) * [-1433.009] (-1432.319) (-1433.547) (-1434.269) -- 0:00:12
809500 -- (-1433.816) [-1431.705] (-1432.785) (-1433.113) * [-1433.483] (-1435.059) (-1430.313) (-1433.632) -- 0:00:12
810000 -- [-1434.252] (-1433.125) (-1434.714) (-1434.043) * (-1430.824) (-1432.988) [-1433.048] (-1436.305) -- 0:00:13
Average standard deviation of split frequencies: 0.009304
810500 -- [-1433.506] (-1431.627) (-1435.038) (-1433.751) * [-1432.288] (-1436.234) (-1433.963) (-1434.077) -- 0:00:13
811000 -- [-1433.966] (-1432.655) (-1435.200) (-1434.777) * [-1433.331] (-1435.892) (-1431.451) (-1431.598) -- 0:00:13
811500 -- (-1435.015) (-1432.311) (-1434.428) [-1434.285] * (-1431.424) (-1435.649) [-1434.288] (-1431.559) -- 0:00:13
812000 -- (-1433.223) [-1432.859] (-1433.448) (-1434.791) * [-1432.672] (-1437.623) (-1435.413) (-1435.086) -- 0:00:12
812500 -- (-1436.598) (-1435.674) [-1431.251] (-1433.205) * [-1431.982] (-1436.724) (-1432.917) (-1432.379) -- 0:00:12
813000 -- (-1435.729) (-1434.862) (-1433.297) [-1433.466] * (-1434.092) [-1432.961] (-1432.146) (-1432.086) -- 0:00:12
813500 -- (-1436.172) (-1434.904) (-1433.458) [-1430.917] * (-1432.438) (-1434.001) [-1430.852] (-1433.520) -- 0:00:12
814000 -- (-1433.890) [-1431.051] (-1431.359) (-1434.758) * (-1433.452) (-1433.369) [-1434.289] (-1433.931) -- 0:00:12
814500 -- (-1434.871) [-1434.423] (-1432.317) (-1432.953) * [-1430.592] (-1434.621) (-1434.140) (-1434.098) -- 0:00:12
815000 -- (-1435.327) (-1430.460) [-1431.625] (-1434.016) * [-1433.671] (-1433.777) (-1434.867) (-1437.517) -- 0:00:12
Average standard deviation of split frequencies: 0.009640
815500 -- [-1434.277] (-1433.111) (-1437.733) (-1432.315) * (-1437.204) (-1432.839) (-1433.585) [-1433.669] -- 0:00:12
816000 -- (-1433.659) (-1437.850) [-1432.713] (-1435.202) * (-1435.833) (-1433.459) (-1433.268) [-1432.743] -- 0:00:12
816500 -- (-1433.411) (-1434.435) (-1432.555) [-1434.412] * [-1434.564] (-1432.319) (-1434.138) (-1435.974) -- 0:00:12
817000 -- (-1431.887) [-1433.636] (-1432.768) (-1430.931) * (-1436.815) (-1433.630) [-1432.203] (-1431.446) -- 0:00:12
817500 -- (-1434.985) (-1434.214) (-1431.595) [-1431.555] * (-1433.584) (-1435.768) (-1437.701) [-1432.399] -- 0:00:12
818000 -- (-1431.768) (-1440.165) [-1432.094] (-1431.996) * (-1435.979) (-1433.594) [-1438.582] (-1434.872) -- 0:00:12
818500 -- (-1432.933) (-1433.744) [-1432.337] (-1431.358) * (-1433.947) (-1434.618) (-1436.016) [-1432.800] -- 0:00:12
819000 -- (-1434.931) (-1433.881) [-1434.134] (-1434.293) * (-1434.224) (-1434.416) [-1436.932] (-1435.757) -- 0:00:12
819500 -- (-1432.740) [-1433.444] (-1431.143) (-1433.541) * [-1431.664] (-1437.743) (-1435.936) (-1434.226) -- 0:00:12
820000 -- (-1431.962) [-1431.619] (-1435.043) (-1433.442) * [-1430.300] (-1434.553) (-1433.190) (-1437.810) -- 0:00:12
Average standard deviation of split frequencies: 0.009729
820500 -- [-1435.319] (-1436.766) (-1432.884) (-1432.763) * (-1431.571) (-1434.676) (-1431.763) [-1433.093] -- 0:00:12
821000 -- (-1434.455) (-1434.239) [-1433.282] (-1430.432) * (-1431.891) (-1433.261) (-1433.402) [-1433.185] -- 0:00:12
821500 -- (-1433.492) (-1434.217) (-1432.543) [-1431.945] * (-1432.930) (-1433.363) (-1433.935) [-1432.230] -- 0:00:12
822000 -- (-1434.871) [-1433.139] (-1431.271) (-1431.931) * [-1434.262] (-1432.866) (-1432.296) (-1436.241) -- 0:00:12
822500 -- (-1432.396) (-1440.519) [-1432.815] (-1434.228) * (-1435.558) [-1434.098] (-1431.993) (-1432.850) -- 0:00:12
823000 -- (-1433.495) [-1432.828] (-1433.733) (-1436.882) * [-1432.899] (-1436.717) (-1432.756) (-1438.316) -- 0:00:12
823500 -- (-1431.960) [-1432.970] (-1436.798) (-1435.793) * (-1437.949) (-1434.161) [-1434.281] (-1433.884) -- 0:00:12
824000 -- (-1434.108) (-1433.456) [-1432.747] (-1430.194) * (-1437.853) [-1434.444] (-1431.497) (-1434.960) -- 0:00:12
824500 -- [-1433.296] (-1434.564) (-1431.883) (-1431.721) * (-1435.864) [-1433.761] (-1433.990) (-1434.104) -- 0:00:12
825000 -- (-1433.398) (-1436.398) [-1434.067] (-1433.223) * (-1434.255) (-1433.804) (-1433.555) [-1434.647] -- 0:00:12
Average standard deviation of split frequencies: 0.009452
825500 -- [-1433.094] (-1437.804) (-1433.063) (-1432.183) * (-1437.269) (-1434.211) (-1434.072) [-1432.995] -- 0:00:12
826000 -- (-1433.292) (-1434.918) (-1434.053) [-1431.768] * (-1434.989) (-1435.465) (-1432.252) [-1430.992] -- 0:00:12
826500 -- [-1434.100] (-1434.008) (-1436.152) (-1431.688) * [-1432.750] (-1433.535) (-1433.549) (-1433.750) -- 0:00:11
827000 -- (-1432.431) (-1434.716) [-1432.907] (-1434.562) * [-1437.184] (-1431.638) (-1436.250) (-1434.669) -- 0:00:11
827500 -- (-1433.534) [-1433.811] (-1434.595) (-1432.547) * [-1434.019] (-1431.858) (-1430.859) (-1433.323) -- 0:00:11
828000 -- (-1436.013) (-1432.238) [-1433.156] (-1434.352) * (-1435.019) (-1432.629) [-1433.123] (-1433.823) -- 0:00:11
828500 -- (-1435.579) (-1433.202) (-1430.827) [-1433.192] * (-1435.403) [-1431.243] (-1433.452) (-1432.334) -- 0:00:11
829000 -- [-1434.433] (-1433.722) (-1431.762) (-1436.601) * (-1434.412) [-1433.520] (-1432.491) (-1434.086) -- 0:00:11
829500 -- (-1438.361) (-1433.898) [-1434.135] (-1433.901) * (-1433.695) [-1433.210] (-1434.057) (-1439.718) -- 0:00:11
830000 -- (-1433.758) (-1431.924) [-1435.345] (-1433.038) * (-1430.460) (-1432.738) [-1432.085] (-1436.366) -- 0:00:11
Average standard deviation of split frequencies: 0.009648
830500 -- [-1430.606] (-1432.749) (-1433.671) (-1430.814) * (-1433.145) (-1432.849) [-1430.894] (-1431.486) -- 0:00:11
831000 -- [-1431.958] (-1431.483) (-1430.890) (-1433.745) * (-1432.392) (-1431.773) (-1434.203) [-1431.952] -- 0:00:11
831500 -- (-1434.503) (-1435.496) (-1433.017) [-1432.822] * (-1433.115) (-1437.192) [-1432.519] (-1433.756) -- 0:00:11
832000 -- (-1434.507) (-1437.641) (-1432.492) [-1433.950] * (-1434.623) (-1431.945) [-1434.229] (-1432.900) -- 0:00:11
832500 -- [-1433.690] (-1430.762) (-1433.368) (-1431.779) * (-1434.406) (-1435.200) [-1432.642] (-1434.314) -- 0:00:11
833000 -- (-1437.930) (-1433.593) (-1434.126) [-1431.803] * (-1430.557) [-1433.649] (-1430.976) (-1436.293) -- 0:00:11
833500 -- (-1433.696) (-1433.393) [-1435.420] (-1431.317) * (-1438.077) [-1438.270] (-1434.024) (-1433.401) -- 0:00:11
834000 -- (-1434.419) [-1433.828] (-1432.589) (-1431.587) * (-1438.743) [-1433.588] (-1431.328) (-1437.643) -- 0:00:11
834500 -- [-1432.916] (-1433.515) (-1435.206) (-1432.625) * (-1433.561) [-1434.773] (-1430.210) (-1437.608) -- 0:00:11
835000 -- (-1435.616) (-1433.277) (-1433.396) [-1432.620] * (-1436.991) (-1432.169) (-1434.795) [-1433.288] -- 0:00:11
Average standard deviation of split frequencies: 0.009515
835500 -- (-1432.582) (-1436.160) [-1433.271] (-1434.983) * (-1432.403) [-1433.361] (-1434.122) (-1436.730) -- 0:00:11
836000 -- [-1431.853] (-1432.405) (-1433.998) (-1433.071) * (-1433.053) (-1433.774) (-1432.540) [-1434.586] -- 0:00:11
836500 -- (-1431.899) [-1432.025] (-1432.337) (-1431.675) * (-1435.005) (-1435.377) [-1433.115] (-1432.833) -- 0:00:11
837000 -- (-1434.022) [-1431.576] (-1434.195) (-1434.179) * (-1434.335) (-1433.846) [-1435.334] (-1431.751) -- 0:00:11
837500 -- (-1437.836) (-1436.098) [-1431.964] (-1432.295) * (-1432.433) (-1435.661) (-1434.275) [-1433.684] -- 0:00:11
838000 -- (-1433.148) (-1436.008) [-1433.904] (-1433.172) * (-1433.435) (-1434.468) [-1434.313] (-1434.815) -- 0:00:11
838500 -- (-1432.480) (-1434.843) (-1434.199) [-1430.330] * (-1432.579) (-1434.616) (-1436.476) [-1433.347] -- 0:00:11
839000 -- (-1437.962) (-1433.689) [-1430.486] (-1437.729) * [-1435.465] (-1435.690) (-1432.341) (-1434.495) -- 0:00:11
839500 -- (-1439.125) [-1431.327] (-1431.871) (-1438.910) * (-1436.606) (-1437.243) [-1432.734] (-1435.928) -- 0:00:11
840000 -- (-1432.892) (-1432.548) [-1430.982] (-1437.041) * [-1432.608] (-1433.979) (-1431.956) (-1434.312) -- 0:00:11
Average standard deviation of split frequencies: 0.009743
840500 -- (-1433.689) (-1430.292) (-1435.078) [-1430.961] * (-1438.004) [-1431.835] (-1434.400) (-1436.054) -- 0:00:11
841000 -- [-1430.677] (-1434.813) (-1431.959) (-1431.325) * (-1433.634) [-1432.683] (-1431.510) (-1431.259) -- 0:00:10
841500 -- [-1432.490] (-1431.192) (-1433.773) (-1432.826) * [-1433.671] (-1434.713) (-1433.086) (-1433.206) -- 0:00:10
842000 -- (-1437.143) [-1432.559] (-1433.549) (-1431.550) * (-1433.453) (-1432.997) [-1433.381] (-1431.434) -- 0:00:10
842500 -- (-1430.353) (-1433.320) [-1433.357] (-1434.737) * (-1433.670) (-1435.969) [-1430.038] (-1435.216) -- 0:00:10
843000 -- (-1433.592) (-1434.438) [-1433.750] (-1432.616) * (-1434.745) [-1432.957] (-1431.978) (-1433.340) -- 0:00:10
843500 -- [-1432.450] (-1434.158) (-1430.726) (-1434.277) * (-1434.840) [-1435.049] (-1437.890) (-1434.339) -- 0:00:10
844000 -- [-1432.064] (-1432.868) (-1432.168) (-1432.924) * [-1434.313] (-1434.634) (-1435.978) (-1432.640) -- 0:00:10
844500 -- [-1431.838] (-1432.702) (-1433.002) (-1434.454) * [-1435.173] (-1436.477) (-1434.767) (-1431.978) -- 0:00:10
845000 -- [-1433.483] (-1433.002) (-1433.453) (-1435.848) * (-1434.384) (-1431.537) [-1431.958] (-1433.323) -- 0:00:10
Average standard deviation of split frequencies: 0.009716
845500 -- [-1433.198] (-1432.125) (-1431.669) (-1436.502) * (-1433.405) [-1436.037] (-1434.308) (-1433.902) -- 0:00:10
846000 -- (-1433.643) (-1432.855) [-1432.796] (-1435.074) * (-1433.161) (-1433.891) (-1432.215) [-1433.201] -- 0:00:10
846500 -- [-1437.775] (-1431.733) (-1432.605) (-1433.698) * (-1432.559) [-1430.222] (-1432.784) (-1433.340) -- 0:00:10
847000 -- (-1433.783) [-1432.650] (-1432.325) (-1434.128) * [-1436.521] (-1430.833) (-1434.907) (-1434.109) -- 0:00:10
847500 -- (-1433.313) [-1432.043] (-1437.799) (-1434.533) * (-1434.826) (-1431.971) [-1435.092] (-1430.061) -- 0:00:10
848000 -- (-1432.184) (-1435.226) [-1436.234] (-1434.263) * (-1438.606) (-1432.422) [-1431.929] (-1431.769) -- 0:00:10
848500 -- [-1430.785] (-1432.580) (-1435.332) (-1434.155) * [-1432.468] (-1433.844) (-1432.576) (-1432.016) -- 0:00:10
849000 -- (-1433.124) (-1434.206) (-1436.579) [-1436.941] * [-1432.572] (-1434.191) (-1433.647) (-1434.897) -- 0:00:10
849500 -- (-1433.130) (-1432.176) [-1433.695] (-1434.882) * [-1432.059] (-1431.269) (-1434.594) (-1436.972) -- 0:00:10
850000 -- (-1433.915) [-1432.843] (-1435.145) (-1434.651) * [-1432.295] (-1433.277) (-1434.093) (-1434.617) -- 0:00:10
Average standard deviation of split frequencies: 0.009732
850500 -- [-1434.191] (-1438.951) (-1437.732) (-1433.874) * (-1432.319) (-1433.896) [-1435.611] (-1431.906) -- 0:00:10
851000 -- (-1433.494) (-1432.310) (-1434.215) [-1434.197] * (-1433.390) (-1435.253) [-1433.024] (-1434.168) -- 0:00:10
851500 -- (-1433.197) (-1438.644) (-1433.461) [-1432.199] * (-1434.017) [-1432.230] (-1432.861) (-1433.380) -- 0:00:10
852000 -- (-1435.883) (-1432.788) [-1434.524] (-1431.640) * (-1434.236) (-1434.936) [-1433.087] (-1433.200) -- 0:00:10
852500 -- (-1438.150) (-1432.503) (-1437.549) [-1431.435] * (-1434.421) (-1434.759) (-1432.951) [-1433.476] -- 0:00:10
853000 -- (-1432.872) (-1433.546) (-1431.706) [-1432.935] * (-1434.803) (-1435.617) [-1433.320] (-1434.091) -- 0:00:10
853500 -- (-1435.006) (-1434.831) [-1432.366] (-1438.041) * [-1437.778] (-1439.094) (-1435.219) (-1435.805) -- 0:00:10
854000 -- (-1436.184) (-1437.296) [-1430.328] (-1432.799) * [-1438.367] (-1435.782) (-1433.587) (-1438.869) -- 0:00:10
854500 -- (-1434.982) (-1433.545) [-1433.207] (-1434.404) * (-1438.117) (-1433.324) (-1432.454) [-1434.595] -- 0:00:10
855000 -- (-1432.940) (-1438.475) (-1431.066) [-1431.767] * (-1435.441) (-1433.730) [-1432.639] (-1434.892) -- 0:00:10
Average standard deviation of split frequencies: 0.009809
855500 -- (-1432.249) (-1437.344) (-1433.059) [-1433.916] * [-1432.659] (-1434.389) (-1433.712) (-1436.232) -- 0:00:09
856000 -- [-1431.980] (-1435.728) (-1432.955) (-1433.179) * (-1431.236) [-1433.077] (-1433.514) (-1440.097) -- 0:00:09
856500 -- (-1431.901) (-1434.527) (-1434.176) [-1433.605] * (-1434.343) (-1437.571) (-1435.921) [-1435.434] -- 0:00:09
857000 -- [-1431.320] (-1433.889) (-1431.569) (-1433.519) * [-1433.091] (-1436.278) (-1434.214) (-1433.739) -- 0:00:09
857500 -- (-1433.057) (-1436.179) [-1434.700] (-1432.570) * (-1440.243) (-1435.268) [-1432.309] (-1433.687) -- 0:00:09
858000 -- (-1433.053) (-1432.232) [-1435.124] (-1435.280) * (-1431.602) (-1434.891) (-1435.842) [-1434.121] -- 0:00:09
858500 -- (-1433.390) (-1434.112) (-1433.526) [-1431.619] * (-1431.726) (-1433.601) (-1433.315) [-1438.449] -- 0:00:09
859000 -- (-1434.995) (-1434.490) [-1434.968] (-1436.185) * (-1435.772) (-1435.659) [-1435.629] (-1436.848) -- 0:00:09
859500 -- [-1432.790] (-1433.374) (-1435.191) (-1432.424) * (-1435.312) (-1433.779) (-1436.694) [-1435.769] -- 0:00:09
860000 -- [-1433.248] (-1433.318) (-1438.337) (-1432.891) * [-1438.142] (-1433.597) (-1434.979) (-1432.960) -- 0:00:09
Average standard deviation of split frequencies: 0.009380
860500 -- (-1436.959) [-1430.402] (-1434.108) (-1432.683) * (-1435.796) (-1436.941) (-1433.400) [-1431.687] -- 0:00:09
861000 -- (-1432.115) [-1431.236] (-1434.289) (-1430.433) * (-1435.995) (-1439.468) [-1433.546] (-1431.324) -- 0:00:09
861500 -- (-1433.704) (-1433.369) [-1434.391] (-1434.416) * [-1434.974] (-1432.538) (-1436.199) (-1432.854) -- 0:00:09
862000 -- (-1434.874) [-1433.068] (-1432.653) (-1434.395) * (-1434.032) (-1434.511) (-1431.515) [-1431.240] -- 0:00:09
862500 -- (-1433.515) (-1436.962) (-1436.927) [-1434.032] * (-1434.100) (-1430.362) (-1434.091) [-1429.527] -- 0:00:09
863000 -- [-1432.933] (-1434.678) (-1437.085) (-1434.902) * [-1434.138] (-1432.045) (-1435.576) (-1434.583) -- 0:00:09
863500 -- (-1433.752) (-1435.126) (-1439.102) [-1433.799] * (-1433.846) (-1433.483) [-1433.810] (-1431.406) -- 0:00:09
864000 -- [-1436.059] (-1435.537) (-1439.051) (-1434.456) * (-1431.119) [-1431.968] (-1433.248) (-1432.479) -- 0:00:09
864500 -- (-1435.908) [-1429.891] (-1434.644) (-1434.090) * [-1434.764] (-1433.961) (-1433.594) (-1434.068) -- 0:00:09
865000 -- (-1433.510) (-1432.431) (-1431.675) [-1433.756] * (-1435.135) (-1431.781) (-1434.821) [-1433.879] -- 0:00:09
Average standard deviation of split frequencies: 0.009356
865500 -- (-1432.942) (-1436.184) [-1432.389] (-1434.482) * [-1436.735] (-1432.867) (-1435.453) (-1433.098) -- 0:00:09
866000 -- (-1435.645) (-1441.652) [-1436.966] (-1430.601) * (-1432.122) (-1433.173) [-1433.384] (-1432.804) -- 0:00:09
866500 -- (-1437.040) [-1435.607] (-1434.030) (-1433.502) * [-1432.827] (-1437.333) (-1430.489) (-1434.139) -- 0:00:09
867000 -- (-1434.409) (-1437.276) [-1433.251] (-1434.989) * [-1433.916] (-1430.712) (-1433.653) (-1432.775) -- 0:00:09
867500 -- [-1433.629] (-1433.952) (-1435.890) (-1435.460) * (-1434.260) (-1435.706) [-1429.908] (-1433.170) -- 0:00:09
868000 -- (-1431.401) (-1435.266) [-1434.168] (-1433.725) * (-1439.067) (-1435.825) (-1432.838) [-1429.323] -- 0:00:09
868500 -- (-1438.476) (-1436.685) [-1434.092] (-1434.117) * (-1432.810) [-1434.899] (-1434.946) (-1433.394) -- 0:00:09
869000 -- (-1444.643) [-1433.550] (-1432.299) (-1434.675) * (-1432.101) (-1434.504) [-1430.412] (-1436.005) -- 0:00:09
869500 -- (-1434.462) (-1434.007) (-1431.552) [-1431.396] * (-1435.055) [-1433.095] (-1433.888) (-1435.955) -- 0:00:09
870000 -- (-1432.875) [-1434.185] (-1436.407) (-1433.410) * (-1433.847) (-1433.447) (-1432.184) [-1434.116] -- 0:00:08
Average standard deviation of split frequencies: 0.009340
870500 -- (-1432.958) (-1432.304) [-1432.088] (-1439.528) * (-1431.092) (-1432.507) [-1431.823] (-1432.346) -- 0:00:08
871000 -- [-1434.509] (-1434.587) (-1432.161) (-1432.637) * (-1432.100) [-1433.874] (-1431.891) (-1433.147) -- 0:00:08
871500 -- (-1435.046) (-1431.792) (-1435.354) [-1433.325] * [-1437.925] (-1431.542) (-1436.282) (-1431.756) -- 0:00:08
872000 -- [-1432.718] (-1436.231) (-1434.455) (-1433.128) * [-1434.702] (-1431.816) (-1433.361) (-1434.098) -- 0:00:08
872500 -- (-1434.768) [-1432.944] (-1430.679) (-1435.663) * (-1432.944) (-1433.057) [-1431.936] (-1431.484) -- 0:00:08
873000 -- (-1431.258) (-1437.702) [-1431.577] (-1431.668) * (-1435.621) [-1429.945] (-1433.675) (-1434.377) -- 0:00:08
873500 -- (-1434.803) (-1442.053) [-1430.741] (-1434.599) * (-1434.376) (-1431.121) [-1435.336] (-1432.097) -- 0:00:08
874000 -- (-1436.273) [-1437.477] (-1435.787) (-1433.658) * (-1432.078) (-1431.960) [-1431.181] (-1432.484) -- 0:00:08
874500 -- (-1436.035) [-1433.329] (-1433.702) (-1439.124) * [-1432.952] (-1430.865) (-1431.912) (-1432.658) -- 0:00:08
875000 -- (-1432.709) (-1431.764) (-1433.271) [-1433.349] * [-1433.099] (-1433.083) (-1432.518) (-1432.326) -- 0:00:08
Average standard deviation of split frequencies: 0.009316
875500 -- (-1433.784) (-1431.802) [-1432.917] (-1433.950) * (-1433.833) (-1433.665) (-1431.017) [-1430.824] -- 0:00:08
876000 -- (-1434.431) (-1433.498) (-1433.450) [-1433.568] * (-1435.251) (-1434.008) (-1434.567) [-1436.998] -- 0:00:08
876500 -- (-1435.694) [-1435.198] (-1430.145) (-1435.566) * (-1434.292) [-1434.177] (-1429.815) (-1431.888) -- 0:00:08
877000 -- [-1431.842] (-1434.297) (-1432.828) (-1435.824) * (-1434.529) [-1432.749] (-1432.905) (-1434.950) -- 0:00:08
877500 -- (-1435.251) [-1434.778] (-1433.794) (-1434.078) * [-1434.105] (-1434.420) (-1431.019) (-1438.725) -- 0:00:08
878000 -- (-1434.086) [-1433.577] (-1432.745) (-1433.371) * (-1434.324) [-1433.178] (-1431.682) (-1435.469) -- 0:00:08
878500 -- [-1432.910] (-1434.301) (-1434.042) (-1435.304) * (-1433.643) (-1435.764) (-1437.046) [-1433.407] -- 0:00:08
879000 -- (-1431.856) (-1432.733) [-1433.328] (-1431.785) * (-1431.992) (-1432.136) (-1430.388) [-1433.911] -- 0:00:08
879500 -- (-1434.056) (-1433.940) [-1431.478] (-1430.985) * (-1435.957) (-1431.095) (-1432.974) [-1433.676] -- 0:00:08
880000 -- (-1432.121) [-1433.429] (-1431.382) (-1433.887) * [-1439.967] (-1433.150) (-1432.920) (-1433.654) -- 0:00:08
Average standard deviation of split frequencies: 0.009468
880500 -- (-1434.786) [-1430.697] (-1432.746) (-1433.531) * (-1437.986) [-1432.998] (-1431.325) (-1434.307) -- 0:00:08
881000 -- [-1431.797] (-1434.217) (-1430.465) (-1434.775) * (-1432.071) (-1431.704) [-1432.753] (-1434.839) -- 0:00:08
881500 -- (-1434.934) (-1434.379) (-1435.237) [-1433.960] * (-1433.733) (-1432.380) [-1434.981] (-1433.653) -- 0:00:08
882000 -- (-1434.768) (-1434.382) [-1429.794] (-1434.479) * (-1432.006) (-1431.060) [-1431.744] (-1433.042) -- 0:00:08
882500 -- (-1433.091) [-1435.672] (-1430.469) (-1433.906) * (-1433.363) (-1432.694) (-1432.208) [-1433.489] -- 0:00:08
883000 -- (-1432.937) (-1437.014) (-1430.933) [-1433.784] * (-1436.883) (-1433.785) (-1431.289) [-1433.505] -- 0:00:08
883500 -- (-1433.016) (-1434.347) (-1434.338) [-1435.187] * (-1439.335) (-1435.790) [-1432.552] (-1434.901) -- 0:00:08
884000 -- (-1439.814) (-1433.018) [-1434.410] (-1433.890) * [-1435.482] (-1432.693) (-1432.025) (-1436.704) -- 0:00:08
884500 -- (-1433.526) (-1432.936) [-1432.994] (-1434.029) * (-1432.406) (-1432.583) (-1434.783) [-1433.120] -- 0:00:07
885000 -- (-1436.030) (-1433.799) (-1433.020) [-1433.721] * (-1438.398) (-1431.788) [-1433.704] (-1435.069) -- 0:00:07
Average standard deviation of split frequencies: 0.009810
885500 -- (-1438.051) (-1431.275) (-1432.994) [-1430.807] * (-1439.489) (-1433.755) [-1433.543] (-1437.908) -- 0:00:07
886000 -- (-1434.258) [-1431.822] (-1435.523) (-1433.031) * (-1434.612) (-1434.201) [-1433.849] (-1431.175) -- 0:00:07
886500 -- (-1433.706) (-1434.930) [-1432.690] (-1433.423) * (-1434.402) (-1433.887) (-1433.507) [-1432.998] -- 0:00:07
887000 -- (-1433.695) (-1434.587) (-1434.945) [-1431.447] * (-1433.455) (-1432.366) [-1432.333] (-1434.305) -- 0:00:07
887500 -- (-1434.694) [-1432.126] (-1436.263) (-1432.659) * (-1438.729) (-1432.945) (-1433.135) [-1433.132] -- 0:00:07
888000 -- (-1435.210) [-1433.488] (-1433.383) (-1430.974) * (-1440.823) [-1432.310] (-1432.430) (-1437.648) -- 0:00:07
888500 -- (-1433.578) [-1432.226] (-1432.063) (-1429.040) * (-1433.083) (-1433.766) [-1434.358] (-1433.129) -- 0:00:07
889000 -- [-1434.246] (-1434.098) (-1433.975) (-1434.639) * (-1432.483) [-1434.891] (-1437.617) (-1431.421) -- 0:00:07
889500 -- (-1433.666) (-1434.191) (-1433.301) [-1435.505] * [-1431.674] (-1431.090) (-1432.459) (-1438.241) -- 0:00:07
890000 -- [-1434.681] (-1433.823) (-1433.160) (-1441.483) * (-1432.648) (-1432.433) [-1432.063] (-1431.832) -- 0:00:07
Average standard deviation of split frequencies: 0.009361
890500 -- [-1433.489] (-1433.216) (-1434.238) (-1431.390) * (-1434.491) (-1434.296) [-1431.808] (-1436.201) -- 0:00:07
891000 -- (-1438.292) [-1432.451] (-1439.218) (-1435.750) * [-1430.846] (-1435.403) (-1435.258) (-1439.134) -- 0:00:07
891500 -- [-1434.346] (-1434.301) (-1438.796) (-1435.366) * (-1433.398) (-1431.255) [-1433.390] (-1433.208) -- 0:00:07
892000 -- [-1435.723] (-1434.134) (-1435.730) (-1436.414) * (-1432.905) (-1433.052) (-1438.055) [-1430.372] -- 0:00:07
892500 -- (-1437.814) (-1436.740) [-1434.107] (-1431.839) * [-1430.305] (-1439.759) (-1434.281) (-1432.878) -- 0:00:07
893000 -- (-1434.199) [-1432.079] (-1434.033) (-1434.299) * (-1433.624) (-1431.409) [-1434.923] (-1431.656) -- 0:00:07
893500 -- (-1433.403) (-1434.885) [-1434.269] (-1434.310) * [-1432.386] (-1434.953) (-1432.667) (-1433.618) -- 0:00:07
894000 -- (-1434.540) (-1430.812) (-1436.454) [-1431.518] * (-1436.453) (-1441.741) (-1434.052) [-1432.353] -- 0:00:07
894500 -- (-1435.335) (-1431.386) [-1436.435] (-1434.233) * (-1437.015) (-1434.587) [-1433.391] (-1433.083) -- 0:00:07
895000 -- (-1434.591) [-1434.108] (-1433.317) (-1434.501) * (-1433.060) (-1433.658) (-1433.370) [-1431.042] -- 0:00:07
Average standard deviation of split frequencies: 0.008977
895500 -- (-1434.682) [-1431.385] (-1431.474) (-1431.815) * (-1432.929) (-1434.672) [-1433.068] (-1432.006) -- 0:00:07
896000 -- (-1432.329) (-1433.670) (-1434.344) [-1434.870] * (-1432.350) (-1435.305) [-1435.543] (-1432.312) -- 0:00:07
896500 -- (-1432.385) (-1433.124) (-1433.268) [-1432.839] * (-1430.771) (-1441.447) [-1433.802] (-1430.951) -- 0:00:07
897000 -- (-1436.979) (-1430.951) [-1433.848] (-1433.636) * (-1433.711) [-1433.401] (-1434.400) (-1432.199) -- 0:00:07
897500 -- [-1436.466] (-1433.669) (-1433.549) (-1432.656) * [-1431.809] (-1436.768) (-1432.487) (-1432.199) -- 0:00:07
898000 -- [-1433.939] (-1439.405) (-1434.556) (-1436.973) * [-1429.395] (-1435.006) (-1430.997) (-1431.259) -- 0:00:07
898500 -- [-1433.811] (-1436.384) (-1433.537) (-1434.344) * (-1435.083) (-1437.853) (-1439.223) [-1433.488] -- 0:00:07
899000 -- (-1432.058) [-1432.463] (-1434.949) (-1437.955) * [-1432.082] (-1436.444) (-1431.068) (-1439.019) -- 0:00:06
899500 -- (-1433.939) [-1432.392] (-1438.821) (-1443.614) * (-1434.024) (-1436.735) [-1433.906] (-1436.534) -- 0:00:06
900000 -- [-1433.057] (-1436.868) (-1434.412) (-1440.964) * (-1436.559) (-1436.174) (-1435.729) [-1431.429] -- 0:00:06
Average standard deviation of split frequencies: 0.008767
900500 -- [-1433.383] (-1435.353) (-1433.403) (-1430.960) * [-1432.775] (-1433.336) (-1434.532) (-1434.493) -- 0:00:06
901000 -- [-1432.848] (-1432.707) (-1434.191) (-1430.578) * (-1431.999) (-1434.422) (-1433.989) [-1431.353] -- 0:00:06
901500 -- (-1434.266) (-1431.171) (-1434.413) [-1432.727] * (-1431.220) [-1433.789] (-1433.361) (-1431.887) -- 0:00:06
902000 -- (-1435.461) [-1431.420] (-1434.294) (-1433.643) * (-1432.381) (-1433.771) (-1433.397) [-1432.712] -- 0:00:06
902500 -- (-1433.915) [-1431.203] (-1435.559) (-1431.920) * (-1430.126) (-1433.337) (-1432.703) [-1432.720] -- 0:00:06
903000 -- (-1435.529) (-1432.485) (-1432.769) [-1433.457] * (-1434.912) (-1434.488) [-1434.631] (-1434.681) -- 0:00:06
903500 -- [-1435.222] (-1437.016) (-1430.175) (-1434.363) * [-1432.973] (-1437.365) (-1435.903) (-1432.432) -- 0:00:06
904000 -- (-1435.558) (-1431.682) [-1432.266] (-1436.593) * (-1439.321) [-1433.666] (-1432.783) (-1438.806) -- 0:00:06
904500 -- (-1434.397) [-1432.185] (-1432.604) (-1436.943) * (-1433.268) (-1434.429) (-1431.555) [-1434.993] -- 0:00:06
905000 -- (-1435.182) [-1434.766] (-1432.557) (-1434.290) * (-1438.661) (-1435.741) (-1436.180) [-1434.070] -- 0:00:06
Average standard deviation of split frequencies: 0.008780
905500 -- [-1432.963] (-1435.027) (-1431.683) (-1433.226) * (-1432.128) [-1432.700] (-1436.584) (-1432.824) -- 0:00:06
906000 -- (-1433.010) (-1434.482) (-1436.034) [-1432.116] * [-1432.688] (-1431.604) (-1436.066) (-1433.277) -- 0:00:06
906500 -- [-1432.885] (-1436.715) (-1439.011) (-1434.820) * (-1433.002) [-1433.575] (-1431.824) (-1431.262) -- 0:00:06
907000 -- [-1434.586] (-1438.364) (-1432.547) (-1434.188) * (-1432.949) (-1435.440) [-1432.548] (-1431.881) -- 0:00:06
907500 -- (-1432.155) [-1432.827] (-1433.318) (-1435.780) * (-1434.370) (-1436.059) [-1432.546] (-1433.193) -- 0:00:06
908000 -- [-1432.698] (-1433.166) (-1435.178) (-1436.057) * [-1431.102] (-1436.208) (-1436.251) (-1435.893) -- 0:00:06
908500 -- [-1434.428] (-1435.707) (-1430.501) (-1434.689) * (-1433.751) (-1437.270) [-1433.758] (-1434.319) -- 0:00:06
909000 -- (-1433.109) (-1434.335) (-1430.154) [-1432.228] * (-1436.881) (-1434.319) [-1434.018] (-1435.182) -- 0:00:06
909500 -- (-1433.489) (-1433.527) [-1434.828] (-1437.081) * (-1432.270) [-1432.819] (-1432.610) (-1432.533) -- 0:00:06
910000 -- (-1433.720) [-1433.447] (-1431.585) (-1432.993) * (-1433.247) (-1434.276) [-1432.858] (-1433.066) -- 0:00:06
Average standard deviation of split frequencies: 0.008574
910500 -- (-1433.769) (-1440.926) [-1432.799] (-1433.638) * [-1431.788] (-1433.365) (-1438.627) (-1433.652) -- 0:00:06
911000 -- [-1433.832] (-1436.441) (-1431.885) (-1432.337) * (-1434.159) [-1432.763] (-1432.910) (-1431.734) -- 0:00:06
911500 -- (-1435.272) (-1433.179) [-1431.836] (-1433.383) * (-1433.412) [-1432.884] (-1432.406) (-1434.097) -- 0:00:06
912000 -- (-1434.573) (-1433.610) (-1433.464) [-1436.091] * [-1431.746] (-1433.734) (-1432.258) (-1434.856) -- 0:00:06
912500 -- (-1435.327) (-1435.211) (-1434.870) [-1434.629] * (-1432.077) [-1433.823] (-1434.100) (-1431.682) -- 0:00:06
913000 -- (-1433.445) (-1434.722) (-1433.280) [-1434.488] * (-1433.743) (-1432.491) [-1432.529] (-1431.099) -- 0:00:06
913500 -- (-1433.577) [-1434.038] (-1434.622) (-1434.541) * [-1433.035] (-1433.675) (-1432.531) (-1433.480) -- 0:00:05
914000 -- (-1432.558) [-1433.249] (-1431.439) (-1436.216) * (-1433.885) [-1434.012] (-1433.541) (-1431.001) -- 0:00:05
914500 -- (-1433.334) (-1433.041) [-1430.829] (-1437.137) * (-1433.983) (-1434.544) (-1433.236) [-1431.031] -- 0:00:05
915000 -- (-1433.353) (-1434.474) (-1432.012) [-1437.045] * [-1434.409] (-1438.557) (-1436.086) (-1433.505) -- 0:00:05
Average standard deviation of split frequencies: 0.008363
915500 -- [-1433.858] (-1435.413) (-1438.513) (-1439.752) * (-1432.986) [-1439.630] (-1431.151) (-1433.859) -- 0:00:05
916000 -- (-1435.510) (-1434.922) (-1432.677) [-1432.837] * [-1434.225] (-1434.685) (-1429.923) (-1430.714) -- 0:00:05
916500 -- (-1433.117) [-1437.742] (-1432.920) (-1434.975) * (-1432.254) (-1437.357) (-1432.440) [-1433.349] -- 0:00:05
917000 -- (-1432.679) (-1438.462) [-1431.599] (-1433.740) * [-1432.175] (-1434.776) (-1433.366) (-1435.342) -- 0:00:05
917500 -- (-1433.867) (-1433.407) (-1434.143) [-1432.633] * (-1433.026) (-1431.684) [-1435.898] (-1434.058) -- 0:00:05
918000 -- (-1434.203) (-1432.858) (-1430.217) [-1431.460] * (-1433.361) [-1437.866] (-1433.751) (-1437.025) -- 0:00:05
918500 -- (-1433.255) (-1443.561) [-1431.439] (-1435.808) * (-1431.340) [-1432.513] (-1434.763) (-1430.017) -- 0:00:05
919000 -- [-1433.261] (-1435.869) (-1431.924) (-1435.077) * (-1434.412) (-1432.678) (-1435.444) [-1432.802] -- 0:00:05
919500 -- (-1435.113) [-1432.957] (-1432.488) (-1432.602) * (-1435.027) [-1431.483] (-1436.949) (-1432.845) -- 0:00:05
920000 -- (-1436.375) (-1432.312) [-1432.104] (-1434.286) * [-1433.093] (-1439.038) (-1434.269) (-1431.962) -- 0:00:05
Average standard deviation of split frequencies: 0.008544
920500 -- (-1436.281) [-1432.717] (-1432.451) (-1433.158) * (-1433.226) (-1433.080) [-1434.055] (-1435.544) -- 0:00:05
921000 -- (-1432.448) (-1435.994) (-1433.192) [-1435.133] * [-1436.217] (-1436.066) (-1433.642) (-1435.251) -- 0:00:05
921500 -- (-1437.713) [-1432.606] (-1434.211) (-1432.819) * (-1434.922) (-1437.291) [-1434.833] (-1437.285) -- 0:00:05
922000 -- (-1430.927) (-1441.303) (-1436.259) [-1432.646] * [-1431.130] (-1434.422) (-1433.456) (-1434.338) -- 0:00:05
922500 -- (-1433.165) (-1433.066) (-1436.255) [-1432.205] * (-1433.690) (-1435.395) (-1430.117) [-1432.188] -- 0:00:05
923000 -- [-1434.207] (-1432.998) (-1435.240) (-1432.909) * (-1432.553) (-1432.928) [-1433.601] (-1432.784) -- 0:00:05
923500 -- (-1433.328) (-1430.531) [-1437.318] (-1440.404) * [-1431.751] (-1436.292) (-1434.688) (-1436.104) -- 0:00:05
924000 -- (-1432.938) (-1433.466) (-1433.686) [-1437.574] * (-1432.119) [-1433.483] (-1434.381) (-1432.850) -- 0:00:05
924500 -- (-1430.693) (-1434.446) [-1435.977] (-1441.832) * (-1433.630) (-1430.108) (-1435.188) [-1433.542] -- 0:00:05
925000 -- (-1434.917) (-1434.761) [-1436.510] (-1432.347) * (-1433.308) (-1433.315) [-1433.575] (-1436.162) -- 0:00:05
Average standard deviation of split frequencies: 0.008782
925500 -- (-1435.575) (-1436.290) (-1436.565) [-1432.799] * (-1430.213) (-1434.539) [-1431.936] (-1433.074) -- 0:00:05
926000 -- (-1436.634) (-1434.886) [-1435.256] (-1434.173) * (-1433.012) (-1435.189) [-1434.179] (-1436.230) -- 0:00:05
926500 -- (-1436.677) (-1432.846) [-1434.388] (-1431.840) * (-1430.037) (-1433.684) [-1433.599] (-1434.988) -- 0:00:05
927000 -- (-1434.704) (-1435.692) [-1432.084] (-1435.165) * (-1430.739) (-1435.477) [-1434.141] (-1435.053) -- 0:00:05
927500 -- [-1432.863] (-1435.500) (-1431.752) (-1433.145) * (-1433.990) (-1434.084) (-1436.094) [-1433.406] -- 0:00:05
928000 -- (-1434.502) (-1433.927) [-1431.873] (-1434.109) * (-1431.693) (-1434.140) [-1434.140] (-1436.973) -- 0:00:04
928500 -- [-1430.594] (-1434.263) (-1433.933) (-1435.822) * [-1431.635] (-1436.755) (-1432.818) (-1431.341) -- 0:00:04
929000 -- [-1433.790] (-1435.446) (-1433.218) (-1432.727) * [-1434.334] (-1433.844) (-1432.087) (-1431.914) -- 0:00:04
929500 -- (-1437.112) (-1434.782) [-1432.504] (-1432.600) * (-1432.231) (-1431.902) [-1432.479] (-1434.803) -- 0:00:04
930000 -- (-1432.703) [-1433.146] (-1432.932) (-1432.521) * (-1431.190) (-1432.517) (-1437.104) [-1434.636] -- 0:00:04
Average standard deviation of split frequencies: 0.008738
930500 -- (-1430.457) [-1434.477] (-1433.765) (-1434.723) * (-1433.953) (-1433.523) (-1436.695) [-1436.904] -- 0:00:04
931000 -- (-1431.716) [-1432.460] (-1436.228) (-1432.720) * (-1436.449) [-1432.478] (-1435.145) (-1437.195) -- 0:00:04
931500 -- [-1432.408] (-1437.098) (-1438.237) (-1437.198) * (-1433.083) (-1434.856) (-1436.258) [-1435.368] -- 0:00:04
932000 -- (-1433.734) (-1433.014) (-1433.388) [-1431.698] * [-1433.013] (-1435.907) (-1439.393) (-1433.560) -- 0:00:04
932500 -- [-1434.137] (-1431.767) (-1440.201) (-1434.121) * [-1431.643] (-1433.810) (-1432.899) (-1435.693) -- 0:00:04
933000 -- [-1431.870] (-1433.850) (-1440.772) (-1433.673) * (-1434.453) (-1433.170) (-1432.876) [-1434.919] -- 0:00:04
933500 -- (-1436.062) [-1435.484] (-1441.792) (-1434.922) * (-1433.153) [-1430.668] (-1436.845) (-1432.717) -- 0:00:04
934000 -- (-1434.875) (-1432.576) (-1435.135) [-1434.519] * [-1429.993] (-1431.270) (-1439.770) (-1432.208) -- 0:00:04
934500 -- [-1433.475] (-1432.568) (-1434.087) (-1434.455) * (-1433.685) (-1432.084) [-1434.802] (-1436.082) -- 0:00:04
935000 -- [-1432.265] (-1432.561) (-1432.909) (-1432.346) * (-1434.030) [-1433.561] (-1431.601) (-1437.029) -- 0:00:04
Average standard deviation of split frequencies: 0.008908
935500 -- (-1432.230) [-1433.284] (-1435.169) (-1433.878) * (-1434.406) (-1431.116) (-1430.889) [-1431.465] -- 0:00:04
936000 -- (-1433.683) [-1433.921] (-1434.555) (-1435.511) * [-1432.941] (-1433.372) (-1433.712) (-1431.814) -- 0:00:04
936500 -- (-1433.322) (-1436.238) [-1433.638] (-1432.248) * (-1436.032) (-1430.412) [-1431.926] (-1435.840) -- 0:00:04
937000 -- (-1431.179) [-1433.593] (-1435.025) (-1437.715) * (-1436.156) [-1432.911] (-1434.726) (-1433.112) -- 0:00:04
937500 -- [-1434.720] (-1434.186) (-1432.297) (-1433.531) * [-1433.406] (-1437.798) (-1433.034) (-1432.194) -- 0:00:04
938000 -- (-1436.816) [-1431.817] (-1434.460) (-1432.579) * (-1433.469) (-1434.035) (-1431.568) [-1433.841] -- 0:00:04
938500 -- (-1436.980) [-1432.884] (-1433.428) (-1434.522) * [-1434.856] (-1437.739) (-1435.783) (-1434.959) -- 0:00:04
939000 -- (-1434.225) [-1434.252] (-1435.167) (-1435.498) * (-1433.807) (-1438.004) [-1433.387] (-1434.545) -- 0:00:04
939500 -- (-1434.115) (-1437.954) [-1433.946] (-1438.820) * (-1433.771) (-1433.845) [-1432.597] (-1433.127) -- 0:00:04
940000 -- (-1432.508) [-1431.820] (-1434.452) (-1434.606) * [-1432.794] (-1434.385) (-1434.490) (-1432.006) -- 0:00:04
Average standard deviation of split frequencies: 0.008175
940500 -- (-1432.845) [-1430.949] (-1432.248) (-1431.611) * (-1436.797) (-1434.168) [-1435.163] (-1433.187) -- 0:00:04
941000 -- (-1432.717) (-1434.183) [-1435.431] (-1434.621) * (-1436.364) (-1435.959) (-1433.512) [-1436.430] -- 0:00:04
941500 -- (-1434.148) [-1432.916] (-1440.754) (-1433.613) * (-1433.492) (-1436.790) [-1432.180] (-1436.091) -- 0:00:04
942000 -- [-1432.804] (-1431.907) (-1431.894) (-1433.613) * (-1432.548) (-1435.222) [-1434.481] (-1436.141) -- 0:00:04
942500 -- (-1433.617) (-1431.420) (-1433.664) [-1433.313] * (-1434.339) [-1430.973] (-1434.454) (-1439.511) -- 0:00:03
943000 -- (-1433.251) (-1433.571) (-1434.171) [-1435.443] * (-1434.896) [-1432.821] (-1434.294) (-1433.672) -- 0:00:03
943500 -- (-1436.206) (-1432.935) (-1435.207) [-1436.403] * (-1435.068) [-1431.456] (-1431.800) (-1436.746) -- 0:00:03
944000 -- (-1433.104) (-1438.455) (-1434.449) [-1437.462] * (-1433.995) (-1433.377) (-1434.076) [-1435.523] -- 0:00:03
944500 -- (-1431.787) [-1436.239] (-1433.848) (-1432.871) * [-1435.692] (-1435.902) (-1435.099) (-1436.388) -- 0:00:03
945000 -- [-1433.783] (-1436.656) (-1433.290) (-1434.080) * (-1438.312) (-1432.102) (-1436.980) [-1431.366] -- 0:00:03
Average standard deviation of split frequencies: 0.008004
945500 -- (-1433.776) [-1433.936] (-1433.356) (-1434.751) * (-1433.372) [-1431.884] (-1434.605) (-1432.135) -- 0:00:03
946000 -- (-1431.333) (-1431.569) [-1434.074] (-1434.220) * (-1435.425) (-1433.291) (-1433.748) [-1432.254] -- 0:00:03
946500 -- (-1434.196) (-1436.581) [-1432.695] (-1434.732) * (-1433.356) (-1433.267) (-1434.718) [-1435.828] -- 0:00:03
947000 -- (-1433.176) (-1434.548) [-1433.952] (-1431.726) * (-1434.061) [-1433.693] (-1435.065) (-1434.187) -- 0:00:03
947500 -- (-1433.197) [-1432.615] (-1434.067) (-1436.039) * [-1432.474] (-1433.147) (-1431.966) (-1433.640) -- 0:00:03
948000 -- (-1432.738) (-1430.291) (-1433.471) [-1432.855] * (-1435.570) (-1434.344) [-1434.353] (-1432.747) -- 0:00:03
948500 -- (-1434.394) (-1432.582) [-1431.448] (-1431.316) * [-1432.397] (-1434.490) (-1433.638) (-1436.038) -- 0:00:03
949000 -- (-1432.678) (-1431.106) [-1433.679] (-1437.302) * [-1432.401] (-1433.038) (-1434.172) (-1435.518) -- 0:00:03
949500 -- (-1432.394) (-1431.008) [-1432.158] (-1431.605) * (-1433.172) (-1432.755) (-1440.503) [-1433.996] -- 0:00:03
950000 -- (-1433.900) [-1431.329] (-1433.158) (-1431.067) * [-1433.495] (-1433.585) (-1434.698) (-1435.837) -- 0:00:03
Average standard deviation of split frequencies: 0.007901
950500 -- (-1431.772) (-1434.107) (-1435.668) [-1432.960] * (-1432.498) [-1434.439] (-1434.288) (-1434.826) -- 0:00:03
951000 -- (-1435.687) (-1431.591) [-1430.563] (-1434.113) * (-1433.127) (-1437.134) [-1433.811] (-1433.604) -- 0:00:03
951500 -- [-1434.883] (-1432.195) (-1431.835) (-1434.203) * [-1433.364] (-1434.402) (-1435.702) (-1436.048) -- 0:00:03
952000 -- [-1433.061] (-1432.262) (-1433.299) (-1432.961) * (-1433.435) [-1434.506] (-1436.313) (-1431.598) -- 0:00:03
952500 -- [-1434.846] (-1433.517) (-1431.912) (-1433.562) * (-1434.738) (-1432.601) [-1435.826] (-1434.332) -- 0:00:03
953000 -- (-1432.273) (-1432.271) [-1430.419] (-1438.114) * [-1436.152] (-1435.081) (-1438.880) (-1430.634) -- 0:00:03
953500 -- (-1440.451) [-1432.966] (-1435.466) (-1434.767) * [-1434.788] (-1431.631) (-1433.659) (-1431.344) -- 0:00:03
954000 -- (-1436.242) (-1433.153) [-1434.837] (-1434.945) * [-1432.264] (-1433.102) (-1433.841) (-1430.267) -- 0:00:03
954500 -- [-1433.736] (-1433.301) (-1433.538) (-1434.530) * (-1432.376) (-1437.791) [-1433.691] (-1433.286) -- 0:00:03
955000 -- (-1435.873) (-1432.799) [-1435.119] (-1433.449) * (-1433.148) [-1434.607] (-1433.033) (-1440.101) -- 0:00:03
Average standard deviation of split frequencies: 0.007824
955500 -- (-1435.417) (-1436.411) (-1431.975) [-1432.816] * [-1431.956] (-1436.502) (-1434.456) (-1433.869) -- 0:00:03
956000 -- (-1434.716) [-1433.598] (-1431.751) (-1431.041) * (-1434.794) (-1434.465) (-1432.037) [-1433.994] -- 0:00:03
956500 -- (-1438.751) (-1432.402) (-1434.027) [-1432.108] * (-1435.342) (-1433.425) (-1434.410) [-1433.918] -- 0:00:03
957000 -- (-1430.977) (-1432.366) (-1433.564) [-1430.005] * [-1432.453] (-1434.168) (-1439.326) (-1434.536) -- 0:00:02
957500 -- (-1433.980) (-1434.801) [-1434.313] (-1432.562) * (-1431.466) (-1431.195) [-1431.851] (-1436.084) -- 0:00:02
958000 -- (-1435.931) (-1435.798) (-1431.572) [-1432.533] * [-1435.484] (-1436.036) (-1433.344) (-1438.196) -- 0:00:02
958500 -- (-1432.912) [-1437.288] (-1432.294) (-1434.873) * (-1433.685) [-1435.324] (-1433.677) (-1436.061) -- 0:00:02
959000 -- [-1433.473] (-1431.870) (-1432.899) (-1433.478) * (-1434.918) [-1431.576] (-1432.699) (-1434.648) -- 0:00:02
959500 -- [-1432.402] (-1430.604) (-1433.597) (-1433.176) * [-1432.490] (-1438.192) (-1437.153) (-1433.790) -- 0:00:02
960000 -- (-1432.783) (-1431.525) [-1433.063] (-1434.827) * (-1437.744) [-1432.587] (-1434.513) (-1437.272) -- 0:00:02
Average standard deviation of split frequencies: 0.008557
960500 -- (-1433.697) [-1431.980] (-1431.953) (-1436.091) * (-1432.724) [-1433.075] (-1434.050) (-1432.936) -- 0:00:02
961000 -- (-1435.019) (-1434.948) (-1433.495) [-1431.139] * (-1432.524) [-1433.864] (-1432.296) (-1434.138) -- 0:00:02
961500 -- (-1434.669) [-1433.080] (-1434.084) (-1433.648) * (-1438.266) (-1434.234) [-1433.831] (-1433.414) -- 0:00:02
962000 -- (-1431.503) [-1434.823] (-1434.220) (-1431.630) * (-1432.514) [-1431.468] (-1433.143) (-1437.392) -- 0:00:02
962500 -- [-1436.399] (-1436.261) (-1432.094) (-1432.883) * (-1432.179) (-1434.176) [-1437.030] (-1435.376) -- 0:00:02
963000 -- [-1435.639] (-1431.449) (-1431.273) (-1432.579) * (-1435.091) (-1432.736) (-1430.680) [-1434.006] -- 0:00:02
963500 -- (-1436.487) (-1433.824) [-1434.836] (-1433.951) * [-1435.872] (-1434.325) (-1431.144) (-1434.566) -- 0:00:02
964000 -- (-1434.127) (-1433.004) (-1434.045) [-1434.937] * (-1434.763) (-1432.475) [-1432.277] (-1434.692) -- 0:00:02
964500 -- (-1434.543) (-1431.907) (-1433.082) [-1433.084] * [-1433.186] (-1436.435) (-1435.230) (-1434.763) -- 0:00:02
965000 -- (-1433.726) (-1432.367) (-1433.923) [-1432.680] * [-1433.300] (-1432.899) (-1435.936) (-1434.442) -- 0:00:02
Average standard deviation of split frequencies: 0.008479
965500 -- [-1432.709] (-1437.000) (-1433.488) (-1433.014) * (-1433.271) (-1432.635) [-1436.855] (-1433.334) -- 0:00:02
966000 -- (-1430.716) (-1436.669) (-1431.987) [-1431.913] * (-1435.313) [-1431.787] (-1436.816) (-1431.968) -- 0:00:02
966500 -- (-1431.847) (-1436.325) [-1431.110] (-1435.039) * (-1438.322) (-1433.550) (-1436.623) [-1433.508] -- 0:00:02
967000 -- [-1431.573] (-1436.347) (-1431.882) (-1434.428) * (-1432.890) [-1434.524] (-1435.789) (-1433.988) -- 0:00:02
967500 -- (-1434.719) (-1434.970) (-1431.618) [-1434.670] * [-1433.045] (-1434.299) (-1433.396) (-1433.335) -- 0:00:02
968000 -- (-1430.687) (-1431.843) [-1432.026] (-1433.106) * (-1433.242) [-1432.642] (-1433.459) (-1433.409) -- 0:00:02
968500 -- (-1430.434) (-1432.413) (-1433.922) [-1434.041] * (-1431.753) (-1434.286) [-1435.382] (-1435.035) -- 0:00:02
969000 -- (-1434.778) [-1434.700] (-1437.831) (-1434.370) * (-1434.607) [-1435.272] (-1434.333) (-1433.518) -- 0:00:02
969500 -- (-1430.654) (-1438.997) (-1432.719) [-1439.161] * (-1435.119) (-1431.227) [-1433.256] (-1434.497) -- 0:00:02
970000 -- [-1435.739] (-1435.114) (-1433.778) (-1436.785) * (-1430.309) (-1432.160) [-1433.111] (-1433.077) -- 0:00:02
Average standard deviation of split frequencies: 0.008127
970500 -- [-1432.255] (-1432.680) (-1432.829) (-1436.737) * (-1432.206) (-1431.982) (-1437.039) [-1434.289] -- 0:00:02
971000 -- (-1432.626) (-1432.189) (-1433.505) [-1434.076] * (-1430.921) [-1435.600] (-1436.465) (-1432.097) -- 0:00:02
971500 -- (-1434.874) (-1433.554) (-1434.115) [-1432.106] * [-1433.560] (-1435.726) (-1435.020) (-1432.954) -- 0:00:01
972000 -- (-1434.235) (-1433.568) [-1434.717] (-1432.143) * (-1435.227) (-1438.380) (-1435.303) [-1431.702] -- 0:00:01
972500 -- (-1435.763) (-1433.308) [-1434.637] (-1433.343) * (-1435.606) (-1438.126) (-1435.258) [-1432.238] -- 0:00:01
973000 -- (-1435.750) [-1436.899] (-1434.077) (-1431.939) * (-1431.594) [-1430.897] (-1438.694) (-1434.506) -- 0:00:01
973500 -- (-1432.424) [-1437.075] (-1433.179) (-1434.516) * (-1435.510) (-1433.786) [-1434.068] (-1433.875) -- 0:00:01
974000 -- (-1436.106) (-1430.867) (-1433.636) [-1431.782] * (-1431.256) (-1434.793) (-1431.858) [-1433.636] -- 0:00:01
974500 -- (-1432.706) (-1431.207) [-1432.439] (-1433.930) * (-1436.001) (-1433.845) (-1434.505) [-1434.415] -- 0:00:01
975000 -- (-1435.030) (-1431.919) (-1433.471) [-1433.557] * [-1431.772] (-1432.298) (-1433.146) (-1436.556) -- 0:00:01
Average standard deviation of split frequencies: 0.008211
975500 -- (-1435.935) (-1430.597) [-1437.628] (-1432.905) * (-1432.909) (-1437.289) (-1433.586) [-1432.609] -- 0:00:01
976000 -- (-1433.574) (-1431.387) (-1433.881) [-1435.095] * (-1432.983) (-1434.165) [-1432.884] (-1435.684) -- 0:00:01
976500 -- (-1432.746) (-1434.577) [-1434.691] (-1434.719) * [-1431.243] (-1433.235) (-1431.192) (-1436.407) -- 0:00:01
977000 -- [-1432.883] (-1432.616) (-1433.512) (-1431.753) * (-1432.629) [-1430.462] (-1435.638) (-1434.996) -- 0:00:01
977500 -- (-1435.575) (-1430.890) [-1433.907] (-1434.683) * (-1435.923) [-1432.536] (-1432.927) (-1435.095) -- 0:00:01
978000 -- (-1432.392) (-1435.135) [-1432.114] (-1431.863) * (-1436.716) (-1433.196) [-1433.466] (-1433.467) -- 0:00:01
978500 -- (-1431.108) (-1438.215) (-1432.473) [-1432.550] * (-1435.952) (-1433.020) [-1432.274] (-1433.059) -- 0:00:01
979000 -- (-1433.591) (-1439.337) [-1431.347] (-1434.496) * (-1432.976) (-1432.688) [-1431.431] (-1437.072) -- 0:00:01
979500 -- (-1434.197) (-1434.979) [-1431.445] (-1437.899) * (-1435.531) (-1432.223) [-1436.066] (-1433.224) -- 0:00:01
980000 -- (-1433.912) [-1432.887] (-1432.262) (-1434.490) * (-1436.526) (-1434.136) (-1434.139) [-1431.150] -- 0:00:01
Average standard deviation of split frequencies: 0.008204
980500 -- (-1435.999) (-1433.311) (-1435.038) [-1433.177] * (-1433.374) (-1431.869) [-1433.859] (-1436.134) -- 0:00:01
981000 -- (-1434.606) (-1435.676) [-1432.977] (-1433.960) * (-1433.674) [-1432.259] (-1436.246) (-1433.527) -- 0:00:01
981500 -- (-1435.610) (-1436.784) [-1431.046] (-1434.081) * [-1433.442] (-1433.302) (-1438.239) (-1436.230) -- 0:00:01
982000 -- [-1433.116] (-1432.299) (-1433.213) (-1431.452) * (-1433.283) [-1434.375] (-1433.933) (-1431.840) -- 0:00:01
982500 -- (-1431.959) [-1436.643] (-1432.778) (-1433.164) * (-1435.670) (-1434.713) (-1433.105) [-1430.224] -- 0:00:01
983000 -- (-1432.250) (-1433.322) (-1434.430) [-1431.211] * [-1431.608] (-1431.788) (-1441.687) (-1436.618) -- 0:00:01
983500 -- (-1433.993) (-1432.117) [-1431.239] (-1435.611) * (-1434.796) (-1433.039) [-1431.447] (-1433.543) -- 0:00:01
984000 -- (-1436.116) [-1432.961] (-1433.310) (-1431.461) * (-1432.397) (-1433.782) [-1429.183] (-1434.485) -- 0:00:01
984500 -- (-1431.802) (-1433.371) [-1434.620] (-1436.152) * (-1434.442) [-1432.999] (-1433.578) (-1433.541) -- 0:00:01
985000 -- (-1433.203) (-1431.427) [-1430.977] (-1437.032) * (-1432.935) [-1433.473] (-1430.367) (-1440.317) -- 0:00:01
Average standard deviation of split frequencies: 0.007968
985500 -- (-1435.940) (-1436.684) (-1431.228) [-1436.883] * (-1434.725) (-1434.514) [-1434.122] (-1434.300) -- 0:00:01
986000 -- [-1433.117] (-1433.908) (-1429.602) (-1440.983) * (-1432.856) [-1431.076] (-1433.410) (-1434.714) -- 0:00:00
986500 -- [-1433.705] (-1435.543) (-1431.955) (-1433.418) * (-1431.099) (-1434.005) [-1433.029] (-1436.009) -- 0:00:00
987000 -- (-1433.729) [-1433.510] (-1435.941) (-1434.229) * [-1432.189] (-1434.665) (-1432.202) (-1433.023) -- 0:00:00
987500 -- (-1432.317) (-1433.829) (-1436.525) [-1433.031] * (-1432.785) [-1432.308] (-1432.443) (-1433.444) -- 0:00:00
988000 -- [-1434.567] (-1431.174) (-1433.940) (-1435.544) * (-1431.300) (-1435.056) [-1432.113] (-1431.448) -- 0:00:00
988500 -- (-1439.143) (-1432.706) [-1433.021] (-1433.900) * (-1434.192) (-1432.589) (-1433.032) [-1434.561] -- 0:00:00
989000 -- (-1440.713) (-1435.425) (-1436.439) [-1432.820] * (-1435.402) (-1434.881) (-1435.713) [-1434.249] -- 0:00:00
989500 -- [-1438.024] (-1434.519) (-1432.009) (-1432.492) * (-1440.165) (-1434.628) (-1431.462) [-1434.330] -- 0:00:00
990000 -- (-1436.245) (-1434.598) [-1432.829] (-1433.548) * (-1434.465) [-1434.438] (-1436.147) (-1433.960) -- 0:00:00
Average standard deviation of split frequencies: 0.007614
990500 -- (-1437.237) (-1431.997) (-1431.325) [-1432.788] * (-1435.676) (-1431.450) (-1433.771) [-1433.100] -- 0:00:00
991000 -- [-1432.768] (-1432.640) (-1431.011) (-1434.639) * [-1434.371] (-1431.728) (-1434.775) (-1432.692) -- 0:00:00
991500 -- (-1431.622) (-1434.366) (-1434.027) [-1434.172] * (-1432.896) (-1433.344) (-1430.951) [-1431.439] -- 0:00:00
992000 -- (-1431.578) (-1436.152) [-1436.471] (-1433.836) * (-1433.369) (-1431.114) [-1434.296] (-1432.040) -- 0:00:00
992500 -- (-1432.075) (-1438.211) [-1433.578] (-1435.445) * (-1432.422) (-1434.285) [-1433.790] (-1434.986) -- 0:00:00
993000 -- (-1435.244) (-1436.396) (-1441.734) [-1436.817] * (-1433.957) (-1432.050) [-1433.358] (-1439.630) -- 0:00:00
993500 -- (-1435.378) (-1433.858) (-1439.288) [-1434.667] * [-1437.311] (-1431.717) (-1435.400) (-1431.754) -- 0:00:00
994000 -- [-1435.648] (-1433.773) (-1436.839) (-1437.029) * (-1432.732) [-1435.564] (-1438.974) (-1431.379) -- 0:00:00
994500 -- (-1433.473) [-1432.003] (-1433.706) (-1436.351) * (-1432.369) [-1433.051] (-1434.070) (-1429.317) -- 0:00:00
995000 -- [-1434.110] (-1436.703) (-1436.210) (-1435.057) * (-1435.223) (-1433.971) (-1434.972) [-1430.297] -- 0:00:00
Average standard deviation of split frequencies: 0.007951
995500 -- (-1433.572) [-1431.553] (-1435.125) (-1431.634) * (-1433.654) (-1432.902) [-1431.922] (-1432.781) -- 0:00:00
996000 -- [-1431.897] (-1433.327) (-1438.814) (-1433.776) * (-1433.700) [-1434.076] (-1434.075) (-1431.583) -- 0:00:00
996500 -- (-1432.156) (-1434.925) (-1433.762) [-1436.958] * (-1434.373) (-1431.788) [-1436.739] (-1431.376) -- 0:00:00
997000 -- (-1434.796) [-1431.495] (-1432.902) (-1432.662) * (-1432.464) [-1431.642] (-1433.462) (-1430.247) -- 0:00:00
997500 -- (-1431.438) (-1434.727) (-1438.721) [-1435.655] * [-1432.623] (-1435.612) (-1433.047) (-1434.732) -- 0:00:00
998000 -- (-1431.529) [-1434.174] (-1435.457) (-1432.652) * (-1432.637) (-1434.585) (-1434.517) [-1434.516] -- 0:00:00
998500 -- [-1434.391] (-1432.241) (-1433.391) (-1433.957) * (-1436.091) [-1430.782] (-1434.874) (-1432.939) -- 0:00:00
999000 -- (-1439.564) [-1430.945] (-1434.694) (-1433.484) * (-1437.341) (-1431.116) [-1430.747] (-1432.122) -- 0:00:00
999500 -- [-1431.900] (-1435.683) (-1435.135) (-1433.149) * [-1433.134] (-1431.467) (-1432.201) (-1436.582) -- 0:00:00
1000000 -- [-1430.655] (-1434.316) (-1433.752) (-1436.476) * (-1433.478) (-1432.686) [-1432.062] (-1440.764) -- 0:00:00
Average standard deviation of split frequencies: 0.008197
Analysis completed in 1 mins 9 seconds
Analysis used 67.25 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1428.44
Likelihood of best state for "cold" chain of run 2 was -1428.63
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 74 %) Dirichlet(Revmat{all})
98.2 % ( 99 %) Slider(Revmat{all})
25.3 % ( 26 %) Dirichlet(Pi{all})
27.4 % ( 24 %) Slider(Pi{all})
65.8 % ( 34 %) Multiplier(Alpha{1,2})
79.6 % ( 59 %) Multiplier(Alpha{3})
24.2 % ( 21 %) Slider(Pinvar{all})
97.3 % (100 %) ExtSPR(Tau{all},V{all})
69.2 % ( 69 %) ExtTBR(Tau{all},V{all})
98.3 % ( 99 %) NNI(Tau{all},V{all})
88.0 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 19 %) Multiplier(V{all})
94.8 % ( 97 %) Nodeslider(V{all})
30.1 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 59 %) Dirichlet(Revmat{all})
98.1 % ( 96 %) Slider(Revmat{all})
25.7 % ( 32 %) Dirichlet(Pi{all})
27.8 % ( 28 %) Slider(Pi{all})
65.2 % ( 30 %) Multiplier(Alpha{1,2})
79.5 % ( 57 %) Multiplier(Alpha{3})
23.6 % ( 29 %) Slider(Pinvar{all})
97.3 % ( 99 %) ExtSPR(Tau{all},V{all})
69.1 % ( 69 %) ExtTBR(Tau{all},V{all})
98.3 % (100 %) NNI(Tau{all},V{all})
88.0 % ( 89 %) ParsSPR(Tau{all},V{all})
28.3 % ( 24 %) Multiplier(V{all})
94.9 % ( 96 %) Nodeslider(V{all})
30.8 % ( 35 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166415 0.82 0.65
3 | 166365 166807 0.83
4 | 166791 166554 167068
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166562 0.82 0.66
3 | 166628 166694 0.83
4 | 166534 166977 166605
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1432.37
| 2 2 |
| 2 2 |
| 1 2 * 2 1 1 1 |
| 2 1 1 12 2 22 1 1 1 2 |
| 2 2 2 1 1 2 2 1 2 1 |
| 1 2 1* 1 1 2 1 2 1 1 1 12 1 * |
| 22* 1 22 1 1 2 * 1 2 2 2 12|
|11 1 2 1 1 *2 2 11 22 2 2 1 2 1 2 |
| 1 11 2 1 * 2 21 * 1 1|
| 2 22 1 1 2 |
| 11 1 1 |
|2 2 2 2 |
| |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1434.76
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1432.34 -1435.68
2 -1432.25 -1436.48
--------------------------------------
TOTAL -1432.30 -1436.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.866284 0.082499 0.331085 1.392859 0.831805 1329.69 1415.34 1.000
r(A<->C){all} 0.169713 0.020417 0.000006 0.451153 0.133948 178.86 193.83 1.000
r(A<->G){all} 0.215419 0.023126 0.000260 0.505806 0.189643 210.53 234.88 1.000
r(A<->T){all} 0.155445 0.018446 0.000052 0.433194 0.118116 199.77 266.41 1.000
r(C<->G){all} 0.145500 0.017366 0.000060 0.410735 0.105665 248.40 256.36 1.005
r(C<->T){all} 0.175147 0.020795 0.000009 0.464982 0.140131 158.39 225.83 1.004
r(G<->T){all} 0.138775 0.016036 0.000010 0.399652 0.102279 204.85 248.89 1.001
pi(A){all} 0.250288 0.000184 0.222434 0.275191 0.250191 1250.61 1263.93 1.000
pi(C){all} 0.303718 0.000188 0.278920 0.332112 0.303609 1285.34 1321.88 1.000
pi(G){all} 0.264745 0.000182 0.238900 0.291129 0.264827 1254.01 1284.95 1.000
pi(T){all} 0.181250 0.000135 0.158379 0.202837 0.180979 1129.64 1138.07 1.000
alpha{1,2} 0.290048 0.125408 0.000350 0.973406 0.181075 1037.08 1134.51 1.000
alpha{3} 0.418907 0.249517 0.000128 1.404647 0.230185 1124.67 1197.17 1.000
pinvar{all} 0.996727 0.000007 0.991820 0.999876 0.997402 1261.70 1312.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- ...*.*
9 -- ..*.*.
10 -- .*...*
11 -- .**...
12 -- .*..*.
13 -- ..*..*
14 -- .***.*
15 -- .*.*..
16 -- ..****
17 -- .****.
18 -- ...**.
19 -- .*.***
20 -- ..**..
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 459 0.152898 0.008009 0.147235 0.158561 2
8 449 0.149567 0.004240 0.146569 0.152565 2
9 447 0.148901 0.011777 0.140573 0.157229 2
10 442 0.147235 0.013191 0.137908 0.156562 2
11 441 0.146902 0.008009 0.141239 0.152565 2
12 441 0.146902 0.006124 0.142572 0.151233 2
13 437 0.145570 0.001413 0.144570 0.146569 2
14 436 0.145237 0.008480 0.139241 0.151233 2
15 434 0.144570 0.007537 0.139241 0.149900 2
16 433 0.144237 0.001413 0.143238 0.145237 2
17 426 0.141905 0.006595 0.137242 0.146569 2
18 413 0.137575 0.007066 0.132578 0.142572 2
19 410 0.136576 0.011306 0.128581 0.144570 2
20 406 0.135243 0.010364 0.127915 0.142572 2
21 391 0.130247 0.017430 0.117921 0.142572 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.085846 0.007685 0.000036 0.262124 0.058800 1.000 2
length{all}[2] 0.089804 0.008485 0.000049 0.270149 0.061396 1.000 2
length{all}[3] 0.090146 0.009068 0.000000 0.288413 0.060130 1.000 2
length{all}[4] 0.089783 0.008458 0.000080 0.275492 0.061051 1.000 2
length{all}[5] 0.090574 0.008825 0.000020 0.278043 0.059352 1.000 2
length{all}[6] 0.140465 0.014452 0.000381 0.372346 0.107638 1.000 2
length{all}[7] 0.096390 0.008629 0.000009 0.278450 0.070604 0.998 2
length{all}[8] 0.094214 0.008481 0.000929 0.301855 0.061154 0.998 2
length{all}[9] 0.091140 0.008482 0.000251 0.273901 0.065482 0.998 2
length{all}[10] 0.096284 0.007726 0.000506 0.253866 0.071677 0.998 2
length{all}[11] 0.087753 0.008110 0.000164 0.249926 0.058971 0.998 2
length{all}[12] 0.092366 0.008540 0.000020 0.262632 0.071879 1.010 2
length{all}[13] 0.096449 0.010007 0.000228 0.286531 0.065217 0.998 2
length{all}[14] 0.090396 0.007865 0.000025 0.281401 0.061080 1.004 2
length{all}[15] 0.090128 0.008882 0.000357 0.247237 0.064261 1.004 2
length{all}[16] 0.089915 0.008035 0.000067 0.254602 0.064408 1.000 2
length{all}[17] 0.097363 0.009634 0.000206 0.303680 0.064610 0.998 2
length{all}[18] 0.093953 0.009350 0.000352 0.267066 0.066483 0.998 2
length{all}[19] 0.092476 0.008391 0.000064 0.265492 0.062562 0.999 2
length{all}[20] 0.095342 0.010462 0.000206 0.314584 0.058531 1.002 2
length{all}[21] 0.090617 0.008846 0.000795 0.272924 0.063372 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008197
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------- C1 (1)
|
|----------------------------------------- C2 (2)
|
|---------------------------------------- C3 (3)
+
|----------------------------------------- C4 (4)
|
|---------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1035
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 345 / 345 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 345 / 345 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.066972 0.033390 0.011554 0.071867 0.021947 0.092011 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1473.256773
Iterating by ming2
Initial: fx= 1473.256773
x= 0.06697 0.03339 0.01155 0.07187 0.02195 0.09201 0.30000 1.30000
1 h-m-p 0.0000 0.0000 822.5743 ++ 1450.251704 m 0.0000 13 | 1/8
2 h-m-p 0.0000 0.0000 1956.3067 ++ 1424.954231 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0001 189.7734 ++ 1412.576987 m 0.0001 35 | 3/8
4 h-m-p 0.0002 0.0010 109.5069 ++ 1379.631342 m 0.0010 46 | 4/8
5 h-m-p 0.0000 0.0000 185.6353 ++ 1378.414048 m 0.0000 57 | 5/8
6 h-m-p 0.0001 0.0585 9.0275 ++++YCCYYC 1376.363474 5 0.0441 80 | 5/8
7 h-m-p 1.1192 8.0000 0.3555 YCYC 1376.237958 3 0.4893 95 | 5/8
8 h-m-p 0.6022 6.8531 0.2889 +YCYCCC 1375.696387 5 3.4525 118 | 5/8
9 h-m-p 1.6000 8.0000 0.4057 CYCC 1375.479722 3 1.7990 137 | 5/8
10 h-m-p 1.4940 8.0000 0.4885 +YCC 1375.108521 2 6.7657 155 | 5/8
11 h-m-p 1.6000 8.0000 0.8690 YYC 1374.996557 2 2.0310 171 | 5/8
12 h-m-p 1.4048 8.0000 1.2564 ++ 1374.826039 m 8.0000 185 | 5/8
13 h-m-p 1.6000 8.0000 1.7532 CCC 1374.770904 2 1.4529 200 | 5/8
14 h-m-p 0.9827 8.0000 2.5920 ++ 1374.693902 m 8.0000 211 | 5/8
15 h-m-p 1.6000 8.0000 7.0487 +CCC 1374.660431 2 5.9124 227 | 5/8
16 h-m-p 1.6000 8.0000 7.9070 CCC 1374.645744 2 2.4355 242 | 5/8
17 h-m-p 1.5151 8.0000 12.7102 ++ 1374.630885 m 8.0000 253 | 5/8
18 h-m-p 1.6000 8.0000 29.0248 CCC 1374.625470 2 1.7885 268 | 5/8
19 h-m-p 1.6000 8.0000 32.1001 ++ 1374.619729 m 8.0000 279 | 5/8
20 h-m-p 1.6000 8.0000 59.3230 C 1374.617328 0 1.6451 290 | 5/8
21 h-m-p 1.1633 5.8164 79.1194 ++ 1374.614844 m 5.8164 301 | 6/8
22 h-m-p 1.5396 7.6978 79.8563 +YC 1374.614470 1 4.3960 314 | 6/8
23 h-m-p 0.6036 3.0182 87.3621 +YC 1374.614286 1 1.8658 327 | 6/8
24 h-m-p 0.1803 0.9017 111.6477 ++ 1374.614240 m 0.9017 338 | 7/8
25 h-m-p 0.4515 8.0000 0.0000 Y 1374.614236 0 1.0316 349 | 7/8
26 h-m-p 1.6000 8.0000 0.0000 ----Y 1374.614236 0 0.0003 365
Out..
lnL = -1374.614236
366 lfun, 366 eigenQcodon, 2196 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.032088 0.099880 0.040097 0.104691 0.048980 0.097926 999.000000 0.812548 0.311361
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.031126
np = 9
lnL0 = -1509.550755
Iterating by ming2
Initial: fx= 1509.550755
x= 0.03209 0.09988 0.04010 0.10469 0.04898 0.09793 951.42857 0.81255 0.31136
1 h-m-p 0.0000 0.0001 769.4519 ++ 1449.594935 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 557.4127 ++ 1432.563496 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 1139.3315 ++ 1423.568653 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 1734.1836 ++ 1384.376637 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 35338.7353 ++ 1382.428689 m 0.0000 62 | 5/9
6 h-m-p 0.0001 0.0018 203.7082 ++YCYYYCYCCC 1375.186278 9 0.0016 89 | 5/9
7 h-m-p 0.4299 2.1493 0.3951 +YCCC 1375.056038 3 1.2078 107 | 5/9
8 h-m-p 0.0703 0.3514 1.1298 +YCCC 1374.952250 3 0.2169 129 | 5/9
9 h-m-p 0.0795 0.3975 0.3592 ++ 1374.932896 m 0.3975 141 | 6/9
10 h-m-p 0.1907 3.9044 0.1362 C 1374.931762 0 0.1833 157 | 6/9
11 h-m-p 1.6000 8.0000 0.0011 Y 1374.931759 0 1.1057 172 | 6/9
12 h-m-p 1.6000 8.0000 0.0001 -----C 1374.931759 0 0.0005 192
Out..
lnL = -1374.931759
193 lfun, 579 eigenQcodon, 2316 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.011585 0.106452 0.035458 0.050330 0.062047 0.056628 951.428581 1.290300 0.374217 0.417462 1185.520164
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000160
np = 11
lnL0 = -1419.108093
Iterating by ming2
Initial: fx= 1419.108093
x= 0.01159 0.10645 0.03546 0.05033 0.06205 0.05663 951.42858 1.29030 0.37422 0.41746 951.42857
1 h-m-p 0.0000 0.0002 147.8648 +++ 1415.068927 m 0.0002 17 | 1/11
2 h-m-p 0.0007 0.0212 31.7584 +++ 1393.532533 m 0.0212 32 | 2/11
3 h-m-p 0.0000 0.0000 7521.8465 ++ 1392.514706 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0002 181.0566 ++ 1390.748818 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0000 5351.3383 ++ 1389.532210 m 0.0000 74 | 5/11
6 h-m-p 0.0005 0.0024 58.1050 +CCYCYYYYCC 1374.637792 10 0.0023 103 | 5/11
7 h-m-p 0.0083 0.0413 0.3766 YC 1374.637422 1 0.0011 118 | 5/11
8 h-m-p 0.2568 8.0000 0.0017 +++ 1374.637236 m 8.0000 139 | 5/11
9 h-m-p 0.0160 8.0000 0.8746 +++YCC 1374.628726 2 1.6447 165 | 5/11
10 h-m-p 1.6000 8.0000 0.0161 C 1374.628515 0 1.3895 185 | 5/11
11 h-m-p 1.5768 8.0000 0.0142 ++ 1374.628085 m 8.0000 205 | 5/11
12 h-m-p 0.1673 8.0000 0.6787 ++YCC 1374.622887 2 4.4202 230 | 5/11
13 h-m-p 1.6000 8.0000 0.3626 CY 1374.620168 1 2.0348 252 | 5/11
14 h-m-p 1.4158 8.0000 0.5211 ++ 1374.615688 m 8.0000 272 | 5/11
15 h-m-p 1.6000 8.0000 0.6042 CC 1374.614965 1 1.3785 294 | 5/11
16 h-m-p 1.4032 8.0000 0.5936 ++ 1374.614471 m 8.0000 314 | 5/11
17 h-m-p 1.6000 8.0000 0.5647 C 1374.614417 0 1.3644 334 | 5/11
18 h-m-p 1.4586 8.0000 0.5282 ++ 1374.614378 m 8.0000 354 | 5/11
19 h-m-p 1.6000 8.0000 0.6629 C 1374.614372 0 1.4008 374 | 5/11
20 h-m-p 1.4950 8.0000 0.6211 ++ 1374.614368 m 8.0000 394 | 5/11
21 h-m-p 1.6000 8.0000 0.5669 Y 1374.614368 0 1.2048 414 | 5/11
22 h-m-p 1.0690 8.0000 0.6389 +Y 1374.614368 0 5.4566 435 | 5/11
23 h-m-p 1.6000 8.0000 0.8163 C 1374.614367 0 2.2329 455 | 5/11
24 h-m-p 1.6000 8.0000 0.5282 Y 1374.614367 0 1.0557 475 | 5/11
25 h-m-p 0.3779 8.0000 1.4755 +C 1374.614367 0 1.5118 496 | 5/11
26 h-m-p 0.0026 0.0806 871.9750 -----C 1374.614367 0 0.0000 515 | 5/11
27 h-m-p 1.6000 8.0000 0.0002 ------------N 1374.614367 0 0.0000 541 | 5/11
28 h-m-p 0.0160 8.0000 0.0002 ---------Y 1374.614367 0 0.0000 570
Out..
lnL = -1374.614367
571 lfun, 2284 eigenQcodon, 10278 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1379.552517 S = -1378.113644 -2.367429
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:04
did 30 / 56 patterns 0:04
did 40 / 56 patterns 0:04
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.038441 0.080889 0.029075 0.082376 0.070755 0.010300 951.514997 0.357133 1.049762
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.040562
np = 9
lnL0 = -1474.648850
Iterating by ming2
Initial: fx= 1474.648850
x= 0.03844 0.08089 0.02907 0.08238 0.07076 0.01030 951.51500 0.35713 1.04976
1 h-m-p 0.0000 0.0000 724.1176 +CYYYCCCCC 1453.227368 8 0.0000 29 | 0/9
2 h-m-p 0.0000 0.0000 7716.6858 ++ 1430.579954 m 0.0000 41 | 1/9
3 h-m-p 0.0000 0.0000 585.0197 ++ 1419.030233 m 0.0000 53 | 2/9
4 h-m-p 0.0000 0.0002 271.4117 ++ 1389.351202 m 0.0002 65 | 2/9
5 h-m-p 0.0000 0.0000 25.3029
h-m-p: 8.46536235e-19 4.23268117e-18 2.53028756e+01 1389.351202
.. | 2/9
6 h-m-p 0.0000 0.0000 236568.3500 CCYYCYCYC 1383.752249 8 0.0000 98 | 2/9
7 h-m-p 0.0000 0.0000 590.2995 ++ 1383.263702 m 0.0000 110 | 3/9
8 h-m-p 0.0005 0.2747 6.1057 -----------.. | 3/9
9 h-m-p 0.0000 0.0000 481.0381 ++ 1376.066463 m 0.0000 143 | 4/9
10 h-m-p 0.0000 0.0000 894.8098 ++ 1375.627887 m 0.0000 155 | 5/9
11 h-m-p 0.0047 2.3533 1.3795 ++++
QuantileBeta(0.85, 3.42554, 0.00500) = 1.000000e+00 2000 rounds
YYCC 1374.994806 3 1.5250 175 | 5/9
12 h-m-p 0.6185 3.0923 0.1234 +
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
+ 1374.936985 m 3.0923 187
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45062, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45075, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.45050, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
13 h-m-p 1.6000 8.0000 0.0293
QuantileBeta(0.85, 2.40373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.26306, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42489, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
C 1374.931762 1 0.8550 204
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42570, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42544, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42557, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
14 h-m-p 1.6000 8.0000 0.0007
QuantileBeta(0.85, 2.42661, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42973, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
Y 1374.931758 0 1.1525 219
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42645, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42619, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
15 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.42627, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42631, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
Y 1374.931758 0 0.0000 244
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1374.931758
245 lfun, 2695 eigenQcodon, 14700 P(t)
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.42632, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.109891 0.099230 0.050273 0.058641 0.010192 0.071555 951.515009 0.900000 0.498190 1.671795 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000263
np = 11
lnL0 = -1407.889323
Iterating by ming2
Initial: fx= 1407.889323
x= 0.10989 0.09923 0.05027 0.05864 0.01019 0.07155 951.51501 0.90000 0.49819 1.67179 951.42857
1 h-m-p 0.0000 0.0003 255.7848 +++ 1385.870449 m 0.0003 17 | 1/11
2 h-m-p 0.0000 0.0001 336.1658 CYCYCC 1384.772906 5 0.0000 40 | 1/11
3 h-m-p 0.0006 0.0140 15.8965 +++ 1382.115618 m 0.0140 55 | 2/11
4 h-m-p 0.0000 0.0001 79.2379 ++ 1382.041424 m 0.0001 69 | 3/11
5 h-m-p 0.0000 0.0012 208.2136 ++CYYC 1381.387396 3 0.0008 90 | 3/11
6 h-m-p 0.0020 0.0098 4.1599 ++ 1380.691653 m 0.0098 104 | 4/11
7 h-m-p 0.0038 0.0188 4.7653 ++ 1377.145324 m 0.0188 118 | 5/11
8 h-m-p 0.0066 0.1441 3.5158 +++ 1376.099779 m 0.1441 133 | 5/11
9 h-m-p 0.0000 0.0000 0.5432
h-m-p: 1.66755655e-18 8.33778273e-18 5.43155264e-01 1376.099779
.. | 5/11
10 h-m-p 0.0000 0.0011 38.3068 +YYCC 1376.061157 3 0.0001 169 | 5/11
11 h-m-p 0.0000 0.0006 48.1594 +YCYYYCYYCC 1374.903990 10 0.0005 198 | 5/11
12 h-m-p 0.0003 0.0016 0.0039 ++ 1374.903915 m 0.0016 212 | 5/11
13 h-m-p -0.0000 -0.0000 0.0049
h-m-p: -0.00000000e+00 -0.00000000e+00 4.94050430e-03 1374.903915
.. | 5/11
14 h-m-p 0.0001 0.0280 35.4408 +++CYYC 1374.643024 3 0.0026 256 | 5/11
15 h-m-p 0.0000 0.0001 58.6714 YCC 1374.634346 2 0.0000 273 | 5/11
16 h-m-p 0.2353 1.1764 0.0006 ++ 1374.634195 m 1.1764 287 | 5/11
17 h-m-p -0.0000 -0.0000 0.0527
h-m-p: -0.00000000e+00 -0.00000000e+00 5.27287658e-02 1374.634195
.. | 5/11
18 h-m-p 0.0083 4.1302 0.4219 ----C 1374.634195 0 0.0000 328 | 5/11
19 h-m-p 0.0061 3.0378 0.2953 ++++YC 1374.616243 1 2.2391 353 | 5/11
20 h-m-p 1.6000 8.0000 0.0115 YC 1374.615022 1 0.9378 374 | 5/11
21 h-m-p 0.9173 8.0000 0.0117 ++ 1374.614710 m 8.0000 394 | 5/11
22 h-m-p 0.0746 0.3731 0.3521 ++ 1374.614370 m 0.3731 414 | 6/11
23 h-m-p 0.0382 0.3339 0.0008 ++ 1374.614368 m 0.3339 434 | 6/11
24 h-m-p -0.0000 -0.0000 0.0001
h-m-p: -0.00000000e+00 -0.00000000e+00 5.05192670e-05 1374.614368
.. | 6/11
25 h-m-p 0.0160 8.0000 0.1384 -----C 1374.614367 0 0.0000 474 | 6/11
26 h-m-p 0.3291 8.0000 0.0000 --C 1374.614367 0 0.0051 495 | 6/11
27 h-m-p 0.0160 8.0000 0.0000 -----------Y 1374.614367 0 0.0000 525
Out..
lnL = -1374.614367
526 lfun, 6312 eigenQcodon, 34716 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1379.291467 S = -1378.113687 -1.981244
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:17
did 20 / 56 patterns 0:17
did 30 / 56 patterns 0:17
did 40 / 56 patterns 0:17
did 50 / 56 patterns 0:18
did 56 / 56 patterns 0:18
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.02 sec, SCORE=100, Nseq=6, Len=345
NC_011896_1_WP_010907710_1_409_MLBR_RS01960 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
NC_002677_1_NP_301386_1_258_ML0398 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF
**************************************************
NC_011896_1_WP_010907710_1_409_MLBR_RS01960 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
NC_002677_1_NP_301386_1_258_ML0398 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP
**************************************************
NC_011896_1_WP_010907710_1_409_MLBR_RS01960 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
NC_002677_1_NP_301386_1_258_ML0398 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA
**************************************************
NC_011896_1_WP_010907710_1_409_MLBR_RS01960 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
NC_002677_1_NP_301386_1_258_ML0398 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 GSGIAEALMAGGGSKFLALGSMPGNSVAQGRKAGLESALTAVGHRLVQFQ
********************.*****************************
NC_011896_1_WP_010907710_1_409_MLBR_RS01960 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
NC_002677_1_NP_301386_1_258_ML0398 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK
**************************************************
NC_011896_1_WP_010907710_1_409_MLBR_RS01960 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
NC_002677_1_NP_301386_1_258_ML0398 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA
**************************************************
NC_011896_1_WP_010907710_1_409_MLBR_RS01960 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
NC_002677_1_NP_301386_1_258_ML0398 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
*********************************************
>NC_011896_1_WP_010907710_1_409_MLBR_RS01960 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT CCACAACCCCGTTCGATATGACGATCACCTTGAAC >NC_002677_1_NP_301386_1_258_ML0398 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT CCACAACCCCGTTCGATATGACGATCACCTTGAAC >NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT CCACAACCCCGTTCGATATGACGATCACCTTGAAC >NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT CCACAACCCCGTTCGATATGACGATCACCTTGAAC >NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT TGCCCTCGGTGGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT CCACAACCCCGTTCGATATGACGATCACCTTGAAC >NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 ATGAGCACAGGAACGAGTGTACCACTGCGCGTGGCTAGCATTATGCTGAT CCTGGGACTGCTACCAGCAATCCTGCCGGCGTGTGGTTTCTCAGAGTCAC ATCACAAGCTGACCATCGGCGTGTCCTATCCTACCGCGAACAGTCCGTTC TGGAATGCCTACACACGCTTTATCGACGAGGGAAGCCACCAACTCGGTGT CTATATCAATGCCGTGTCGGCTGAAGAAGACGAACAAAAACAACTGTCCG ACGTTGAGACCCTCATCAACCAAGGCATCGACGGGCTTATCGTCACCCCC CAGTCAACATCGATCGCTCCCACGCTGCTGCGGATAGCCACCCAGGCAAA CATCCCGGTGGTCGTAGTCGACCGCTACCCAGGATATGCCCCGGGGCAGA ACAAAAACGCTGATTATGTGGCCTTCCTGGGACCCAATAATGAGAAAGCC GGAAGCGGCATTGCTGAAGCACTCATGGCTGGCGGCGGGTCGAAATTCCT TGCCCTCGGTAGCATGCCCGGCAACTCGGTGGCCCAGGGCCGCAAGGCTG GCCTGGAATCAGCGCTCACGGCAGTCGGTCACCGGCTTGTGCAGTTTCAG TACGCCGGTGACAGCGAAGACAAAGGCCTTGCCGCCGCCGAGAACATGCT GCAAGCACACCCCGCCGGCGACGCCAACGCCATCTGGTGCTTCAACGACA AACTCTGCCAGGGCGCAATCAAAGCAGTATACAACGCCAATCGTGAAAAG GAATTCATCTTTGGAGGAATGGATTTGACACCGCAAGCAATCGCAGCGAT CGAAAACGGATTGTACACCGTCAGCTTGGGCGCCCATTGGCTAGAGGGCG GGTTCGGGCTGGCAATCCTCTATCGCAAAATCCACGGCCAAGATCCTGCT GAGCGGATGGTGAAGCTCGACCTGCTCAAGGTTGACAAATCCAACGTCGC CAAGTTCAAGGCCCGCTACATCGACAACACGCCACACTACAACTGGAAGT CCACAACCCCGTTCGATATGACGATCACCTTGAAC
>NC_011896_1_WP_010907710_1_409_MLBR_RS01960 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN >NC_002677_1_NP_301386_1_258_ML0398 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN >NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN >NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN >NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA GSGIAEALMAGGGSKFLALGGMPGNSVAQGRKAGLESALTAVGHRLVQFQ YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN >NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200 MSTGTSVPLRVASIMLILGLLPAILPACGFSESHHKLTIGVSYPTANSPF WNAYTRFIDEGSHQLGVYINAVSAEEDEQKQLSDVETLINQGIDGLIVTP QSTSIAPTLLRIATQANIPVVVVDRYPGYAPGQNKNADYVAFLGPNNEKA GSGIAEALMAGGGSKFLALGSMPGNSVAQGRKAGLESALTAVGHRLVQFQ YAGDSEDKGLAAAENMLQAHPAGDANAIWCFNDKLCQGAIKAVYNANREK EFIFGGMDLTPQAIAAIENGLYTVSLGAHWLEGGFGLAILYRKIHGQDPA ERMVKLDLLKVDKSNVAKFKARYIDNTPHYNWKSTTPFDMTITLN
#NEXUS
[ID: 1678619041]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907710_1_409_MLBR_RS01960
NC_002677_1_NP_301386_1_258_ML0398
NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795
NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655
NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110
NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907710_1_409_MLBR_RS01960,
2 NC_002677_1_NP_301386_1_258_ML0398,
3 NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795,
4 NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655,
5 NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110,
6 NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05880015,2:0.0613958,3:0.06012991,4:0.0610505,5:0.05935243,6:0.1076383);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05880015,2:0.0613958,3:0.06012991,4:0.0610505,5:0.05935243,6:0.1076383);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1432.34 -1435.68
2 -1432.25 -1436.48
--------------------------------------
TOTAL -1432.30 -1436.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0398/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.866284 0.082499 0.331085 1.392859 0.831805 1329.69 1415.34 1.000
r(A<->C){all} 0.169713 0.020417 0.000006 0.451153 0.133948 178.86 193.83 1.000
r(A<->G){all} 0.215419 0.023126 0.000260 0.505806 0.189643 210.53 234.88 1.000
r(A<->T){all} 0.155445 0.018446 0.000052 0.433194 0.118116 199.77 266.41 1.000
r(C<->G){all} 0.145500 0.017366 0.000060 0.410735 0.105665 248.40 256.36 1.005
r(C<->T){all} 0.175147 0.020795 0.000009 0.464982 0.140131 158.39 225.83 1.004
r(G<->T){all} 0.138775 0.016036 0.000010 0.399652 0.102279 204.85 248.89 1.001
pi(A){all} 0.250288 0.000184 0.222434 0.275191 0.250191 1250.61 1263.93 1.000
pi(C){all} 0.303718 0.000188 0.278920 0.332112 0.303609 1285.34 1321.88 1.000
pi(G){all} 0.264745 0.000182 0.238900 0.291129 0.264827 1254.01 1284.95 1.000
pi(T){all} 0.181250 0.000135 0.158379 0.202837 0.180979 1129.64 1138.07 1.000
alpha{1,2} 0.290048 0.125408 0.000350 0.973406 0.181075 1037.08 1134.51 1.000
alpha{3} 0.418907 0.249517 0.000128 1.404647 0.230185 1124.67 1197.17 1.000
pinvar{all} 0.996727 0.000007 0.991820 0.999876 0.997402 1261.70 1312.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0398/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 345
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 1 1 1 1 1 1
TTC 9 9 9 9 9 9 | TCC 4 4 4 4 4 4 | TAC 7 7 7 7 7 7 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 9 9 9 9 9 9 | CCC 5 5 5 5 5 5 | CAC 6 6 6 6 6 6 | CGC 6 6 6 6 6 6
CTA 2 2 2 2 2 2 | CCA 4 4 4 4 4 4 | Gln CAA 7 7 7 7 7 7 | CGA 0 0 0 0 0 0
CTG 14 14 14 14 14 14 | CCG 6 6 6 6 6 6 | CAG 7 7 7 7 7 7 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 5 5 5 5 5 5 | Ser AGT 2 2 2 2 2 2
ATC 19 19 19 19 19 19 | ACC 8 8 8 8 8 8 | AAC 15 15 15 15 15 15 | AGC 6 6 6 6 6 7
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 5 5 | Lys AAA 9 9 9 9 9 9 | Arg AGA 0 0 0 0 0 0
Met ATG 8 8 8 8 8 8 | ACG 5 5 5 5 5 5 | AAG 8 8 8 8 8 8 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 8 8 8 8 8 8 | Asp GAT 4 4 4 4 4 4 | Gly GGT 5 5 5 5 5 5
GTC 7 7 7 7 7 7 | GCC 19 19 19 19 19 19 | GAC 12 12 12 12 12 12 | GGC 15 15 15 15 15 14
GTA 3 3 3 3 3 3 | GCA 10 10 10 10 10 10 | Glu GAA 9 9 9 9 9 9 | GGA 9 9 9 9 9 9
GTG 8 8 8 8 8 8 | GCG 4 4 4 4 4 4 | GAG 7 7 7 7 7 7 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907710_1_409_MLBR_RS01960
position 1: T:0.13623 C:0.22609 A:0.26957 G:0.36812
position 2: T:0.27536 C:0.25507 A:0.29855 G:0.17101
position 3: T:0.13333 C:0.43188 A:0.18261 G:0.25217
Average T:0.18164 C:0.30435 A:0.25024 G:0.26377
#2: NC_002677_1_NP_301386_1_258_ML0398
position 1: T:0.13623 C:0.22609 A:0.26957 G:0.36812
position 2: T:0.27536 C:0.25507 A:0.29855 G:0.17101
position 3: T:0.13333 C:0.43188 A:0.18261 G:0.25217
Average T:0.18164 C:0.30435 A:0.25024 G:0.26377
#3: NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795
position 1: T:0.13623 C:0.22609 A:0.26957 G:0.36812
position 2: T:0.27536 C:0.25507 A:0.29855 G:0.17101
position 3: T:0.13333 C:0.43188 A:0.18261 G:0.25217
Average T:0.18164 C:0.30435 A:0.25024 G:0.26377
#4: NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655
position 1: T:0.13623 C:0.22609 A:0.26957 G:0.36812
position 2: T:0.27536 C:0.25507 A:0.29855 G:0.17101
position 3: T:0.13333 C:0.43188 A:0.18261 G:0.25217
Average T:0.18164 C:0.30435 A:0.25024 G:0.26377
#5: NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110
position 1: T:0.13623 C:0.22609 A:0.26957 G:0.36812
position 2: T:0.27536 C:0.25507 A:0.29855 G:0.17101
position 3: T:0.13333 C:0.43188 A:0.18261 G:0.25217
Average T:0.18164 C:0.30435 A:0.25024 G:0.26377
#6: NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200
position 1: T:0.13623 C:0.22609 A:0.27246 G:0.36522
position 2: T:0.27536 C:0.25507 A:0.29855 G:0.17101
position 3: T:0.13333 C:0.43188 A:0.18261 G:0.25217
Average T:0.18164 C:0.30435 A:0.25121 G:0.26280
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 30 | Cys C TGT 6
TTC 54 | TCC 24 | TAC 42 | TGC 12
Leu L TTA 0 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 6
CTC 54 | CCC 30 | CAC 36 | CGC 36
CTA 12 | CCA 24 | Gln Q CAA 42 | CGA 0
CTG 84 | CCG 36 | CAG 42 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 30 | Ser S AGT 12
ATC 114 | ACC 48 | AAC 90 | AGC 37
ATA 6 | ACA 30 | Lys K AAA 54 | Arg R AGA 0
Met M ATG 48 | ACG 30 | AAG 48 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 48 | Asp D GAT 24 | Gly G GGT 30
GTC 42 | GCC 114 | GAC 72 | GGC 89
GTA 18 | GCA 60 | Glu E GAA 54 | GGA 54
GTG 48 | GCG 24 | GAG 42 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13623 C:0.22609 A:0.27005 G:0.36763
position 2: T:0.27536 C:0.25507 A:0.29855 G:0.17101
position 3: T:0.13333 C:0.43188 A:0.18261 G:0.25217
Average T:0.18164 C:0.30435 A:0.25040 G:0.26361
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -1374.614236 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002941 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002961
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002941);
(NC_011896_1_WP_010907710_1_409_MLBR_RS01960: 0.000004, NC_002677_1_NP_301386_1_258_ML0398: 0.000004, NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795: 0.000004, NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655: 0.000004, NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110: 0.000004, NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200: 0.002941);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.0 278.0 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 757.0 278.0 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 757.0 278.0 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 757.0 278.0 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 757.0 278.0 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.003 757.0 278.0 999.0000 0.0013 0.0000 1.0 0.0
tree length for dN: 0.0013
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1374.931759 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002926 951.428581 0.000010 0.508031
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002946
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002926);
(NC_011896_1_WP_010907710_1_409_MLBR_RS01960: 0.000004, NC_002677_1_NP_301386_1_258_ML0398: 0.000004, NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795: 0.000004, NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655: 0.000004, NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110: 0.000004, NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200: 0.002926);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.50803 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.003 757.0 278.0 1.0000 0.0010 0.0010 0.7 0.3
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1374.614367 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002942 951.514997 0.000000 0.000004 0.241884 951.581744
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002962
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002942);
(NC_011896_1_WP_010907710_1_409_MLBR_RS01960: 0.000004, NC_002677_1_NP_301386_1_258_ML0398: 0.000004, NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795: 0.000004, NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655: 0.000004, NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110: 0.000004, NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200: 0.002942);
Detailed output identifying parameters
kappa (ts/tv) = 951.51500
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.24188 1.00000 951.58174
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.0 278.0 951.5777 0.0000 0.0000 0.0 0.0
7..2 0.000 757.0 278.0 951.5777 0.0000 0.0000 0.0 0.0
7..3 0.000 757.0 278.0 951.5777 0.0000 0.0000 0.0 0.0
7..4 0.000 757.0 278.0 951.5777 0.0000 0.0000 0.0 0.0
7..5 0.000 757.0 278.0 951.5777 0.0000 0.0000 0.0 0.0
7..6 0.003 757.0 278.0 951.5777 0.0013 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907710_1_409_MLBR_RS01960)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.578
2 S 1.000** 951.578
3 T 1.000** 951.578
4 G 1.000** 951.578
5 T 1.000** 951.578
6 S 1.000** 951.578
7 V 1.000** 951.578
8 P 1.000** 951.578
9 L 1.000** 951.578
10 R 1.000** 951.578
11 V 1.000** 951.578
12 A 1.000** 951.578
13 S 1.000** 951.578
14 I 1.000** 951.578
15 M 1.000** 951.578
16 L 1.000** 951.578
17 I 1.000** 951.578
18 L 1.000** 951.578
19 G 1.000** 951.578
20 L 1.000** 951.578
21 L 1.000** 951.578
22 P 1.000** 951.578
23 A 1.000** 951.578
24 I 1.000** 951.578
25 L 1.000** 951.578
26 P 1.000** 951.578
27 A 1.000** 951.578
28 C 1.000** 951.578
29 G 1.000** 951.578
30 F 1.000** 951.578
31 S 1.000** 951.578
32 E 1.000** 951.578
33 S 1.000** 951.578
34 H 1.000** 951.578
35 H 1.000** 951.578
36 K 1.000** 951.578
37 L 1.000** 951.578
38 T 1.000** 951.578
39 I 1.000** 951.578
40 G 1.000** 951.578
41 V 1.000** 951.578
42 S 1.000** 951.578
43 Y 1.000** 951.578
44 P 1.000** 951.578
45 T 1.000** 951.578
46 A 1.000** 951.578
47 N 1.000** 951.578
48 S 1.000** 951.578
49 P 1.000** 951.578
50 F 1.000** 951.578
51 W 1.000** 951.578
52 N 1.000** 951.578
53 A 1.000** 951.578
54 Y 1.000** 951.578
55 T 1.000** 951.578
56 R 1.000** 951.578
57 F 1.000** 951.578
58 I 1.000** 951.578
59 D 1.000** 951.578
60 E 1.000** 951.578
61 G 1.000** 951.578
62 S 1.000** 951.578
63 H 1.000** 951.578
64 Q 1.000** 951.578
65 L 1.000** 951.578
66 G 1.000** 951.578
67 V 1.000** 951.578
68 Y 1.000** 951.578
69 I 1.000** 951.578
70 N 1.000** 951.578
71 A 1.000** 951.578
72 V 1.000** 951.578
73 S 1.000** 951.578
74 A 1.000** 951.578
75 E 1.000** 951.578
76 E 1.000** 951.578
77 D 1.000** 951.578
78 E 1.000** 951.578
79 Q 1.000** 951.578
80 K 1.000** 951.578
81 Q 1.000** 951.578
82 L 1.000** 951.578
83 S 1.000** 951.578
84 D 1.000** 951.578
85 V 1.000** 951.578
86 E 1.000** 951.578
87 T 1.000** 951.578
88 L 1.000** 951.578
89 I 1.000** 951.578
90 N 1.000** 951.578
91 Q 1.000** 951.578
92 G 1.000** 951.578
93 I 1.000** 951.578
94 D 1.000** 951.578
95 G 1.000** 951.578
96 L 1.000** 951.578
97 I 1.000** 951.578
98 V 1.000** 951.578
99 T 1.000** 951.578
100 P 1.000** 951.578
101 Q 1.000** 951.578
102 S 1.000** 951.578
103 T 1.000** 951.578
104 S 1.000** 951.578
105 I 1.000** 951.578
106 A 1.000** 951.578
107 P 1.000** 951.578
108 T 1.000** 951.578
109 L 1.000** 951.578
110 L 1.000** 951.578
111 R 1.000** 951.578
112 I 1.000** 951.578
113 A 1.000** 951.578
114 T 1.000** 951.578
115 Q 1.000** 951.578
116 A 1.000** 951.578
117 N 1.000** 951.578
118 I 1.000** 951.578
119 P 1.000** 951.578
120 V 1.000** 951.578
121 V 1.000** 951.578
122 V 1.000** 951.578
123 V 1.000** 951.578
124 D 1.000** 951.578
125 R 1.000** 951.578
126 Y 1.000** 951.578
127 P 1.000** 951.578
128 G 1.000** 951.578
129 Y 1.000** 951.578
130 A 1.000** 951.578
131 P 1.000** 951.578
132 G 1.000** 951.578
133 Q 1.000** 951.578
134 N 1.000** 951.578
135 K 1.000** 951.578
136 N 1.000** 951.578
137 A 1.000** 951.578
138 D 1.000** 951.578
139 Y 1.000** 951.578
140 V 1.000** 951.578
141 A 1.000** 951.578
142 F 1.000** 951.578
143 L 1.000** 951.578
144 G 1.000** 951.578
145 P 1.000** 951.578
146 N 1.000** 951.578
147 N 1.000** 951.578
148 E 1.000** 951.578
149 K 1.000** 951.578
150 A 1.000** 951.578
151 G 1.000** 951.578
152 S 1.000** 951.578
153 G 1.000** 951.578
154 I 1.000** 951.578
155 A 1.000** 951.578
156 E 1.000** 951.578
157 A 1.000** 951.578
158 L 1.000** 951.578
159 M 1.000** 951.578
160 A 1.000** 951.578
161 G 1.000** 951.578
162 G 1.000** 951.578
163 G 1.000** 951.578
164 S 1.000** 951.578
165 K 1.000** 951.578
166 F 1.000** 951.578
167 L 1.000** 951.578
168 A 1.000** 951.578
169 L 1.000** 951.578
170 G 1.000** 951.578
171 G 1.000** 951.582
172 M 1.000** 951.578
173 P 1.000** 951.578
174 G 1.000** 951.578
175 N 1.000** 951.578
176 S 1.000** 951.578
177 V 1.000** 951.578
178 A 1.000** 951.578
179 Q 1.000** 951.578
180 G 1.000** 951.578
181 R 1.000** 951.578
182 K 1.000** 951.578
183 A 1.000** 951.578
184 G 1.000** 951.578
185 L 1.000** 951.578
186 E 1.000** 951.578
187 S 1.000** 951.578
188 A 1.000** 951.578
189 L 1.000** 951.578
190 T 1.000** 951.578
191 A 1.000** 951.578
192 V 1.000** 951.578
193 G 1.000** 951.578
194 H 1.000** 951.578
195 R 1.000** 951.578
196 L 1.000** 951.578
197 V 1.000** 951.578
198 Q 1.000** 951.578
199 F 1.000** 951.578
200 Q 1.000** 951.578
201 Y 1.000** 951.578
202 A 1.000** 951.578
203 G 1.000** 951.578
204 D 1.000** 951.578
205 S 1.000** 951.578
206 E 1.000** 951.578
207 D 1.000** 951.578
208 K 1.000** 951.578
209 G 1.000** 951.578
210 L 1.000** 951.578
211 A 1.000** 951.578
212 A 1.000** 951.578
213 A 1.000** 951.578
214 E 1.000** 951.578
215 N 1.000** 951.578
216 M 1.000** 951.578
217 L 1.000** 951.578
218 Q 1.000** 951.578
219 A 1.000** 951.578
220 H 1.000** 951.578
221 P 1.000** 951.578
222 A 1.000** 951.578
223 G 1.000** 951.578
224 D 1.000** 951.578
225 A 1.000** 951.578
226 N 1.000** 951.578
227 A 1.000** 951.578
228 I 1.000** 951.578
229 W 1.000** 951.578
230 C 1.000** 951.578
231 F 1.000** 951.578
232 N 1.000** 951.578
233 D 1.000** 951.578
234 K 1.000** 951.578
235 L 1.000** 951.578
236 C 1.000** 951.578
237 Q 1.000** 951.578
238 G 1.000** 951.578
239 A 1.000** 951.578
240 I 1.000** 951.578
241 K 1.000** 951.578
242 A 1.000** 951.578
243 V 1.000** 951.578
244 Y 1.000** 951.578
245 N 1.000** 951.578
246 A 1.000** 951.578
247 N 1.000** 951.578
248 R 1.000** 951.578
249 E 1.000** 951.578
250 K 1.000** 951.578
251 E 1.000** 951.578
252 F 1.000** 951.578
253 I 1.000** 951.578
254 F 1.000** 951.578
255 G 1.000** 951.578
256 G 1.000** 951.578
257 M 1.000** 951.578
258 D 1.000** 951.578
259 L 1.000** 951.578
260 T 1.000** 951.578
261 P 1.000** 951.578
262 Q 1.000** 951.578
263 A 1.000** 951.578
264 I 1.000** 951.578
265 A 1.000** 951.578
266 A 1.000** 951.578
267 I 1.000** 951.578
268 E 1.000** 951.578
269 N 1.000** 951.578
270 G 1.000** 951.578
271 L 1.000** 951.578
272 Y 1.000** 951.578
273 T 1.000** 951.578
274 V 1.000** 951.578
275 S 1.000** 951.578
276 L 1.000** 951.578
277 G 1.000** 951.578
278 A 1.000** 951.578
279 H 1.000** 951.578
280 W 1.000** 951.578
281 L 1.000** 951.578
282 E 1.000** 951.578
283 G 1.000** 951.578
284 G 1.000** 951.578
285 F 1.000** 951.578
286 G 1.000** 951.578
287 L 1.000** 951.578
288 A 1.000** 951.578
289 I 1.000** 951.578
290 L 1.000** 951.578
291 Y 1.000** 951.578
292 R 1.000** 951.578
293 K 1.000** 951.578
294 I 1.000** 951.578
295 H 1.000** 951.578
296 G 1.000** 951.578
297 Q 1.000** 951.578
298 D 1.000** 951.578
299 P 1.000** 951.578
300 A 1.000** 951.578
301 E 1.000** 951.578
302 R 1.000** 951.578
303 M 1.000** 951.578
304 V 1.000** 951.578
305 K 1.000** 951.578
306 L 1.000** 951.578
307 D 1.000** 951.578
308 L 1.000** 951.578
309 L 1.000** 951.578
310 K 1.000** 951.578
311 V 1.000** 951.578
312 D 1.000** 951.578
313 K 1.000** 951.578
314 S 1.000** 951.578
315 N 1.000** 951.578
316 V 1.000** 951.578
317 A 1.000** 951.578
318 K 1.000** 951.578
319 F 1.000** 951.578
320 K 1.000** 951.578
321 A 1.000** 951.578
322 R 1.000** 951.578
323 Y 1.000** 951.578
324 I 1.000** 951.578
325 D 1.000** 951.578
326 N 1.000** 951.578
327 T 1.000** 951.578
328 P 1.000** 951.578
329 H 1.000** 951.578
330 Y 1.000** 951.578
331 N 1.000** 951.578
332 W 1.000** 951.578
333 K 1.000** 951.578
334 S 1.000** 951.578
335 T 1.000** 951.578
336 T 1.000** 951.578
337 P 1.000** 951.578
338 F 1.000** 951.578
339 D 1.000** 951.578
340 M 1.000** 951.578
341 T 1.000** 951.578
342 I 1.000** 951.578
343 T 1.000** 951.578
344 L 1.000** 951.578
345 N 1.000** 951.578
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907710_1_409_MLBR_RS01960)
Pr(w>1) post mean +- SE for w
171 G 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1374.931758 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002926 951.515009 2.426318 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002946
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002926);
(NC_011896_1_WP_010907710_1_409_MLBR_RS01960: 0.000004, NC_002677_1_NP_301386_1_258_ML0398: 0.000004, NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795: 0.000004, NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655: 0.000004, NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110: 0.000004, NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200: 0.002926);
Detailed output identifying parameters
kappa (ts/tv) = 951.51501
Parameters in M7 (beta):
p = 2.42632 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 757.0 278.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.003 757.0 278.0 1.0000 0.0010 0.0010 0.7 0.3
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1374.614367 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002941 951.514837 0.000010 0.005000 1.816206 951.429351
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002961
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002941);
(NC_011896_1_WP_010907710_1_409_MLBR_RS01960: 0.000004, NC_002677_1_NP_301386_1_258_ML0398: 0.000004, NZ_LVXE01000036_1_WP_010907710_1_1593_A3216_RS09795: 0.000004, NZ_LYPH01000040_1_WP_010907710_1_1602_A8144_RS07655: 0.000004, NZ_CP029543_1_WP_010907710_1_412_DIJ64_RS02110: 0.000004, NZ_AP014567_1_WP_119607888_1_430_JK2ML_RS02200: 0.002941);
Detailed output identifying parameters
kappa (ts/tv) = 951.51484
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.81621
(p1 = 0.99999) w = 951.42935
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 951.42935
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.0 278.0 951.4198 0.0000 0.0000 0.0 0.0
7..2 0.000 757.0 278.0 951.4198 0.0000 0.0000 0.0 0.0
7..3 0.000 757.0 278.0 951.4198 0.0000 0.0000 0.0 0.0
7..4 0.000 757.0 278.0 951.4198 0.0000 0.0000 0.0 0.0
7..5 0.000 757.0 278.0 951.4198 0.0000 0.0000 0.0 0.0
7..6 0.003 757.0 278.0 951.4198 0.0013 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907710_1_409_MLBR_RS01960)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.420
2 S 1.000** 951.420
3 T 1.000** 951.420
4 G 1.000** 951.420
5 T 1.000** 951.420
6 S 1.000** 951.420
7 V 1.000** 951.420
8 P 1.000** 951.420
9 L 1.000** 951.420
10 R 1.000** 951.420
11 V 1.000** 951.420
12 A 1.000** 951.420
13 S 1.000** 951.420
14 I 1.000** 951.420
15 M 1.000** 951.420
16 L 1.000** 951.420
17 I 1.000** 951.420
18 L 1.000** 951.420
19 G 1.000** 951.420
20 L 1.000** 951.420
21 L 1.000** 951.420
22 P 1.000** 951.420
23 A 1.000** 951.420
24 I 1.000** 951.420
25 L 1.000** 951.420
26 P 1.000** 951.420
27 A 1.000** 951.420
28 C 1.000** 951.420
29 G 1.000** 951.420
30 F 1.000** 951.420
31 S 1.000** 951.420
32 E 1.000** 951.420
33 S 1.000** 951.420
34 H 1.000** 951.420
35 H 1.000** 951.420
36 K 1.000** 951.420
37 L 1.000** 951.420
38 T 1.000** 951.420
39 I 1.000** 951.420
40 G 1.000** 951.420
41 V 1.000** 951.420
42 S 1.000** 951.420
43 Y 1.000** 951.420
44 P 1.000** 951.420
45 T 1.000** 951.420
46 A 1.000** 951.420
47 N 1.000** 951.420
48 S 1.000** 951.420
49 P 1.000** 951.420
50 F 1.000** 951.420
51 W 1.000** 951.420
52 N 1.000** 951.420
53 A 1.000** 951.420
54 Y 1.000** 951.420
55 T 1.000** 951.420
56 R 1.000** 951.420
57 F 1.000** 951.420
58 I 1.000** 951.420
59 D 1.000** 951.420
60 E 1.000** 951.420
61 G 1.000** 951.420
62 S 1.000** 951.420
63 H 1.000** 951.420
64 Q 1.000** 951.420
65 L 1.000** 951.420
66 G 1.000** 951.420
67 V 1.000** 951.420
68 Y 1.000** 951.420
69 I 1.000** 951.420
70 N 1.000** 951.420
71 A 1.000** 951.420
72 V 1.000** 951.420
73 S 1.000** 951.420
74 A 1.000** 951.420
75 E 1.000** 951.420
76 E 1.000** 951.420
77 D 1.000** 951.420
78 E 1.000** 951.420
79 Q 1.000** 951.420
80 K 1.000** 951.420
81 Q 1.000** 951.420
82 L 1.000** 951.420
83 S 1.000** 951.420
84 D 1.000** 951.420
85 V 1.000** 951.420
86 E 1.000** 951.420
87 T 1.000** 951.420
88 L 1.000** 951.420
89 I 1.000** 951.420
90 N 1.000** 951.420
91 Q 1.000** 951.420
92 G 1.000** 951.420
93 I 1.000** 951.420
94 D 1.000** 951.420
95 G 1.000** 951.420
96 L 1.000** 951.420
97 I 1.000** 951.420
98 V 1.000** 951.420
99 T 1.000** 951.420
100 P 1.000** 951.420
101 Q 1.000** 951.420
102 S 1.000** 951.420
103 T 1.000** 951.420
104 S 1.000** 951.420
105 I 1.000** 951.420
106 A 1.000** 951.420
107 P 1.000** 951.420
108 T 1.000** 951.420
109 L 1.000** 951.420
110 L 1.000** 951.420
111 R 1.000** 951.420
112 I 1.000** 951.420
113 A 1.000** 951.420
114 T 1.000** 951.420
115 Q 1.000** 951.420
116 A 1.000** 951.420
117 N 1.000** 951.420
118 I 1.000** 951.420
119 P 1.000** 951.420
120 V 1.000** 951.420
121 V 1.000** 951.420
122 V 1.000** 951.420
123 V 1.000** 951.420
124 D 1.000** 951.420
125 R 1.000** 951.420
126 Y 1.000** 951.420
127 P 1.000** 951.420
128 G 1.000** 951.420
129 Y 1.000** 951.420
130 A 1.000** 951.420
131 P 1.000** 951.420
132 G 1.000** 951.420
133 Q 1.000** 951.420
134 N 1.000** 951.420
135 K 1.000** 951.420
136 N 1.000** 951.420
137 A 1.000** 951.420
138 D 1.000** 951.420
139 Y 1.000** 951.420
140 V 1.000** 951.420
141 A 1.000** 951.420
142 F 1.000** 951.420
143 L 1.000** 951.420
144 G 1.000** 951.420
145 P 1.000** 951.420
146 N 1.000** 951.420
147 N 1.000** 951.420
148 E 1.000** 951.420
149 K 1.000** 951.420
150 A 1.000** 951.420
151 G 1.000** 951.420
152 S 1.000** 951.420
153 G 1.000** 951.420
154 I 1.000** 951.420
155 A 1.000** 951.420
156 E 1.000** 951.420
157 A 1.000** 951.420
158 L 1.000** 951.420
159 M 1.000** 951.420
160 A 1.000** 951.420
161 G 1.000** 951.420
162 G 1.000** 951.420
163 G 1.000** 951.420
164 S 1.000** 951.420
165 K 1.000** 951.420
166 F 1.000** 951.420
167 L 1.000** 951.420
168 A 1.000** 951.420
169 L 1.000** 951.420
170 G 1.000** 951.420
171 G 1.000** 951.429
172 M 1.000** 951.420
173 P 1.000** 951.420
174 G 1.000** 951.420
175 N 1.000** 951.420
176 S 1.000** 951.420
177 V 1.000** 951.420
178 A 1.000** 951.420
179 Q 1.000** 951.420
180 G 1.000** 951.420
181 R 1.000** 951.420
182 K 1.000** 951.420
183 A 1.000** 951.420
184 G 1.000** 951.420
185 L 1.000** 951.420
186 E 1.000** 951.420
187 S 1.000** 951.420
188 A 1.000** 951.420
189 L 1.000** 951.420
190 T 1.000** 951.420
191 A 1.000** 951.420
192 V 1.000** 951.420
193 G 1.000** 951.420
194 H 1.000** 951.420
195 R 1.000** 951.420
196 L 1.000** 951.420
197 V 1.000** 951.420
198 Q 1.000** 951.420
199 F 1.000** 951.420
200 Q 1.000** 951.420
201 Y 1.000** 951.420
202 A 1.000** 951.420
203 G 1.000** 951.420
204 D 1.000** 951.420
205 S 1.000** 951.420
206 E 1.000** 951.420
207 D 1.000** 951.420
208 K 1.000** 951.420
209 G 1.000** 951.420
210 L 1.000** 951.420
211 A 1.000** 951.420
212 A 1.000** 951.420
213 A 1.000** 951.420
214 E 1.000** 951.420
215 N 1.000** 951.420
216 M 1.000** 951.420
217 L 1.000** 951.420
218 Q 1.000** 951.420
219 A 1.000** 951.420
220 H 1.000** 951.420
221 P 1.000** 951.420
222 A 1.000** 951.420
223 G 1.000** 951.420
224 D 1.000** 951.420
225 A 1.000** 951.420
226 N 1.000** 951.420
227 A 1.000** 951.420
228 I 1.000** 951.420
229 W 1.000** 951.420
230 C 1.000** 951.420
231 F 1.000** 951.420
232 N 1.000** 951.420
233 D 1.000** 951.420
234 K 1.000** 951.420
235 L 1.000** 951.420
236 C 1.000** 951.420
237 Q 1.000** 951.420
238 G 1.000** 951.420
239 A 1.000** 951.420
240 I 1.000** 951.420
241 K 1.000** 951.420
242 A 1.000** 951.420
243 V 1.000** 951.420
244 Y 1.000** 951.420
245 N 1.000** 951.420
246 A 1.000** 951.420
247 N 1.000** 951.420
248 R 1.000** 951.420
249 E 1.000** 951.420
250 K 1.000** 951.420
251 E 1.000** 951.420
252 F 1.000** 951.420
253 I 1.000** 951.420
254 F 1.000** 951.420
255 G 1.000** 951.420
256 G 1.000** 951.420
257 M 1.000** 951.420
258 D 1.000** 951.420
259 L 1.000** 951.420
260 T 1.000** 951.420
261 P 1.000** 951.420
262 Q 1.000** 951.420
263 A 1.000** 951.420
264 I 1.000** 951.420
265 A 1.000** 951.420
266 A 1.000** 951.420
267 I 1.000** 951.420
268 E 1.000** 951.420
269 N 1.000** 951.420
270 G 1.000** 951.420
271 L 1.000** 951.420
272 Y 1.000** 951.420
273 T 1.000** 951.420
274 V 1.000** 951.420
275 S 1.000** 951.420
276 L 1.000** 951.420
277 G 1.000** 951.420
278 A 1.000** 951.420
279 H 1.000** 951.420
280 W 1.000** 951.420
281 L 1.000** 951.420
282 E 1.000** 951.420
283 G 1.000** 951.420
284 G 1.000** 951.420
285 F 1.000** 951.420
286 G 1.000** 951.420
287 L 1.000** 951.420
288 A 1.000** 951.420
289 I 1.000** 951.420
290 L 1.000** 951.420
291 Y 1.000** 951.420
292 R 1.000** 951.420
293 K 1.000** 951.420
294 I 1.000** 951.420
295 H 1.000** 951.420
296 G 1.000** 951.420
297 Q 1.000** 951.420
298 D 1.000** 951.420
299 P 1.000** 951.420
300 A 1.000** 951.420
301 E 1.000** 951.420
302 R 1.000** 951.420
303 M 1.000** 951.420
304 V 1.000** 951.420
305 K 1.000** 951.420
306 L 1.000** 951.420
307 D 1.000** 951.420
308 L 1.000** 951.420
309 L 1.000** 951.420
310 K 1.000** 951.420
311 V 1.000** 951.420
312 D 1.000** 951.420
313 K 1.000** 951.420
314 S 1.000** 951.420
315 N 1.000** 951.420
316 V 1.000** 951.420
317 A 1.000** 951.420
318 K 1.000** 951.420
319 F 1.000** 951.420
320 K 1.000** 951.420
321 A 1.000** 951.420
322 R 1.000** 951.420
323 Y 1.000** 951.420
324 I 1.000** 951.420
325 D 1.000** 951.420
326 N 1.000** 951.420
327 T 1.000** 951.420
328 P 1.000** 951.420
329 H 1.000** 951.420
330 Y 1.000** 951.420
331 N 1.000** 951.420
332 W 1.000** 951.420
333 K 1.000** 951.420
334 S 1.000** 951.420
335 T 1.000** 951.420
336 T 1.000** 951.420
337 P 1.000** 951.420
338 F 1.000** 951.420
339 D 1.000** 951.420
340 M 1.000** 951.420
341 T 1.000** 951.420
342 I 1.000** 951.420
343 T 1.000** 951.420
344 L 1.000** 951.420
345 N 1.000** 951.420
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907710_1_409_MLBR_RS01960)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 S 0.639 4.860 +- 3.856
3 T 0.639 4.860 +- 3.856
4 G 0.639 4.860 +- 3.856
5 T 0.639 4.860 +- 3.856
6 S 0.639 4.860 +- 3.856
7 V 0.639 4.860 +- 3.856
8 P 0.639 4.860 +- 3.856
9 L 0.639 4.860 +- 3.856
10 R 0.639 4.860 +- 3.856
11 V 0.639 4.860 +- 3.856
12 A 0.639 4.860 +- 3.856
13 S 0.639 4.860 +- 3.856
14 I 0.639 4.860 +- 3.856
15 M 0.639 4.860 +- 3.856
16 L 0.639 4.860 +- 3.856
17 I 0.639 4.860 +- 3.856
18 L 0.639 4.860 +- 3.856
19 G 0.639 4.860 +- 3.856
20 L 0.639 4.860 +- 3.856
21 L 0.639 4.860 +- 3.856
22 P 0.639 4.860 +- 3.856
23 A 0.639 4.860 +- 3.856
24 I 0.639 4.860 +- 3.856
25 L 0.639 4.860 +- 3.856
26 P 0.639 4.860 +- 3.856
27 A 0.639 4.860 +- 3.856
28 C 0.639 4.860 +- 3.856
29 G 0.639 4.860 +- 3.856
30 F 0.639 4.860 +- 3.856
31 S 0.639 4.860 +- 3.856
32 E 0.639 4.860 +- 3.856
33 S 0.639 4.860 +- 3.856
34 H 0.639 4.860 +- 3.856
35 H 0.639 4.860 +- 3.856
36 K 0.639 4.860 +- 3.856
37 L 0.639 4.860 +- 3.856
38 T 0.639 4.860 +- 3.856
39 I 0.639 4.860 +- 3.856
40 G 0.639 4.860 +- 3.856
41 V 0.639 4.860 +- 3.856
42 S 0.639 4.860 +- 3.856
43 Y 0.639 4.860 +- 3.856
44 P 0.639 4.860 +- 3.856
45 T 0.639 4.860 +- 3.856
46 A 0.639 4.860 +- 3.856
47 N 0.639 4.860 +- 3.856
48 S 0.639 4.860 +- 3.856
49 P 0.639 4.860 +- 3.856
50 F 0.639 4.860 +- 3.856
51 W 0.639 4.860 +- 3.856
52 N 0.639 4.860 +- 3.856
53 A 0.639 4.860 +- 3.856
54 Y 0.639 4.860 +- 3.856
55 T 0.639 4.860 +- 3.856
56 R 0.639 4.860 +- 3.856
57 F 0.639 4.860 +- 3.856
58 I 0.639 4.860 +- 3.856
59 D 0.639 4.860 +- 3.856
60 E 0.639 4.860 +- 3.856
61 G 0.639 4.860 +- 3.856
62 S 0.639 4.860 +- 3.856
63 H 0.639 4.860 +- 3.856
64 Q 0.639 4.860 +- 3.856
65 L 0.639 4.860 +- 3.856
66 G 0.639 4.860 +- 3.856
67 V 0.639 4.860 +- 3.856
68 Y 0.639 4.860 +- 3.856
69 I 0.639 4.860 +- 3.856
70 N 0.639 4.860 +- 3.856
71 A 0.639 4.860 +- 3.856
72 V 0.639 4.860 +- 3.856
73 S 0.639 4.860 +- 3.856
74 A 0.639 4.860 +- 3.856
75 E 0.639 4.860 +- 3.856
76 E 0.639 4.860 +- 3.856
77 D 0.639 4.860 +- 3.856
78 E 0.639 4.860 +- 3.856
79 Q 0.639 4.860 +- 3.856
80 K 0.639 4.860 +- 3.856
81 Q 0.639 4.860 +- 3.856
82 L 0.639 4.860 +- 3.856
83 S 0.639 4.860 +- 3.856
84 D 0.639 4.860 +- 3.856
85 V 0.639 4.860 +- 3.856
86 E 0.639 4.860 +- 3.856
87 T 0.639 4.860 +- 3.856
88 L 0.639 4.860 +- 3.856
89 I 0.639 4.860 +- 3.856
90 N 0.639 4.860 +- 3.856
91 Q 0.639 4.860 +- 3.856
92 G 0.639 4.860 +- 3.856
93 I 0.639 4.860 +- 3.856
94 D 0.639 4.860 +- 3.856
95 G 0.639 4.860 +- 3.856
96 L 0.639 4.860 +- 3.856
97 I 0.639 4.860 +- 3.856
98 V 0.639 4.860 +- 3.856
99 T 0.639 4.860 +- 3.856
100 P 0.639 4.860 +- 3.856
101 Q 0.639 4.860 +- 3.856
102 S 0.639 4.860 +- 3.856
103 T 0.639 4.860 +- 3.856
104 S 0.639 4.860 +- 3.856
105 I 0.639 4.860 +- 3.856
106 A 0.639 4.860 +- 3.856
107 P 0.639 4.860 +- 3.856
108 T 0.639 4.860 +- 3.856
109 L 0.639 4.860 +- 3.856
110 L 0.639 4.860 +- 3.856
111 R 0.639 4.860 +- 3.856
112 I 0.639 4.860 +- 3.856
113 A 0.639 4.860 +- 3.856
114 T 0.639 4.860 +- 3.856
115 Q 0.639 4.860 +- 3.856
116 A 0.639 4.860 +- 3.856
117 N 0.639 4.860 +- 3.856
118 I 0.639 4.860 +- 3.856
119 P 0.639 4.860 +- 3.856
120 V 0.639 4.860 +- 3.856
121 V 0.639 4.860 +- 3.856
122 V 0.639 4.860 +- 3.856
123 V 0.639 4.860 +- 3.856
124 D 0.639 4.860 +- 3.856
125 R 0.639 4.860 +- 3.856
126 Y 0.639 4.860 +- 3.856
127 P 0.639 4.860 +- 3.856
128 G 0.639 4.860 +- 3.856
129 Y 0.639 4.860 +- 3.856
130 A 0.639 4.860 +- 3.856
131 P 0.639 4.860 +- 3.856
132 G 0.639 4.860 +- 3.856
133 Q 0.639 4.860 +- 3.856
134 N 0.639 4.860 +- 3.856
135 K 0.639 4.860 +- 3.856
136 N 0.639 4.860 +- 3.856
137 A 0.639 4.860 +- 3.856
138 D 0.639 4.860 +- 3.856
139 Y 0.639 4.860 +- 3.856
140 V 0.639 4.860 +- 3.856
141 A 0.639 4.860 +- 3.856
142 F 0.639 4.860 +- 3.856
143 L 0.639 4.860 +- 3.856
144 G 0.639 4.860 +- 3.856
145 P 0.639 4.860 +- 3.856
146 N 0.639 4.860 +- 3.856
147 N 0.639 4.860 +- 3.856
148 E 0.639 4.860 +- 3.856
149 K 0.639 4.860 +- 3.856
150 A 0.639 4.860 +- 3.856
151 G 0.639 4.860 +- 3.856
152 S 0.639 4.860 +- 3.856
153 G 0.639 4.860 +- 3.856
154 I 0.639 4.860 +- 3.856
155 A 0.639 4.860 +- 3.856
156 E 0.639 4.860 +- 3.856
157 A 0.639 4.860 +- 3.856
158 L 0.639 4.860 +- 3.856
159 M 0.639 4.860 +- 3.856
160 A 0.639 4.860 +- 3.856
161 G 0.639 4.860 +- 3.856
162 G 0.639 4.860 +- 3.856
163 G 0.639 4.860 +- 3.856
164 S 0.639 4.860 +- 3.856
165 K 0.639 4.860 +- 3.856
166 F 0.639 4.860 +- 3.856
167 L 0.639 4.860 +- 3.856
168 A 0.639 4.860 +- 3.856
169 L 0.639 4.860 +- 3.856
170 G 0.639 4.860 +- 3.856
171 G 0.923 6.858 +- 3.003
172 M 0.639 4.860 +- 3.856
173 P 0.639 4.860 +- 3.856
174 G 0.639 4.860 +- 3.856
175 N 0.639 4.860 +- 3.856
176 S 0.639 4.860 +- 3.856
177 V 0.639 4.860 +- 3.856
178 A 0.639 4.860 +- 3.856
179 Q 0.639 4.860 +- 3.856
180 G 0.639 4.860 +- 3.856
181 R 0.639 4.860 +- 3.856
182 K 0.639 4.860 +- 3.856
183 A 0.639 4.860 +- 3.856
184 G 0.639 4.860 +- 3.856
185 L 0.639 4.860 +- 3.856
186 E 0.639 4.860 +- 3.856
187 S 0.639 4.860 +- 3.856
188 A 0.639 4.860 +- 3.856
189 L 0.639 4.860 +- 3.856
190 T 0.639 4.860 +- 3.856
191 A 0.639 4.860 +- 3.856
192 V 0.639 4.860 +- 3.856
193 G 0.639 4.860 +- 3.856
194 H 0.639 4.860 +- 3.856
195 R 0.639 4.860 +- 3.856
196 L 0.639 4.860 +- 3.856
197 V 0.639 4.860 +- 3.856
198 Q 0.639 4.860 +- 3.856
199 F 0.639 4.860 +- 3.856
200 Q 0.639 4.860 +- 3.856
201 Y 0.639 4.860 +- 3.856
202 A 0.639 4.860 +- 3.856
203 G 0.639 4.860 +- 3.856
204 D 0.639 4.860 +- 3.856
205 S 0.639 4.860 +- 3.856
206 E 0.639 4.860 +- 3.856
207 D 0.639 4.860 +- 3.856
208 K 0.639 4.860 +- 3.856
209 G 0.639 4.860 +- 3.856
210 L 0.639 4.860 +- 3.856
211 A 0.639 4.860 +- 3.856
212 A 0.639 4.860 +- 3.856
213 A 0.639 4.860 +- 3.856
214 E 0.639 4.860 +- 3.856
215 N 0.639 4.860 +- 3.856
216 M 0.639 4.860 +- 3.856
217 L 0.639 4.860 +- 3.856
218 Q 0.639 4.860 +- 3.856
219 A 0.639 4.860 +- 3.856
220 H 0.639 4.860 +- 3.856
221 P 0.639 4.860 +- 3.856
222 A 0.639 4.860 +- 3.856
223 G 0.639 4.860 +- 3.856
224 D 0.639 4.860 +- 3.856
225 A 0.639 4.860 +- 3.856
226 N 0.639 4.860 +- 3.856
227 A 0.639 4.860 +- 3.856
228 I 0.639 4.860 +- 3.856
229 W 0.639 4.860 +- 3.856
230 C 0.639 4.860 +- 3.856
231 F 0.639 4.860 +- 3.856
232 N 0.639 4.860 +- 3.856
233 D 0.639 4.860 +- 3.856
234 K 0.639 4.860 +- 3.856
235 L 0.639 4.860 +- 3.856
236 C 0.639 4.860 +- 3.856
237 Q 0.639 4.860 +- 3.856
238 G 0.639 4.860 +- 3.856
239 A 0.639 4.860 +- 3.856
240 I 0.639 4.860 +- 3.856
241 K 0.639 4.860 +- 3.856
242 A 0.639 4.860 +- 3.856
243 V 0.639 4.860 +- 3.856
244 Y 0.639 4.860 +- 3.856
245 N 0.639 4.860 +- 3.856
246 A 0.639 4.860 +- 3.856
247 N 0.639 4.860 +- 3.856
248 R 0.639 4.860 +- 3.856
249 E 0.639 4.860 +- 3.856
250 K 0.639 4.860 +- 3.856
251 E 0.639 4.860 +- 3.856
252 F 0.639 4.860 +- 3.856
253 I 0.639 4.860 +- 3.856
254 F 0.639 4.860 +- 3.856
255 G 0.639 4.860 +- 3.856
256 G 0.639 4.860 +- 3.856
257 M 0.639 4.860 +- 3.856
258 D 0.639 4.860 +- 3.856
259 L 0.639 4.860 +- 3.856
260 T 0.639 4.860 +- 3.856
261 P 0.639 4.860 +- 3.856
262 Q 0.639 4.860 +- 3.856
263 A 0.639 4.860 +- 3.856
264 I 0.639 4.860 +- 3.856
265 A 0.639 4.860 +- 3.856
266 A 0.639 4.860 +- 3.856
267 I 0.639 4.860 +- 3.856
268 E 0.639 4.860 +- 3.856
269 N 0.639 4.860 +- 3.856
270 G 0.639 4.860 +- 3.856
271 L 0.639 4.860 +- 3.856
272 Y 0.639 4.860 +- 3.856
273 T 0.639 4.860 +- 3.856
274 V 0.639 4.860 +- 3.856
275 S 0.639 4.860 +- 3.856
276 L 0.639 4.860 +- 3.856
277 G 0.639 4.860 +- 3.856
278 A 0.639 4.860 +- 3.856
279 H 0.639 4.860 +- 3.856
280 W 0.639 4.860 +- 3.856
281 L 0.639 4.860 +- 3.856
282 E 0.639 4.860 +- 3.856
283 G 0.639 4.860 +- 3.856
284 G 0.639 4.860 +- 3.856
285 F 0.639 4.860 +- 3.856
286 G 0.639 4.860 +- 3.856
287 L 0.639 4.860 +- 3.856
288 A 0.639 4.860 +- 3.856
289 I 0.639 4.860 +- 3.856
290 L 0.639 4.860 +- 3.856
291 Y 0.639 4.860 +- 3.856
292 R 0.639 4.860 +- 3.856
293 K 0.639 4.860 +- 3.856
294 I 0.639 4.860 +- 3.856
295 H 0.639 4.860 +- 3.856
296 G 0.639 4.860 +- 3.856
297 Q 0.639 4.860 +- 3.856
298 D 0.639 4.860 +- 3.856
299 P 0.639 4.860 +- 3.856
300 A 0.639 4.860 +- 3.856
301 E 0.639 4.860 +- 3.856
302 R 0.639 4.860 +- 3.856
303 M 0.639 4.860 +- 3.856
304 V 0.639 4.860 +- 3.856
305 K 0.639 4.860 +- 3.856
306 L 0.639 4.860 +- 3.856
307 D 0.639 4.860 +- 3.856
308 L 0.639 4.860 +- 3.856
309 L 0.639 4.860 +- 3.856
310 K 0.639 4.860 +- 3.856
311 V 0.639 4.860 +- 3.856
312 D 0.639 4.860 +- 3.856
313 K 0.639 4.860 +- 3.856
314 S 0.639 4.860 +- 3.856
315 N 0.639 4.860 +- 3.856
316 V 0.639 4.860 +- 3.856
317 A 0.639 4.860 +- 3.856
318 K 0.639 4.860 +- 3.856
319 F 0.639 4.860 +- 3.856
320 K 0.639 4.860 +- 3.856
321 A 0.639 4.860 +- 3.856
322 R 0.639 4.860 +- 3.856
323 Y 0.639 4.860 +- 3.856
324 I 0.639 4.860 +- 3.856
325 D 0.639 4.860 +- 3.856
326 N 0.639 4.860 +- 3.856
327 T 0.639 4.860 +- 3.856
328 P 0.639 4.860 +- 3.856
329 H 0.639 4.860 +- 3.856
330 Y 0.639 4.860 +- 3.856
331 N 0.639 4.860 +- 3.856
332 W 0.639 4.860 +- 3.856
333 K 0.639 4.860 +- 3.856
334 S 0.639 4.860 +- 3.856
335 T 0.639 4.860 +- 3.856
336 T 0.639 4.860 +- 3.856
337 P 0.639 4.860 +- 3.856
338 F 0.639 4.860 +- 3.856
339 D 0.639 4.860 +- 3.856
340 M 0.639 4.860 +- 3.856
341 T 0.639 4.860 +- 3.856
342 I 0.639 4.860 +- 3.856
343 T 0.639 4.860 +- 3.856
344 L 0.639 4.860 +- 3.856
345 N 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:18
Model 1: NearlyNeutral -1374.931759 Model 2: PositiveSelection -1374.614367 Model 0: one-ratio -1374.614236 Model 7: beta -1374.931758 Model 8: beta&w>1 -1374.614367 Model 0 vs 1 0.6350460000003295 Model 2 vs 1 0.6347840000003089 Model 8 vs 7 0.6347820000000866
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
