--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:28:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0407/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -892.55 -895.62
2 -892.57 -895.97
--------------------------------------
TOTAL -892.56 -895.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891336 0.087440 0.394933 1.505938 0.861274 1452.94 1476.97 1.000
r(A<->C){all} 0.160798 0.018944 0.000005 0.432358 0.123551 159.38 205.76 1.000
r(A<->G){all} 0.165671 0.020926 0.000171 0.469502 0.122877 116.65 173.61 1.001
r(A<->T){all} 0.171627 0.020165 0.000506 0.461164 0.137174 200.72 228.76 1.000
r(C<->G){all} 0.173495 0.022942 0.000078 0.494333 0.126775 154.04 155.76 1.004
r(C<->T){all} 0.173837 0.021256 0.000056 0.462386 0.136530 193.93 287.90 1.005
r(G<->T){all} 0.154572 0.017951 0.000182 0.430417 0.115562 88.06 115.36 1.004
pi(A){all} 0.230668 0.000267 0.198668 0.262116 0.230696 1277.21 1341.54 1.000
pi(C){all} 0.256357 0.000291 0.224832 0.290736 0.256066 956.38 1141.34 1.000
pi(G){all} 0.308229 0.000332 0.273518 0.343848 0.307769 1116.00 1214.94 1.000
pi(T){all} 0.204746 0.000245 0.176282 0.236711 0.204331 1255.90 1336.64 1.001
alpha{1,2} 0.418142 0.247079 0.000147 1.422119 0.239029 1171.20 1187.93 1.000
alpha{3} 0.460363 0.258399 0.000146 1.482566 0.288343 1077.52 1201.97 1.001
pinvar{all} 0.997559 0.000008 0.992018 0.999999 0.998521 978.83 1135.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -867.731953
Model 2: PositiveSelection -867.732427
Model 0: one-ratio -867.731953
Model 7: beta -867.732462
Model 8: beta&w>1 -867.732364
Model 0 vs 1 0.0
Model 2 vs 1 9.480000001076405E-4
Model 8 vs 7 1.960000001872686E-4
>C1
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C2
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C3
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C4
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C5
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C6
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=216
C1 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C2 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C3 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C4 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C5 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C6 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
**************************************************
C1 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C2 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C3 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C4 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C5 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C6 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
**************************************************
C1 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C2 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C3 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C4 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C5 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C6 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
**************************************************
C1 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C2 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C3 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C4 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C5 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C6 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
**************************************************
C1 RYSDYCPAQDTENDQW
C2 RYSDYCPAQDTENDQW
C3 RYSDYCPAQDTENDQW
C4 RYSDYCPAQDTENDQW
C5 RYSDYCPAQDTENDQW
C6 RYSDYCPAQDTENDQW
****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6480]--->[6480]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.485 Mb, Max= 30.762 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C2 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C3 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C4 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C5 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
C6 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
**************************************************
C1 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C2 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C3 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C4 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C5 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
C6 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
**************************************************
C1 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C2 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C3 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C4 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C5 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
C6 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
**************************************************
C1 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C2 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C3 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C4 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C5 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
C6 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
**************************************************
C1 RYSDYCPAQDTENDQW
C2 RYSDYCPAQDTENDQW
C3 RYSDYCPAQDTENDQW
C4 RYSDYCPAQDTENDQW
C5 RYSDYCPAQDTENDQW
C6 RYSDYCPAQDTENDQW
****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
C2 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
C3 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
C4 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
C5 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
C6 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
**************************************************
C1 TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
C2 TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
C3 TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
C4 TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
C5 TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
C6 TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
**************************************************
C1 ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
C2 ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
C3 ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
C4 ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
C5 ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
C6 ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
**************************************************
C1 GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
C2 GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
C3 GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
C4 GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
C5 GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
C6 GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
**************************************************
C1 GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
C2 GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
C3 GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
C4 GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
C5 GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
C6 GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
**************************************************
C1 AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
C2 AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
C3 AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
C4 AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
C5 AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
C6 AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
**************************************************
C1 AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
C2 AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
C3 AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
C4 AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
C5 AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
C6 AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
**************************************************
C1 CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
C2 CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
C3 CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
C4 CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
C5 CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
C6 CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
**************************************************
C1 CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
C2 CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
C3 CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
C4 CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
C5 CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
C6 CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
**************************************************
C1 GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
C2 GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
C3 GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
C4 GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
C5 GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
C6 GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
**************************************************
C1 TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
C2 TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
C3 TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
C4 TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
C5 TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
C6 TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
**************************************************
C1 TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
C2 TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
C3 TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
C4 TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
C5 TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
C6 TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
**************************************************
C1 CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
C2 CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
C3 CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
C4 CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
C5 CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
C6 CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
************************************************
>C1
ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
>C2
ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
>C3
ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
>C4
ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
>C5
ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
>C6
ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT
TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA
ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC
GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC
GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG
AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG
AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA
CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG
CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG
GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA
TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT
TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT
CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
>C1
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C2
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C3
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C4
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C5
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
>C6
MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
RYSDYCPAQDTENDQW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 648 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800411
Setting output file names to "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1675923995
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1759650711
Seed = 773881274
Swapseed = 1579800411
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1450.254982 -- -24.965149
Chain 2 -- -1450.255065 -- -24.965149
Chain 3 -- -1450.254844 -- -24.965149
Chain 4 -- -1450.255065 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1450.254844 -- -24.965149
Chain 2 -- -1450.254844 -- -24.965149
Chain 3 -- -1450.255065 -- -24.965149
Chain 4 -- -1450.254982 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1450.255] (-1450.255) (-1450.255) (-1450.255) * [-1450.255] (-1450.255) (-1450.255) (-1450.255)
500 -- (-904.373) (-897.939) (-906.513) [-900.595] * (-911.416) (-908.156) [-903.478] (-902.996) -- 0:00:00
1000 -- (-904.981) (-898.138) (-915.538) [-897.955] * (-913.244) (-902.414) (-902.588) [-902.204] -- 0:00:00
1500 -- (-901.275) (-903.199) (-906.207) [-899.725] * (-899.672) [-896.351] (-905.294) (-901.923) -- 0:00:00
2000 -- (-905.250) (-912.372) [-903.204] (-902.034) * [-899.905] (-902.390) (-906.753) (-902.049) -- 0:08:19
2500 -- [-903.720] (-899.818) (-902.766) (-906.682) * (-901.508) [-898.241] (-898.232) (-907.253) -- 0:06:39
3000 -- (-902.665) [-897.292] (-905.480) (-901.691) * (-904.588) (-905.334) (-903.385) [-900.015] -- 0:05:32
3500 -- (-901.706) (-896.630) [-901.738] (-899.655) * (-901.075) (-898.770) (-905.719) [-903.151] -- 0:04:44
4000 -- (-910.243) [-899.594] (-903.606) (-902.950) * (-899.841) (-907.496) [-904.855] (-901.513) -- 0:04:09
4500 -- [-899.756] (-909.555) (-898.697) (-903.736) * (-900.003) [-899.846] (-902.158) (-901.059) -- 0:03:41
5000 -- (-905.489) (-904.384) [-905.071] (-903.696) * [-901.418] (-898.096) (-909.522) (-899.983) -- 0:03:19
Average standard deviation of split frequencies: 0.107137
5500 -- (-908.980) (-901.486) (-902.419) [-898.428] * (-900.167) (-903.048) [-902.638] (-910.009) -- 0:03:00
6000 -- [-901.079] (-910.558) (-903.008) (-899.388) * [-900.876] (-903.901) (-901.339) (-906.152) -- 0:02:45
6500 -- (-899.850) (-898.558) [-899.618] (-900.154) * (-909.724) [-899.735] (-905.288) (-909.814) -- 0:02:32
7000 -- [-905.162] (-903.752) (-901.705) (-911.769) * (-906.495) (-903.872) [-900.610] (-901.012) -- 0:02:21
7500 -- (-904.531) [-902.508] (-899.506) (-905.535) * (-901.661) [-897.992] (-899.399) (-897.483) -- 0:02:12
8000 -- (-903.153) (-901.469) (-899.574) [-900.359] * (-903.818) (-912.885) (-903.570) [-901.699] -- 0:02:04
8500 -- [-901.855] (-906.056) (-906.753) (-899.479) * (-916.365) (-902.420) [-908.268] (-899.332) -- 0:01:56
9000 -- (-902.507) [-901.291] (-899.120) (-900.155) * (-912.638) (-897.989) [-900.093] (-900.126) -- 0:01:50
9500 -- [-912.343] (-902.936) (-901.274) (-902.516) * (-895.293) [-904.876] (-903.656) (-905.555) -- 0:01:44
10000 -- (-903.237) (-901.090) [-898.868] (-905.317) * (-893.950) (-903.239) [-901.209] (-906.982) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- (-900.868) (-903.555) (-913.821) [-903.705] * (-894.290) (-904.431) [-898.186] (-901.055) -- 0:01:34
11000 -- [-902.002] (-911.221) (-902.201) (-904.170) * [-893.381] (-901.491) (-905.879) (-899.897) -- 0:01:29
11500 -- (-907.963) [-900.970] (-909.182) (-909.228) * (-894.244) (-909.858) [-894.800] (-904.301) -- 0:01:25
12000 -- [-902.407] (-903.425) (-898.573) (-898.569) * (-895.611) [-898.826] (-892.311) (-911.574) -- 0:01:22
12500 -- (-902.432) (-899.922) (-906.010) [-900.995] * (-892.822) (-907.267) [-894.839] (-903.712) -- 0:01:19
13000 -- [-904.466] (-899.841) (-905.739) (-900.816) * (-892.271) (-903.970) (-895.598) [-900.601] -- 0:01:15
13500 -- [-894.098] (-904.519) (-907.958) (-907.574) * (-893.423) (-904.046) (-894.340) [-897.944] -- 0:01:13
14000 -- (-903.349) [-903.818] (-907.904) (-900.761) * (-892.979) (-902.886) (-892.988) [-902.004] -- 0:01:10
14500 -- [-899.712] (-899.274) (-906.365) (-899.321) * (-893.756) [-902.270] (-895.438) (-899.905) -- 0:01:07
15000 -- (-914.361) (-899.736) (-899.789) [-910.251] * (-894.461) (-903.564) [-893.392] (-905.746) -- 0:01:05
Average standard deviation of split frequencies: 0.055979
15500 -- (-895.981) (-908.466) (-908.685) [-898.800] * (-895.029) (-904.775) (-895.539) [-903.629] -- 0:01:03
16000 -- (-893.461) (-904.488) (-902.941) [-901.390] * (-893.391) [-897.930] (-895.515) (-909.485) -- 0:01:01
16500 -- (-891.936) (-895.677) (-902.555) [-899.568] * (-895.024) (-897.215) (-896.435) [-905.142] -- 0:00:59
17000 -- [-895.916] (-894.261) (-899.286) (-903.072) * [-896.393] (-908.654) (-893.976) (-902.327) -- 0:00:57
17500 -- (-898.239) (-892.818) [-906.638] (-897.896) * (-893.288) (-899.456) [-893.557] (-900.320) -- 0:00:56
18000 -- (-896.556) (-893.079) [-901.038] (-903.748) * (-892.965) (-902.219) (-892.454) [-899.325] -- 0:01:49
18500 -- (-893.792) (-891.923) (-898.641) [-897.943] * [-893.917] (-901.738) (-893.296) (-903.776) -- 0:01:46
19000 -- (-895.684) [-892.767] (-907.887) (-898.178) * [-892.310] (-905.116) (-891.695) (-899.479) -- 0:01:43
19500 -- (-896.422) [-893.032] (-914.520) (-900.622) * (-893.519) (-902.139) [-891.358] (-909.683) -- 0:01:40
20000 -- [-893.225] (-893.115) (-905.889) (-904.465) * (-892.758) [-901.856] (-893.281) (-904.144) -- 0:01:38
Average standard deviation of split frequencies: 0.048021
20500 -- [-892.390] (-891.831) (-894.626) (-908.449) * (-892.229) (-900.466) [-891.070] (-901.288) -- 0:01:35
21000 -- (-892.588) (-892.597) (-893.964) [-896.212] * (-893.007) [-897.587] (-892.722) (-901.274) -- 0:01:33
21500 -- (-894.015) (-893.765) [-893.638] (-906.271) * (-892.078) (-906.301) [-891.236] (-916.095) -- 0:01:31
22000 -- (-891.112) (-894.849) (-893.585) [-898.930] * (-893.036) [-907.061] (-892.420) (-892.281) -- 0:01:28
22500 -- (-891.661) (-894.327) [-892.365] (-903.395) * [-893.273] (-902.153) (-892.728) (-896.164) -- 0:01:26
23000 -- (-894.351) [-892.356] (-893.832) (-898.940) * (-894.950) (-907.189) [-896.208] (-892.345) -- 0:01:24
23500 -- (-898.377) [-895.876] (-896.856) (-898.700) * (-894.518) [-899.006] (-894.082) (-892.314) -- 0:01:23
24000 -- (-897.099) [-894.216] (-891.957) (-902.741) * [-893.948] (-898.434) (-892.776) (-891.779) -- 0:01:21
24500 -- (-895.110) (-892.888) [-892.689] (-904.985) * (-893.125) (-901.796) [-895.678] (-892.877) -- 0:01:19
25000 -- (-895.260) [-892.905] (-893.760) (-902.630) * (-892.386) (-912.224) [-895.094] (-893.248) -- 0:01:18
Average standard deviation of split frequencies: 0.043169
25500 -- (-891.969) (-892.675) [-893.655] (-898.533) * (-893.199) [-908.937] (-895.829) (-892.767) -- 0:01:16
26000 -- (-892.523) (-894.035) (-893.414) [-898.178] * [-891.698] (-903.856) (-892.155) (-892.469) -- 0:01:14
26500 -- (-891.613) (-892.887) (-892.233) [-898.396] * (-892.955) (-902.916) [-893.142] (-892.520) -- 0:01:13
27000 -- (-892.244) [-893.171] (-892.336) (-908.645) * (-893.382) (-899.750) [-894.027] (-893.811) -- 0:01:12
27500 -- (-892.309) (-893.562) (-893.605) [-899.384] * (-892.713) (-906.029) [-892.854] (-893.304) -- 0:01:10
28000 -- (-900.384) (-893.463) (-894.227) [-902.872] * (-893.427) (-908.178) [-891.663] (-902.359) -- 0:01:09
28500 -- (-894.407) (-895.422) (-896.967) [-899.484] * (-893.453) [-897.429] (-893.226) (-893.411) -- 0:01:08
29000 -- (-897.801) (-895.707) (-893.651) [-900.168] * (-897.021) (-898.315) (-892.350) [-891.421] -- 0:01:06
29500 -- (-892.535) (-893.352) [-892.759] (-901.550) * (-895.851) [-893.331] (-892.517) (-891.837) -- 0:01:05
30000 -- [-892.795] (-892.070) (-892.110) (-906.557) * (-902.314) (-892.713) [-892.654] (-892.479) -- 0:01:04
Average standard deviation of split frequencies: 0.046116
30500 -- (-892.082) (-892.405) [-893.983] (-909.673) * (-893.445) (-891.912) [-892.284] (-892.247) -- 0:01:03
31000 -- [-892.969] (-892.944) (-892.997) (-900.294) * (-893.343) [-892.477] (-892.014) (-894.589) -- 0:01:02
31500 -- (-891.056) (-892.394) (-894.521) [-898.778] * [-893.631] (-893.368) (-894.892) (-893.555) -- 0:01:01
32000 -- [-893.177] (-892.291) (-894.629) (-904.982) * (-895.132) (-893.427) (-891.881) [-894.830] -- 0:01:00
32500 -- (-892.880) [-892.120] (-892.339) (-911.585) * (-891.863) (-892.690) (-893.479) [-893.434] -- 0:00:59
33000 -- (-892.726) (-892.462) (-893.309) [-909.429] * [-892.629] (-896.593) (-893.521) (-895.653) -- 0:00:58
33500 -- [-891.978] (-892.641) (-893.060) (-912.116) * (-891.289) [-897.453] (-893.499) (-893.974) -- 0:00:57
34000 -- (-892.358) [-893.178] (-891.713) (-911.949) * [-894.589] (-893.616) (-893.896) (-895.989) -- 0:00:56
34500 -- (-892.153) (-894.416) (-891.843) [-901.861] * [-895.471] (-893.348) (-891.949) (-894.307) -- 0:01:23
35000 -- (-891.769) (-891.394) [-894.248] (-911.283) * [-892.784] (-893.535) (-892.415) (-895.294) -- 0:01:22
Average standard deviation of split frequencies: 0.042194
35500 -- (-891.678) [-891.422] (-897.196) (-905.183) * [-895.506] (-893.662) (-894.004) (-894.157) -- 0:01:21
36000 -- (-892.869) (-891.805) [-893.521] (-905.573) * (-898.056) (-892.975) (-892.093) [-897.400] -- 0:01:20
36500 -- (-892.400) (-894.024) [-893.784] (-901.621) * (-895.215) [-891.523] (-894.592) (-895.705) -- 0:01:19
37000 -- (-892.001) [-895.988] (-898.214) (-905.310) * (-893.523) (-891.525) (-893.116) [-895.398] -- 0:01:18
37500 -- (-896.047) (-893.297) [-895.171] (-898.056) * (-891.727) (-891.542) [-893.339] (-894.845) -- 0:01:17
38000 -- (-896.729) (-894.201) [-898.612] (-898.605) * (-891.021) (-891.633) (-892.904) [-893.399] -- 0:01:15
38500 -- (-893.842) (-891.313) (-894.121) [-899.352] * (-891.692) [-891.850] (-892.265) (-897.764) -- 0:01:14
39000 -- [-892.356] (-895.821) (-894.921) (-900.773) * (-895.427) (-891.472) [-893.045] (-893.609) -- 0:01:13
39500 -- (-896.926) [-895.758] (-891.933) (-902.623) * (-895.951) [-893.199] (-892.690) (-892.925) -- 0:01:12
40000 -- [-893.912] (-891.253) (-893.134) (-904.312) * (-893.348) [-893.458] (-894.780) (-895.484) -- 0:01:12
Average standard deviation of split frequencies: 0.033412
40500 -- [-893.863] (-892.590) (-895.048) (-899.146) * (-894.147) [-893.072] (-898.577) (-892.453) -- 0:01:11
41000 -- (-897.350) (-894.444) [-892.705] (-899.706) * (-892.508) (-894.342) (-896.175) [-893.387] -- 0:01:10
41500 -- (-895.987) (-893.171) [-892.125] (-906.681) * (-894.984) (-892.209) [-894.596] (-898.175) -- 0:01:09
42000 -- (-893.556) (-892.636) [-892.585] (-900.974) * (-893.211) (-893.200) (-895.455) [-893.192] -- 0:01:08
42500 -- (-893.951) (-892.572) [-893.051] (-898.888) * (-892.099) [-892.932] (-897.276) (-891.924) -- 0:01:07
43000 -- (-895.488) [-891.364] (-892.819) (-903.793) * [-891.954] (-896.027) (-894.119) (-894.612) -- 0:01:06
43500 -- (-892.405) (-893.810) (-895.363) [-904.469] * (-892.114) (-894.453) [-892.689] (-894.660) -- 0:01:05
44000 -- (-893.251) [-895.235] (-894.791) (-907.878) * [-893.242] (-894.670) (-895.411) (-894.685) -- 0:01:05
44500 -- (-893.875) [-893.066] (-893.768) (-900.907) * (-893.363) (-893.474) [-892.961] (-894.452) -- 0:01:04
45000 -- [-892.600] (-900.987) (-892.659) (-894.241) * (-896.334) (-894.081) [-897.037] (-893.392) -- 0:01:03
Average standard deviation of split frequencies: 0.031283
45500 -- [-891.450] (-898.636) (-898.617) (-894.369) * [-897.406] (-893.178) (-895.628) (-892.991) -- 0:01:02
46000 -- [-891.041] (-895.492) (-893.445) (-894.149) * (-893.927) (-892.388) [-893.236] (-893.150) -- 0:01:02
46500 -- [-891.763] (-895.061) (-895.238) (-894.753) * (-892.419) (-892.840) (-893.021) [-893.139] -- 0:01:01
47000 -- (-892.840) (-895.646) [-892.203] (-893.045) * (-891.713) (-891.553) (-895.914) [-894.124] -- 0:01:00
47500 -- (-891.612) [-896.195] (-893.687) (-893.603) * (-891.699) (-892.388) (-894.557) [-894.146] -- 0:01:00
48000 -- [-892.523] (-898.748) (-895.714) (-892.329) * (-893.425) (-891.064) (-892.597) [-894.402] -- 0:00:59
48500 -- (-894.599) (-897.198) [-895.710] (-892.122) * (-892.372) (-892.999) [-892.224] (-893.760) -- 0:00:58
49000 -- (-893.693) (-895.713) [-894.554] (-895.151) * [-892.233] (-891.439) (-893.255) (-892.279) -- 0:00:58
49500 -- (-891.874) (-892.884) [-891.759] (-894.856) * (-894.407) (-895.792) (-892.797) [-893.429] -- 0:00:57
50000 -- (-891.723) (-892.885) [-894.855] (-891.782) * (-894.315) (-892.012) [-892.153] (-895.335) -- 0:00:57
Average standard deviation of split frequencies: 0.028402
50500 -- [-891.491] (-894.253) (-891.133) (-894.219) * (-893.021) (-892.778) (-892.434) [-892.528] -- 0:01:15
51000 -- (-891.693) (-893.157) [-891.744] (-892.761) * (-895.049) (-891.163) (-891.997) [-895.825] -- 0:01:14
51500 -- (-892.162) (-895.354) [-893.642] (-893.100) * (-892.932) (-891.502) [-892.411] (-895.213) -- 0:01:13
52000 -- (-892.185) [-894.029] (-893.162) (-891.863) * (-893.349) [-892.174] (-892.438) (-894.173) -- 0:01:12
52500 -- (-892.383) (-892.195) [-894.256] (-893.342) * (-894.767) [-892.881] (-894.185) (-897.619) -- 0:01:12
53000 -- (-892.455) (-892.639) [-892.837] (-893.423) * (-896.404) (-893.869) (-894.701) [-892.663] -- 0:01:11
53500 -- [-893.025] (-894.374) (-900.811) (-896.803) * (-894.111) [-895.942] (-893.562) (-892.212) -- 0:01:10
54000 -- (-894.648) [-891.161] (-894.209) (-892.088) * (-894.436) (-905.785) [-893.285] (-893.776) -- 0:01:10
54500 -- (-894.118) (-892.679) (-892.953) [-892.094] * (-896.054) (-893.292) [-893.405] (-894.640) -- 0:01:09
55000 -- (-893.643) (-892.602) [-893.589] (-893.163) * [-893.181] (-892.009) (-892.656) (-894.049) -- 0:01:08
Average standard deviation of split frequencies: 0.020577
55500 -- [-894.078] (-892.665) (-895.772) (-892.448) * (-895.864) (-892.009) (-891.775) [-892.043] -- 0:01:08
56000 -- (-895.011) [-892.549] (-892.853) (-895.922) * [-892.820] (-898.030) (-900.627) (-891.642) -- 0:01:07
56500 -- (-893.679) [-894.921] (-892.398) (-891.209) * (-894.327) (-892.999) [-891.740] (-896.118) -- 0:01:06
57000 -- (-892.886) (-892.528) [-892.065] (-891.770) * (-893.484) (-892.680) [-893.261] (-894.931) -- 0:01:06
57500 -- [-893.936] (-896.131) (-893.950) (-893.778) * (-892.321) (-893.709) (-894.087) [-892.022] -- 0:01:05
58000 -- (-892.357) [-893.590] (-891.116) (-892.938) * (-893.470) (-891.660) [-894.895] (-892.417) -- 0:01:04
58500 -- (-891.974) (-894.579) [-891.836] (-894.495) * (-893.817) (-892.074) (-897.961) [-893.588] -- 0:01:04
59000 -- [-898.391] (-896.143) (-893.910) (-892.329) * [-891.118] (-892.808) (-899.234) (-893.112) -- 0:01:03
59500 -- [-893.134] (-893.515) (-893.849) (-891.517) * (-891.642) (-891.888) [-892.277] (-892.381) -- 0:01:03
60000 -- (-891.629) (-893.163) (-895.301) [-891.636] * (-891.509) (-892.173) [-891.912] (-893.125) -- 0:01:02
Average standard deviation of split frequencies: 0.019858
60500 -- (-892.774) (-893.480) (-895.039) [-894.376] * (-892.308) (-895.456) [-892.818] (-892.501) -- 0:01:02
61000 -- [-891.856] (-893.679) (-894.295) (-894.207) * (-895.795) [-893.457] (-893.454) (-895.838) -- 0:01:01
61500 -- (-893.638) [-892.734] (-894.924) (-893.676) * [-892.057] (-892.686) (-893.712) (-895.186) -- 0:01:01
62000 -- (-893.380) [-896.534] (-895.879) (-897.888) * (-894.350) (-892.973) (-892.708) [-894.179] -- 0:01:00
62500 -- (-893.730) [-892.786] (-897.439) (-893.515) * (-896.075) (-892.620) (-897.064) [-892.840] -- 0:01:00
63000 -- (-892.355) [-893.932] (-891.650) (-895.997) * (-897.630) (-893.670) (-892.568) [-894.190] -- 0:00:59
63500 -- (-894.011) [-893.299] (-892.928) (-892.406) * (-897.228) (-896.340) [-892.932] (-893.932) -- 0:00:58
64000 -- (-892.282) [-893.876] (-892.159) (-894.138) * (-892.754) (-893.143) (-899.110) [-897.094] -- 0:00:58
64500 -- (-893.121) (-892.947) (-895.410) [-893.162] * [-892.401] (-894.980) (-894.447) (-893.664) -- 0:00:58
65000 -- (-895.147) (-893.576) (-899.076) [-897.059] * (-894.967) (-893.174) [-894.727] (-891.895) -- 0:00:57
Average standard deviation of split frequencies: 0.018796
65500 -- (-897.155) [-894.987] (-900.384) (-893.893) * [-893.323] (-894.458) (-892.066) (-892.511) -- 0:00:57
66000 -- (-894.500) (-894.792) (-892.446) [-893.936] * (-894.254) (-893.999) [-893.768] (-896.040) -- 0:00:56
66500 -- (-891.932) [-899.180] (-896.313) (-894.551) * (-894.046) [-891.785] (-893.298) (-895.553) -- 0:00:56
67000 -- (-899.151) [-894.522] (-892.094) (-893.452) * (-895.296) (-891.989) (-893.892) [-894.611] -- 0:00:55
67500 -- (-891.278) (-891.976) [-892.131] (-896.264) * [-900.644] (-892.446) (-892.188) (-893.047) -- 0:01:09
68000 -- [-893.957] (-892.846) (-891.411) (-897.806) * [-893.074] (-892.878) (-892.272) (-895.618) -- 0:01:08
68500 -- (-893.605) [-891.595] (-893.646) (-891.754) * (-892.895) (-893.998) [-893.635] (-893.824) -- 0:01:07
69000 -- (-893.632) (-891.770) [-892.862] (-891.907) * (-891.979) [-896.478] (-891.721) (-893.618) -- 0:01:07
69500 -- (-894.766) (-892.065) (-893.411) [-892.443] * (-891.843) [-894.641] (-891.954) (-892.442) -- 0:01:06
70000 -- (-894.890) (-891.995) [-892.972] (-895.388) * [-894.866] (-896.308) (-892.712) (-897.553) -- 0:01:06
Average standard deviation of split frequencies: 0.021768
70500 -- (-899.229) [-891.984] (-895.908) (-894.840) * (-892.056) (-892.745) [-891.954] (-895.828) -- 0:01:05
71000 -- (-894.365) (-897.371) (-893.384) [-894.312] * (-892.181) [-899.153] (-893.247) (-901.876) -- 0:01:05
71500 -- (-903.661) (-894.806) [-892.029] (-892.948) * (-893.329) [-891.492] (-893.441) (-895.942) -- 0:01:04
72000 -- (-894.246) (-898.567) (-893.147) [-893.030] * [-891.411] (-895.915) (-896.372) (-898.276) -- 0:01:04
72500 -- [-894.241] (-894.640) (-894.589) (-891.728) * [-895.034] (-892.231) (-895.587) (-891.837) -- 0:01:03
73000 -- (-896.263) (-894.049) (-895.414) [-892.017] * (-897.647) (-892.945) [-892.326] (-894.941) -- 0:01:03
73500 -- (-893.057) (-897.868) (-892.803) [-891.452] * (-897.863) [-891.680] (-893.522) (-893.351) -- 0:01:03
74000 -- (-894.309) (-894.863) [-892.820] (-891.672) * (-897.099) [-894.790] (-893.532) (-893.156) -- 0:01:02
74500 -- (-892.442) (-891.973) [-892.011] (-892.413) * (-896.458) (-892.957) (-893.249) [-892.893] -- 0:01:02
75000 -- [-891.781] (-891.614) (-894.130) (-896.958) * (-894.510) [-894.683] (-896.273) (-894.601) -- 0:01:01
Average standard deviation of split frequencies: 0.020676
75500 -- (-891.606) [-891.863] (-893.708) (-894.034) * (-893.015) [-891.719] (-895.088) (-895.120) -- 0:01:01
76000 -- (-896.002) [-894.649] (-893.679) (-892.120) * (-893.693) (-892.810) (-894.639) [-894.120] -- 0:01:00
76500 -- [-893.377] (-893.478) (-894.359) (-892.404) * (-893.974) (-895.105) [-894.262] (-891.890) -- 0:01:00
77000 -- [-892.172] (-891.044) (-892.872) (-895.385) * (-893.337) (-892.932) [-892.306] (-892.711) -- 0:00:59
77500 -- (-895.582) (-891.489) (-894.103) [-892.113] * (-893.338) (-896.146) [-892.851] (-896.102) -- 0:00:59
78000 -- (-894.470) (-897.048) (-892.518) [-892.012] * (-893.410) (-893.975) (-894.213) [-894.397] -- 0:00:59
78500 -- (-892.761) [-891.563] (-893.989) (-892.725) * (-894.362) (-895.229) (-892.710) [-893.369] -- 0:00:58
79000 -- [-894.625] (-893.195) (-893.666) (-892.503) * (-892.699) [-893.460] (-891.967) (-891.938) -- 0:00:58
79500 -- (-894.692) [-893.957] (-893.060) (-895.017) * (-892.754) (-899.643) [-894.562] (-892.539) -- 0:00:57
80000 -- [-892.533] (-895.184) (-895.729) (-899.171) * [-892.407] (-892.207) (-893.123) (-892.539) -- 0:00:57
Average standard deviation of split frequencies: 0.020625
80500 -- [-892.186] (-893.320) (-895.101) (-896.189) * (-893.614) (-893.543) (-893.308) [-893.342] -- 0:00:57
81000 -- [-894.137] (-892.943) (-893.732) (-894.652) * (-892.790) (-894.875) [-892.258] (-891.688) -- 0:00:56
81500 -- (-893.252) (-892.758) (-893.402) [-892.864] * (-894.526) [-893.550] (-893.211) (-891.933) -- 0:00:56
82000 -- (-893.035) (-895.508) (-891.885) [-893.767] * [-892.965] (-892.213) (-891.705) (-892.936) -- 0:00:55
82500 -- (-894.887) (-893.248) [-891.879] (-897.217) * (-893.409) [-892.893] (-891.494) (-896.411) -- 0:00:55
83000 -- (-893.552) [-896.632] (-893.074) (-895.372) * (-896.783) (-895.432) (-891.944) [-893.421] -- 0:00:55
83500 -- (-892.619) (-893.500) [-895.205] (-897.138) * [-892.912] (-894.951) (-892.488) (-892.911) -- 0:00:54
84000 -- (-892.871) [-893.873] (-891.554) (-891.873) * (-892.102) (-893.820) (-891.742) [-894.640] -- 0:01:05
84500 -- (-891.719) (-892.840) (-891.736) [-893.780] * (-892.216) [-892.214] (-892.642) (-894.514) -- 0:01:05
85000 -- (-896.158) (-892.780) [-892.142] (-893.690) * (-892.362) [-892.461] (-891.740) (-891.582) -- 0:01:04
Average standard deviation of split frequencies: 0.021349
85500 -- [-896.679] (-893.465) (-893.308) (-897.040) * (-891.906) [-892.701] (-891.896) (-892.678) -- 0:01:04
86000 -- (-897.722) [-892.451] (-892.668) (-895.902) * (-891.905) (-892.648) [-892.149] (-892.378) -- 0:01:03
86500 -- (-895.471) [-891.480] (-892.032) (-898.701) * (-891.647) (-894.817) [-894.798] (-897.750) -- 0:01:03
87000 -- (-893.830) (-893.700) (-891.587) [-895.696] * (-892.332) (-898.447) (-891.565) [-893.046] -- 0:01:02
87500 -- [-892.396] (-893.998) (-892.383) (-894.746) * (-892.933) (-897.501) (-892.610) [-893.052] -- 0:01:02
88000 -- (-893.217) (-892.412) (-892.759) [-896.860] * (-893.268) [-893.092] (-893.444) (-892.587) -- 0:01:02
88500 -- (-895.806) [-893.206] (-894.022) (-897.628) * [-892.756] (-894.220) (-895.694) (-893.179) -- 0:01:01
89000 -- [-897.089] (-891.201) (-891.461) (-897.859) * (-891.849) [-896.016] (-894.518) (-891.625) -- 0:01:01
89500 -- [-896.485] (-893.678) (-894.494) (-897.756) * (-894.491) (-892.356) (-895.019) [-891.986] -- 0:01:01
90000 -- (-893.590) (-892.584) [-892.160] (-896.377) * [-891.602] (-895.001) (-896.806) (-891.916) -- 0:01:00
Average standard deviation of split frequencies: 0.023397
90500 -- (-893.606) [-893.641] (-892.803) (-895.673) * (-892.552) [-892.318] (-894.055) (-892.864) -- 0:01:00
91000 -- (-893.441) [-895.093] (-892.624) (-894.898) * (-892.095) (-894.806) [-893.351] (-892.757) -- 0:00:59
91500 -- (-898.535) [-892.452] (-891.942) (-895.378) * (-898.043) [-892.585] (-894.615) (-893.256) -- 0:00:59
92000 -- (-893.345) (-893.031) (-892.684) [-894.083] * (-893.529) (-895.438) [-893.419] (-895.390) -- 0:00:59
92500 -- (-891.593) (-892.836) [-891.922] (-896.270) * (-893.392) (-894.722) (-893.625) [-891.254] -- 0:00:58
93000 -- (-894.341) (-896.719) (-891.792) [-895.803] * [-893.136] (-894.739) (-892.749) (-891.519) -- 0:00:58
93500 -- [-893.360] (-893.662) (-894.737) (-895.830) * (-892.558) [-894.857] (-894.225) (-893.825) -- 0:00:58
94000 -- (-891.492) (-897.109) (-893.565) [-893.609] * (-892.373) (-899.103) (-893.948) [-896.121] -- 0:00:57
94500 -- (-892.174) [-892.589] (-891.814) (-893.989) * (-893.165) (-896.970) (-894.956) [-897.592] -- 0:00:57
95000 -- (-894.457) (-891.201) (-892.292) [-893.745] * [-893.638] (-896.773) (-896.649) (-894.491) -- 0:00:57
Average standard deviation of split frequencies: 0.024841
95500 -- (-891.746) [-891.790] (-892.038) (-895.684) * (-893.402) (-894.306) [-894.461] (-893.570) -- 0:00:56
96000 -- (-893.636) (-894.223) (-893.538) [-893.265] * [-894.238] (-896.306) (-894.408) (-893.407) -- 0:00:56
96500 -- (-895.895) (-892.162) [-894.261] (-893.963) * (-892.446) [-898.897] (-896.805) (-893.317) -- 0:00:56
97000 -- (-894.248) (-892.373) (-893.560) [-894.486] * (-893.585) (-900.322) (-895.296) [-894.459] -- 0:00:55
97500 -- (-893.541) (-894.009) [-892.821] (-896.299) * (-892.656) (-895.795) (-892.695) [-891.847] -- 0:00:55
98000 -- (-893.177) [-895.463] (-891.864) (-895.538) * (-897.323) (-892.258) [-891.948] (-891.955) -- 0:00:55
98500 -- (-891.958) [-897.152] (-892.141) (-896.732) * (-893.832) (-895.986) [-892.163] (-893.872) -- 0:00:54
99000 -- (-892.679) (-892.911) (-892.089) [-895.053] * [-894.124] (-897.996) (-895.326) (-892.863) -- 0:00:54
99500 -- (-893.248) (-896.528) [-895.275] (-892.911) * [-896.692] (-895.632) (-892.308) (-900.671) -- 0:00:54
100000 -- (-892.544) [-892.563] (-892.350) (-891.786) * (-895.207) [-892.494] (-892.247) (-897.745) -- 0:00:54
Average standard deviation of split frequencies: 0.023154
100500 -- (-893.440) (-893.247) [-892.379] (-894.204) * (-895.428) (-892.209) (-893.551) [-892.380] -- 0:01:02
101000 -- (-893.235) (-895.220) [-891.186] (-892.260) * (-895.852) [-893.532] (-892.277) (-891.174) -- 0:01:02
101500 -- (-894.755) (-898.711) [-893.831] (-892.934) * (-897.360) (-893.415) [-893.239] (-892.542) -- 0:01:01
102000 -- (-892.995) (-896.894) (-893.167) [-892.225] * (-896.234) (-895.903) [-891.629] (-891.794) -- 0:01:01
102500 -- (-893.230) (-892.024) (-896.347) [-893.434] * (-897.293) [-893.285] (-891.958) (-892.528) -- 0:01:01
103000 -- (-899.018) (-893.495) (-896.975) [-893.485] * (-895.523) (-892.276) (-895.853) [-891.772] -- 0:01:00
103500 -- [-891.313] (-896.463) (-895.191) (-893.805) * (-892.780) (-892.325) (-892.184) [-891.123] -- 0:01:00
104000 -- [-891.621] (-899.309) (-893.743) (-894.286) * (-892.771) (-891.790) (-891.658) [-893.092] -- 0:01:00
104500 -- [-894.689] (-894.655) (-896.725) (-894.805) * (-893.340) (-893.134) [-891.850] (-893.907) -- 0:00:59
105000 -- [-893.096] (-894.547) (-893.621) (-893.298) * (-892.008) (-892.121) [-894.343] (-893.962) -- 0:00:59
Average standard deviation of split frequencies: 0.019765
105500 -- (-893.013) (-892.980) [-894.580] (-893.842) * (-892.506) [-896.222] (-895.890) (-898.752) -- 0:00:59
106000 -- (-893.446) (-892.986) (-896.289) [-896.347] * [-892.325] (-896.064) (-895.499) (-891.031) -- 0:00:59
106500 -- [-894.799] (-892.343) (-897.397) (-892.978) * (-891.928) [-891.952] (-893.365) (-890.970) -- 0:00:58
107000 -- (-892.991) (-893.979) (-891.613) [-891.455] * [-895.214] (-896.001) (-891.901) (-891.494) -- 0:00:58
107500 -- (-893.826) (-893.124) [-892.177] (-892.916) * (-892.827) (-894.162) (-891.789) [-893.841] -- 0:00:58
108000 -- (-892.292) (-892.971) (-891.869) [-896.155] * (-895.453) [-894.151] (-894.193) (-892.424) -- 0:00:57
108500 -- (-895.711) (-901.594) (-892.478) [-893.537] * (-894.044) [-895.072] (-893.843) (-892.175) -- 0:00:57
109000 -- (-895.770) (-893.422) [-893.248] (-894.445) * (-892.526) (-893.453) (-892.113) [-895.184] -- 0:00:57
109500 -- (-892.919) [-892.549] (-892.868) (-895.224) * (-893.003) (-898.257) (-893.871) [-894.221] -- 0:00:56
110000 -- (-892.914) (-891.271) [-892.964] (-894.243) * [-892.592] (-891.887) (-895.805) (-891.772) -- 0:00:56
Average standard deviation of split frequencies: 0.017749
110500 -- (-893.278) (-891.271) [-895.001] (-898.265) * (-895.231) (-892.088) [-892.452] (-891.116) -- 0:00:56
111000 -- (-893.316) [-891.152] (-893.369) (-899.300) * (-892.423) (-892.934) (-891.524) [-891.101] -- 0:00:56
111500 -- (-893.434) [-891.180] (-893.604) (-895.447) * [-892.443] (-893.654) (-892.027) (-892.033) -- 0:00:55
112000 -- [-891.255] (-891.818) (-899.382) (-892.158) * (-891.508) (-893.299) (-896.038) [-891.915] -- 0:00:55
112500 -- (-894.066) [-893.233] (-893.466) (-891.026) * [-892.141] (-893.279) (-895.074) (-891.535) -- 0:00:55
113000 -- [-893.900] (-892.021) (-893.154) (-893.136) * [-892.057] (-894.028) (-893.782) (-894.716) -- 0:00:54
113500 -- (-893.873) [-893.113] (-892.793) (-892.085) * (-894.127) (-894.120) (-897.731) [-894.957] -- 0:00:54
114000 -- (-894.296) [-894.502] (-893.302) (-893.100) * (-896.339) [-893.417] (-895.279) (-894.140) -- 0:00:54
114500 -- (-892.125) [-895.048] (-893.621) (-892.273) * [-893.884] (-894.117) (-895.186) (-893.073) -- 0:00:54
115000 -- [-892.448] (-892.751) (-893.066) (-893.091) * (-892.680) [-893.742] (-894.131) (-892.967) -- 0:00:53
Average standard deviation of split frequencies: 0.021448
115500 -- (-891.661) (-892.122) [-893.721] (-892.483) * [-894.085] (-893.101) (-897.344) (-895.225) -- 0:00:53
116000 -- [-898.188] (-892.460) (-892.615) (-894.602) * (-895.453) [-894.275] (-894.022) (-893.359) -- 0:00:53
116500 -- (-893.583) (-893.361) [-894.297] (-898.417) * (-895.744) (-893.941) [-894.390] (-895.366) -- 0:00:53
117000 -- (-891.231) (-896.556) (-896.305) [-897.016] * (-896.669) (-894.263) [-894.812] (-896.897) -- 0:01:00
117500 -- (-894.900) (-895.140) [-892.666] (-895.040) * (-897.964) (-899.001) (-895.056) [-894.407] -- 0:01:00
118000 -- [-892.808] (-892.479) (-894.459) (-893.557) * [-892.806] (-895.546) (-894.447) (-894.486) -- 0:00:59
118500 -- [-896.561] (-894.037) (-892.842) (-894.148) * (-894.010) (-894.918) (-893.702) [-891.630] -- 0:00:59
119000 -- [-897.944] (-892.558) (-893.449) (-895.618) * (-893.550) (-891.811) [-895.743] (-892.754) -- 0:00:59
119500 -- (-899.565) [-893.079] (-892.870) (-898.586) * (-892.562) (-891.670) (-894.527) [-892.682] -- 0:00:58
120000 -- (-893.204) (-891.633) [-893.629] (-898.628) * (-894.128) [-892.808] (-892.917) (-892.694) -- 0:00:58
Average standard deviation of split frequencies: 0.023440
120500 -- [-894.603] (-894.786) (-893.354) (-891.960) * (-892.004) (-892.948) (-892.275) [-892.156] -- 0:00:58
121000 -- (-893.574) (-901.305) [-894.054] (-891.780) * (-892.391) [-893.209] (-895.129) (-892.448) -- 0:00:58
121500 -- (-895.090) (-899.830) (-891.862) [-897.327] * (-891.905) (-893.847) [-893.835] (-892.245) -- 0:00:57
122000 -- (-892.770) (-904.033) [-892.465] (-893.709) * [-891.199] (-897.134) (-892.485) (-892.278) -- 0:00:57
122500 -- [-892.814] (-894.004) (-892.465) (-891.630) * (-890.935) (-896.275) (-893.522) [-891.494] -- 0:00:57
123000 -- (-894.454) (-893.325) [-891.998] (-892.169) * [-890.948] (-896.732) (-897.113) (-892.705) -- 0:00:57
123500 -- [-891.134] (-895.064) (-891.983) (-891.913) * [-890.964] (-892.307) (-891.623) (-892.554) -- 0:00:56
124000 -- (-892.538) (-893.119) (-892.130) [-899.679] * (-895.100) (-893.687) [-894.661] (-895.293) -- 0:00:56
124500 -- (-891.861) [-893.131] (-891.826) (-892.756) * (-892.862) [-892.936] (-895.515) (-895.744) -- 0:00:56
125000 -- (-893.848) [-892.521] (-894.629) (-892.971) * (-894.250) (-893.316) (-896.225) [-896.033] -- 0:00:56
Average standard deviation of split frequencies: 0.020161
125500 -- (-893.782) (-891.740) [-892.315] (-894.062) * (-893.731) [-893.369] (-892.881) (-892.173) -- 0:00:55
126000 -- (-899.894) (-894.506) (-896.996) [-892.941] * [-894.115] (-895.665) (-897.275) (-892.610) -- 0:00:55
126500 -- (-891.536) [-894.065] (-893.183) (-892.275) * (-893.868) (-893.251) [-892.475] (-894.618) -- 0:00:55
127000 -- (-891.807) (-892.596) [-892.023] (-893.076) * (-896.227) [-891.737] (-893.573) (-892.859) -- 0:00:54
127500 -- (-891.355) (-900.104) [-893.256] (-893.219) * (-894.510) [-892.781] (-891.544) (-892.262) -- 0:00:54
128000 -- (-893.005) (-893.697) [-893.706] (-891.765) * (-893.352) (-894.928) [-893.411] (-891.817) -- 0:00:54
128500 -- [-898.033] (-894.067) (-895.717) (-896.890) * (-897.774) (-897.641) [-892.381] (-894.521) -- 0:00:54
129000 -- (-892.047) (-893.381) (-894.494) [-891.360] * (-895.913) (-892.251) (-891.917) [-892.808] -- 0:00:54
129500 -- [-892.876] (-895.991) (-892.736) (-894.396) * (-893.871) [-894.949] (-892.003) (-892.782) -- 0:00:53
130000 -- (-891.731) (-896.557) (-892.206) [-892.242] * (-895.511) [-891.386] (-892.478) (-892.295) -- 0:00:53
Average standard deviation of split frequencies: 0.022247
130500 -- [-891.790] (-895.148) (-896.021) (-892.028) * (-895.359) [-892.319] (-891.630) (-893.558) -- 0:00:53
131000 -- (-891.778) (-891.616) [-893.880] (-893.156) * (-893.811) [-893.818] (-898.844) (-894.504) -- 0:00:53
131500 -- (-891.723) (-891.979) [-895.313] (-892.947) * [-891.617] (-895.535) (-897.557) (-893.673) -- 0:00:52
132000 -- [-891.914] (-894.493) (-893.103) (-892.000) * [-893.792] (-894.691) (-893.982) (-893.891) -- 0:00:52
132500 -- (-892.369) (-892.801) [-893.878] (-895.604) * (-893.173) (-894.723) [-896.113] (-893.160) -- 0:00:52
133000 -- (-892.286) (-892.342) [-891.712] (-893.211) * (-891.977) (-893.044) (-893.442) [-893.452] -- 0:00:52
133500 -- (-894.706) (-891.154) [-894.504] (-891.931) * (-891.511) [-892.891] (-892.142) (-893.515) -- 0:00:58
134000 -- (-894.983) (-892.248) (-893.436) [-892.096] * (-895.972) (-894.903) [-892.334] (-893.655) -- 0:00:58
134500 -- (-897.214) (-892.863) (-896.712) [-895.442] * [-891.773] (-895.026) (-891.683) (-893.195) -- 0:00:57
135000 -- (-897.022) (-891.037) (-893.427) [-897.659] * (-892.235) [-894.805] (-893.330) (-893.260) -- 0:00:57
Average standard deviation of split frequencies: 0.023448
135500 -- (-895.281) (-893.298) [-891.977] (-893.572) * [-891.091] (-895.375) (-895.246) (-893.223) -- 0:00:57
136000 -- (-892.566) (-891.556) (-891.439) [-892.452] * (-893.722) (-896.455) (-891.975) [-897.537] -- 0:00:57
136500 -- (-892.491) [-892.937] (-891.756) (-896.638) * (-892.425) [-892.350] (-894.380) (-892.260) -- 0:00:56
137000 -- [-893.558] (-899.134) (-895.043) (-894.134) * [-895.447] (-894.011) (-894.634) (-894.056) -- 0:00:56
137500 -- (-892.188) (-892.389) (-895.357) [-896.150] * (-895.792) [-893.539] (-894.627) (-899.790) -- 0:00:56
138000 -- (-893.237) [-892.177] (-892.476) (-896.246) * (-891.655) [-894.206] (-894.857) (-897.283) -- 0:00:56
138500 -- (-892.739) (-894.907) [-897.513] (-894.565) * (-895.458) [-894.154] (-893.108) (-892.384) -- 0:00:55
139000 -- (-892.707) [-892.360] (-893.151) (-896.692) * [-891.546] (-895.802) (-894.009) (-899.069) -- 0:00:55
139500 -- (-897.193) (-891.598) [-895.519] (-895.308) * (-894.289) (-895.763) (-896.917) [-892.396] -- 0:00:55
140000 -- [-897.226] (-893.537) (-895.147) (-892.805) * [-892.349] (-897.727) (-898.228) (-892.319) -- 0:00:55
Average standard deviation of split frequencies: 0.022473
140500 -- (-892.008) (-893.937) [-892.304] (-893.017) * (-893.781) [-894.105] (-899.148) (-893.036) -- 0:00:55
141000 -- (-891.534) (-898.276) [-892.399] (-892.984) * (-896.924) (-899.634) [-895.394] (-893.117) -- 0:00:54
141500 -- (-892.307) (-896.348) [-891.520] (-892.040) * (-894.990) (-893.930) (-898.222) [-894.034] -- 0:00:54
142000 -- (-891.647) (-894.476) [-892.707] (-893.709) * (-894.170) [-891.379] (-895.930) (-894.014) -- 0:00:54
142500 -- [-893.344] (-891.508) (-892.987) (-896.112) * (-893.137) (-893.681) [-892.724] (-893.630) -- 0:00:54
143000 -- (-893.943) (-891.844) [-892.758] (-903.117) * (-893.086) (-896.498) [-892.187] (-893.381) -- 0:00:53
143500 -- (-892.926) (-891.563) [-892.910] (-895.224) * [-893.458] (-895.910) (-891.686) (-896.681) -- 0:00:53
144000 -- [-894.378] (-892.074) (-892.164) (-895.588) * (-894.892) (-892.045) (-891.949) [-892.225] -- 0:00:53
144500 -- (-893.897) (-893.212) [-898.385] (-893.278) * [-892.485] (-893.027) (-892.529) (-892.070) -- 0:00:53
145000 -- (-893.282) (-893.669) [-893.779] (-897.390) * (-892.159) (-891.793) (-892.272) [-891.727] -- 0:00:53
Average standard deviation of split frequencies: 0.022222
145500 -- [-893.766] (-893.278) (-894.271) (-897.893) * (-893.111) (-892.561) (-893.333) [-892.102] -- 0:00:52
146000 -- [-893.313] (-892.505) (-895.159) (-895.676) * [-895.419] (-893.061) (-894.903) (-892.597) -- 0:00:52
146500 -- [-892.777] (-897.553) (-896.737) (-893.645) * (-893.309) [-893.076] (-895.748) (-892.711) -- 0:00:52
147000 -- (-892.731) (-896.712) (-896.943) [-892.628] * [-894.637] (-892.162) (-892.702) (-892.944) -- 0:00:52
147500 -- (-894.158) [-893.479] (-893.418) (-893.888) * (-891.432) (-891.357) (-893.890) [-893.795] -- 0:00:52
148000 -- [-893.159] (-897.237) (-894.664) (-891.846) * (-891.269) (-894.032) (-893.115) [-892.416] -- 0:00:51
148500 -- (-893.587) [-894.065] (-891.501) (-895.707) * (-891.273) (-892.816) [-892.676] (-894.743) -- 0:00:51
149000 -- (-893.155) (-896.281) [-892.480] (-892.687) * [-891.198] (-896.721) (-892.040) (-894.099) -- 0:00:51
149500 -- (-894.281) (-897.097) (-895.359) [-891.901] * [-893.298] (-894.673) (-894.898) (-894.172) -- 0:00:51
150000 -- [-892.955] (-893.472) (-894.572) (-891.983) * [-893.040] (-891.582) (-894.007) (-896.799) -- 0:00:56
Average standard deviation of split frequencies: 0.023075
150500 -- (-893.567) (-892.979) [-894.245] (-896.466) * (-896.325) (-893.015) (-891.431) [-893.584] -- 0:00:56
151000 -- (-891.611) (-895.769) [-892.619] (-897.325) * [-893.355] (-893.489) (-891.198) (-894.165) -- 0:00:56
151500 -- (-892.336) (-893.638) [-891.559] (-896.698) * [-892.655] (-892.837) (-892.493) (-895.203) -- 0:00:56
152000 -- [-892.200] (-893.928) (-893.320) (-895.759) * (-891.602) (-893.994) [-891.874] (-894.603) -- 0:00:55
152500 -- [-891.839] (-893.239) (-893.811) (-892.758) * [-891.620] (-892.830) (-892.848) (-893.823) -- 0:00:55
153000 -- (-892.664) (-894.602) (-893.220) [-894.377] * (-891.761) (-892.168) (-893.000) [-891.451] -- 0:00:55
153500 -- (-895.360) [-892.471] (-893.393) (-893.163) * (-891.612) (-892.901) (-894.627) [-894.393] -- 0:00:55
154000 -- (-896.602) [-891.632] (-892.573) (-892.655) * (-891.598) (-894.364) [-896.481] (-892.850) -- 0:00:54
154500 -- (-895.083) [-891.650] (-894.074) (-891.338) * (-892.324) (-893.000) (-892.965) [-893.819] -- 0:00:54
155000 -- (-897.735) (-893.563) [-895.179] (-891.946) * (-895.935) [-894.753] (-891.743) (-897.306) -- 0:00:54
Average standard deviation of split frequencies: 0.023997
155500 -- (-894.014) (-893.704) [-892.892] (-893.236) * (-898.820) [-891.960] (-893.324) (-897.111) -- 0:00:54
156000 -- (-892.496) [-892.830] (-893.251) (-894.921) * (-893.825) [-893.621] (-894.615) (-893.155) -- 0:00:54
156500 -- [-891.834] (-892.912) (-895.406) (-895.607) * (-892.964) (-893.530) (-892.799) [-895.375] -- 0:00:53
157000 -- (-894.873) (-899.340) [-895.956] (-894.055) * [-891.735] (-892.684) (-894.315) (-891.931) -- 0:00:53
157500 -- [-893.746] (-900.642) (-896.373) (-894.838) * (-892.598) (-893.353) (-892.142) [-891.437] -- 0:00:53
158000 -- [-897.940] (-893.498) (-892.729) (-895.845) * [-892.186] (-895.725) (-896.195) (-892.667) -- 0:00:53
158500 -- (-893.750) (-893.484) [-892.723] (-892.498) * (-894.329) [-893.068] (-892.639) (-891.540) -- 0:00:53
159000 -- (-892.857) (-894.948) [-891.639] (-892.267) * (-895.644) [-893.295] (-891.664) (-894.809) -- 0:00:52
159500 -- [-891.365] (-897.703) (-891.480) (-891.394) * (-897.442) [-894.241] (-892.720) (-892.704) -- 0:00:52
160000 -- (-894.385) [-894.363] (-891.186) (-894.235) * (-897.189) (-892.202) (-894.352) [-892.202] -- 0:00:52
Average standard deviation of split frequencies: 0.025123
160500 -- (-893.153) (-895.538) [-891.065] (-896.582) * [-896.150] (-892.387) (-894.420) (-893.302) -- 0:00:52
161000 -- (-895.825) (-895.057) (-892.142) [-897.719] * [-896.407] (-894.735) (-893.629) (-896.726) -- 0:00:52
161500 -- [-893.653] (-893.903) (-892.627) (-893.511) * (-894.146) (-893.119) (-892.030) [-892.382] -- 0:00:51
162000 -- (-893.318) (-893.388) (-891.910) [-898.733] * (-891.434) (-893.407) [-893.059] (-896.785) -- 0:00:51
162500 -- (-892.349) (-893.288) (-891.686) [-892.605] * (-891.576) [-891.506] (-894.413) (-898.374) -- 0:00:51
163000 -- (-891.821) (-894.093) [-893.771] (-892.443) * (-892.350) [-892.053] (-895.913) (-897.115) -- 0:00:51
163500 -- (-894.729) (-894.465) (-892.159) [-891.932] * (-892.366) (-892.267) (-893.453) [-892.145] -- 0:00:51
164000 -- (-894.225) (-892.896) [-892.697] (-895.609) * (-893.863) (-895.469) (-895.762) [-895.810] -- 0:00:50
164500 -- (-894.855) (-897.699) [-893.102] (-894.514) * (-899.330) (-892.620) [-895.673] (-892.625) -- 0:00:50
165000 -- (-896.058) (-892.741) [-892.435] (-891.393) * (-893.038) (-892.459) (-896.535) [-892.080] -- 0:00:50
Average standard deviation of split frequencies: 0.024611
165500 -- (-895.593) (-892.553) (-892.029) [-894.554] * (-892.549) (-893.546) (-895.298) [-892.860] -- 0:00:50
166000 -- (-894.708) (-892.860) [-892.614] (-894.721) * (-894.742) (-891.392) [-891.335] (-892.991) -- 0:00:50
166500 -- (-893.543) (-892.787) [-893.475] (-891.885) * [-894.511] (-893.852) (-892.437) (-896.396) -- 0:00:55
167000 -- (-893.504) (-893.058) [-895.109] (-891.901) * (-893.221) (-894.663) [-891.913] (-892.018) -- 0:00:54
167500 -- [-892.843] (-892.647) (-893.747) (-895.908) * (-895.359) (-894.954) (-893.270) [-891.761] -- 0:00:54
168000 -- (-892.411) (-892.769) (-895.035) [-894.075] * (-892.549) (-897.535) [-897.287] (-893.119) -- 0:00:54
168500 -- [-892.023] (-893.014) (-898.546) (-891.754) * (-892.997) (-897.048) (-903.061) [-892.444] -- 0:00:54
169000 -- [-891.910] (-894.552) (-895.358) (-892.949) * (-894.365) (-896.905) (-895.944) [-895.019] -- 0:00:54
169500 -- (-894.306) (-893.729) [-893.798] (-892.950) * (-894.454) (-891.898) [-894.449] (-893.703) -- 0:00:53
170000 -- (-893.143) (-893.393) (-892.064) [-896.572] * [-895.825] (-893.229) (-891.798) (-896.099) -- 0:00:53
Average standard deviation of split frequencies: 0.022097
170500 -- [-894.067] (-894.602) (-891.175) (-894.152) * (-893.018) (-894.062) [-892.058] (-894.652) -- 0:00:53
171000 -- (-893.653) (-896.315) [-892.029] (-893.781) * [-897.345] (-897.762) (-894.738) (-893.040) -- 0:00:53
171500 -- [-894.281] (-892.699) (-892.072) (-895.554) * (-895.882) (-891.977) (-895.824) [-893.837] -- 0:00:53
172000 -- [-891.514] (-891.840) (-892.043) (-895.135) * (-892.441) (-894.847) [-892.832] (-894.310) -- 0:00:52
172500 -- [-892.771] (-894.496) (-896.016) (-891.969) * (-893.341) (-891.880) [-891.012] (-894.757) -- 0:00:52
173000 -- (-894.981) (-893.080) [-894.266] (-899.043) * (-893.900) [-894.770] (-893.762) (-900.052) -- 0:00:52
173500 -- (-897.650) [-893.440] (-892.417) (-891.822) * (-895.720) (-894.442) (-893.995) [-893.169] -- 0:00:52
174000 -- (-895.123) (-892.935) [-892.420] (-891.977) * (-894.311) [-893.498] (-893.324) (-894.041) -- 0:00:52
174500 -- (-892.285) (-891.989) (-894.760) [-891.942] * (-894.832) (-892.685) (-893.403) [-892.447] -- 0:00:52
175000 -- (-895.941) [-892.181] (-892.804) (-892.813) * (-893.816) (-892.333) (-893.113) [-895.317] -- 0:00:51
Average standard deviation of split frequencies: 0.019586
175500 -- [-893.790] (-893.510) (-894.530) (-891.526) * (-897.853) (-892.283) (-892.501) [-894.691] -- 0:00:51
176000 -- (-891.694) (-893.308) (-894.384) [-892.971] * (-894.852) (-892.838) [-893.091] (-896.664) -- 0:00:51
176500 -- [-892.441] (-893.235) (-894.759) (-891.120) * [-895.457] (-892.980) (-892.413) (-893.807) -- 0:00:51
177000 -- [-891.746] (-893.582) (-892.029) (-891.120) * (-894.085) (-894.937) [-893.701] (-895.464) -- 0:00:51
177500 -- (-891.557) (-891.248) (-894.016) [-892.597] * [-893.687] (-894.543) (-892.185) (-891.981) -- 0:00:50
178000 -- (-893.827) (-893.744) [-891.565] (-896.308) * [-892.493] (-895.459) (-893.896) (-895.275) -- 0:00:50
178500 -- [-895.227] (-893.947) (-893.003) (-893.940) * (-892.265) (-894.043) (-892.910) [-894.863] -- 0:00:50
179000 -- [-894.178] (-894.210) (-895.057) (-892.490) * (-893.724) (-893.937) [-895.817] (-893.805) -- 0:00:50
179500 -- [-893.646] (-893.064) (-898.352) (-891.949) * (-893.383) (-891.971) [-895.314] (-896.097) -- 0:00:50
180000 -- (-892.919) (-895.611) (-897.805) [-893.376] * (-891.616) (-893.303) (-893.255) [-893.905] -- 0:00:50
Average standard deviation of split frequencies: 0.018428
180500 -- (-894.342) [-891.918] (-894.331) (-891.442) * (-895.397) [-892.524] (-894.338) (-891.357) -- 0:00:49
181000 -- (-892.673) [-892.340] (-896.533) (-893.135) * (-893.103) (-895.083) [-900.193] (-891.358) -- 0:00:49
181500 -- [-893.596] (-894.600) (-893.664) (-901.375) * (-893.993) [-895.625] (-895.404) (-895.583) -- 0:00:49
182000 -- (-892.925) [-892.682] (-900.146) (-892.149) * (-893.794) [-892.671] (-894.121) (-891.235) -- 0:00:49
182500 -- (-892.970) [-896.045] (-894.962) (-894.817) * [-894.101] (-892.433) (-896.674) (-892.617) -- 0:00:49
183000 -- (-894.688) (-898.872) [-892.808] (-895.134) * (-894.019) (-892.899) [-893.467] (-891.583) -- 0:00:53
183500 -- (-892.584) (-893.643) [-892.636] (-892.200) * (-895.557) (-894.117) [-893.135] (-892.902) -- 0:00:53
184000 -- [-893.050] (-894.569) (-892.646) (-892.734) * (-897.264) (-892.034) (-893.636) [-894.723] -- 0:00:53
184500 -- [-892.305] (-892.715) (-892.198) (-892.595) * (-893.969) [-893.566] (-894.772) (-898.983) -- 0:00:53
185000 -- (-893.555) (-895.851) [-894.459] (-893.488) * (-894.687) (-892.419) [-894.578] (-891.339) -- 0:00:52
Average standard deviation of split frequencies: 0.018058
185500 -- [-893.155] (-892.484) (-891.374) (-893.297) * (-893.544) (-892.837) [-895.623] (-891.339) -- 0:00:52
186000 -- (-891.762) (-890.901) (-891.839) [-895.236] * (-895.524) [-893.764] (-896.848) (-892.362) -- 0:00:52
186500 -- (-895.661) (-892.779) (-893.376) [-894.362] * (-896.936) (-895.552) [-894.264] (-891.545) -- 0:00:52
187000 -- [-892.229] (-893.977) (-893.553) (-893.353) * (-893.707) (-893.093) [-896.877] (-891.943) -- 0:00:52
187500 -- (-891.658) (-893.115) [-893.691] (-894.223) * (-894.554) (-894.358) [-895.779] (-892.848) -- 0:00:52
188000 -- (-891.694) (-893.694) [-891.357] (-892.630) * (-896.466) [-893.357] (-894.026) (-893.595) -- 0:00:51
188500 -- (-891.806) (-893.881) (-894.626) [-893.902] * (-895.662) [-894.297] (-895.473) (-904.269) -- 0:00:51
189000 -- (-892.741) [-893.253] (-894.331) (-892.765) * [-894.828] (-894.257) (-894.436) (-901.940) -- 0:00:51
189500 -- (-897.814) (-894.865) [-892.243] (-892.107) * (-895.238) [-895.822] (-892.828) (-893.009) -- 0:00:51
190000 -- (-893.756) (-897.649) [-892.805] (-892.383) * (-892.907) (-892.865) [-892.335] (-891.400) -- 0:00:51
Average standard deviation of split frequencies: 0.019316
190500 -- (-892.279) (-893.686) [-892.286] (-893.228) * (-891.720) [-891.126] (-892.071) (-900.168) -- 0:00:50
191000 -- (-892.586) [-895.890] (-891.867) (-891.324) * (-895.760) [-891.918] (-892.809) (-897.003) -- 0:00:50
191500 -- (-894.764) [-891.536] (-891.635) (-892.830) * (-892.634) [-892.866] (-893.799) (-900.006) -- 0:00:50
192000 -- [-897.051] (-892.165) (-892.656) (-893.716) * (-892.546) [-893.265] (-895.466) (-892.997) -- 0:00:50
192500 -- (-894.064) (-894.729) (-892.547) [-891.470] * (-894.037) (-892.482) (-894.891) [-891.937] -- 0:00:50
193000 -- (-893.478) (-895.886) [-891.562] (-892.779) * [-893.906] (-891.309) (-891.394) (-892.391) -- 0:00:50
193500 -- (-893.699) (-892.478) [-893.004] (-891.533) * (-893.151) (-892.700) [-891.968] (-892.780) -- 0:00:50
194000 -- (-891.933) (-894.228) [-893.938] (-894.089) * [-896.474] (-894.206) (-895.772) (-892.901) -- 0:00:49
194500 -- (-891.750) (-893.153) [-894.567] (-893.187) * (-893.377) (-893.817) (-894.184) [-891.591] -- 0:00:49
195000 -- [-892.759] (-892.572) (-894.290) (-891.928) * (-892.165) [-892.739] (-893.176) (-891.818) -- 0:00:49
Average standard deviation of split frequencies: 0.017437
195500 -- (-893.809) (-893.307) [-895.680] (-891.836) * (-894.676) (-892.534) (-893.174) [-892.894] -- 0:00:49
196000 -- [-896.171] (-894.033) (-892.132) (-893.472) * [-891.865] (-893.360) (-892.533) (-892.976) -- 0:00:49
196500 -- [-892.990] (-891.892) (-891.893) (-893.028) * [-893.065] (-893.692) (-894.486) (-893.488) -- 0:00:49
197000 -- [-892.216] (-892.560) (-891.828) (-894.520) * (-898.895) (-893.523) [-897.371] (-892.849) -- 0:00:48
197500 -- [-893.124] (-895.422) (-892.914) (-893.444) * (-893.314) (-891.694) (-893.240) [-898.438] -- 0:00:48
198000 -- [-894.579] (-898.128) (-895.346) (-897.087) * (-895.752) (-893.201) [-895.954] (-892.734) -- 0:00:48
198500 -- (-891.486) [-893.481] (-895.428) (-894.906) * (-895.320) (-895.489) (-895.141) [-894.507] -- 0:00:48
199000 -- (-892.280) (-894.983) [-892.674] (-894.795) * (-895.332) (-892.554) (-896.478) [-896.146] -- 0:00:48
199500 -- (-891.817) [-896.401] (-896.781) (-894.870) * (-893.100) [-892.994] (-895.063) (-894.273) -- 0:00:52
200000 -- (-894.674) [-891.892] (-895.742) (-892.785) * (-893.535) (-895.819) [-893.402] (-897.855) -- 0:00:51
Average standard deviation of split frequencies: 0.017032
200500 -- [-894.194] (-893.573) (-893.084) (-894.218) * (-892.379) [-894.026] (-891.784) (-892.132) -- 0:00:51
201000 -- [-894.080] (-893.951) (-892.309) (-894.290) * (-892.877) [-893.975] (-893.589) (-893.794) -- 0:00:51
201500 -- (-892.219) [-895.138] (-893.607) (-892.906) * [-895.992] (-893.146) (-893.810) (-895.941) -- 0:00:51
202000 -- (-893.293) [-895.540] (-893.681) (-893.621) * (-894.263) (-891.156) [-893.130] (-900.449) -- 0:00:51
202500 -- [-892.811] (-898.727) (-895.215) (-892.392) * [-892.631] (-892.548) (-892.832) (-897.926) -- 0:00:51
203000 -- (-892.119) (-893.230) (-899.551) [-893.172] * (-891.861) [-896.918] (-893.728) (-891.256) -- 0:00:51
203500 -- [-891.932] (-898.320) (-892.671) (-892.416) * [-892.745] (-894.448) (-895.776) (-891.283) -- 0:00:50
204000 -- (-895.870) (-891.979) (-893.984) [-892.397] * [-893.586] (-893.640) (-893.917) (-892.623) -- 0:00:50
204500 -- [-898.501] (-893.201) (-898.344) (-891.504) * [-892.429] (-894.087) (-892.178) (-898.649) -- 0:00:50
205000 -- (-898.355) (-893.533) (-892.571) [-896.505] * (-894.430) (-892.631) (-894.566) [-894.119] -- 0:00:50
Average standard deviation of split frequencies: 0.016877
205500 -- (-892.781) [-891.586] (-892.531) (-894.711) * (-896.422) [-895.271] (-892.565) (-893.166) -- 0:00:50
206000 -- (-894.363) [-892.631] (-891.648) (-894.267) * (-893.826) (-892.055) [-892.163] (-893.752) -- 0:00:50
206500 -- (-893.301) (-897.433) [-894.802] (-894.599) * (-894.328) [-892.240] (-891.350) (-892.982) -- 0:00:49
207000 -- (-891.490) (-897.723) [-892.556] (-892.606) * [-893.264] (-893.331) (-895.448) (-893.728) -- 0:00:49
207500 -- (-897.183) [-892.923] (-894.061) (-893.501) * (-899.742) (-893.349) [-894.882] (-894.973) -- 0:00:49
208000 -- (-892.379) (-894.103) [-891.470] (-892.437) * [-893.021] (-893.895) (-894.463) (-897.755) -- 0:00:49
208500 -- [-891.361] (-891.105) (-895.494) (-892.068) * (-893.988) (-894.775) (-894.820) [-893.414] -- 0:00:49
209000 -- (-891.623) (-892.214) (-898.256) [-892.748] * (-898.561) (-896.580) (-892.519) [-895.645] -- 0:00:49
209500 -- [-892.762] (-898.211) (-895.860) (-895.375) * (-895.494) [-892.673] (-892.612) (-892.023) -- 0:00:49
210000 -- [-894.462] (-895.581) (-892.134) (-896.418) * (-896.643) (-894.830) (-893.355) [-895.908] -- 0:00:48
Average standard deviation of split frequencies: 0.015943
210500 -- [-891.891] (-891.716) (-891.872) (-891.261) * (-895.941) (-896.440) (-892.655) [-893.518] -- 0:00:48
211000 -- (-890.960) (-897.095) [-892.473] (-894.511) * [-895.455] (-895.336) (-891.425) (-896.139) -- 0:00:48
211500 -- (-891.120) (-895.250) [-892.426] (-893.126) * [-897.081] (-892.901) (-897.498) (-893.103) -- 0:00:48
212000 -- (-894.330) (-897.004) [-893.233] (-891.749) * (-893.630) (-895.982) [-893.102] (-896.101) -- 0:00:48
212500 -- (-892.255) [-895.358] (-894.525) (-891.064) * [-892.025] (-893.456) (-895.420) (-895.754) -- 0:00:48
213000 -- [-894.020] (-896.194) (-891.406) (-891.620) * [-893.602] (-891.691) (-893.883) (-893.714) -- 0:00:48
213500 -- [-892.783] (-898.062) (-891.587) (-893.144) * (-892.899) [-892.744] (-897.408) (-893.363) -- 0:00:47
214000 -- (-892.868) (-893.964) (-891.768) [-893.279] * (-892.070) (-891.598) [-893.151] (-892.865) -- 0:00:47
214500 -- (-895.582) [-894.858] (-893.297) (-891.664) * (-893.199) (-892.708) (-892.037) [-895.112] -- 0:00:47
215000 -- (-893.831) (-892.993) (-892.782) [-892.435] * [-893.012] (-894.273) (-894.110) (-891.685) -- 0:00:47
Average standard deviation of split frequencies: 0.017323
215500 -- [-893.883] (-892.816) (-891.461) (-893.820) * (-892.212) (-893.533) (-898.098) [-892.071] -- 0:00:50
216000 -- (-894.152) (-893.325) (-891.886) [-893.015] * (-893.498) (-896.844) [-895.372] (-894.976) -- 0:00:50
216500 -- [-892.345] (-895.921) (-894.422) (-892.615) * (-892.525) (-893.103) (-896.429) [-892.650] -- 0:00:50
217000 -- (-892.433) (-891.540) (-893.013) [-893.112] * (-891.160) (-892.822) (-896.008) [-892.247] -- 0:00:50
217500 -- (-893.332) (-891.595) [-892.986] (-892.662) * (-896.718) [-895.066] (-895.986) (-893.062) -- 0:00:50
218000 -- [-896.000] (-893.853) (-894.315) (-895.059) * (-893.239) [-894.017] (-903.042) (-891.393) -- 0:00:50
218500 -- (-894.677) (-894.590) (-896.143) [-894.245] * (-892.822) [-894.331] (-894.476) (-891.052) -- 0:00:50
219000 -- (-893.706) (-893.564) (-897.068) [-894.759] * [-892.161] (-895.602) (-895.296) (-891.773) -- 0:00:49
219500 -- (-893.096) (-894.899) (-893.342) [-895.355] * (-893.200) (-893.818) (-892.899) [-892.966] -- 0:00:49
220000 -- (-892.681) (-894.662) [-892.601] (-893.275) * (-893.784) [-894.800] (-892.816) (-891.978) -- 0:00:49
Average standard deviation of split frequencies: 0.016948
220500 -- (-891.684) [-892.203] (-893.162) (-893.127) * (-892.013) [-893.359] (-892.579) (-896.164) -- 0:00:49
221000 -- [-893.416] (-892.746) (-894.770) (-893.363) * (-892.606) (-893.781) [-893.724] (-895.258) -- 0:00:49
221500 -- (-891.696) [-891.768] (-892.527) (-893.773) * (-895.100) (-894.869) (-895.117) [-897.469] -- 0:00:49
222000 -- (-893.706) [-892.481] (-894.316) (-892.554) * [-893.103] (-892.330) (-896.914) (-896.688) -- 0:00:49
222500 -- (-893.480) [-894.151] (-894.744) (-895.483) * (-892.210) [-895.478] (-902.488) (-892.416) -- 0:00:48
223000 -- (-893.401) (-894.185) (-893.504) [-895.444] * (-891.480) [-895.591] (-900.615) (-892.963) -- 0:00:48
223500 -- (-895.666) [-895.221] (-894.667) (-894.619) * (-891.608) (-897.869) [-893.137] (-892.867) -- 0:00:48
224000 -- (-895.225) (-893.680) [-895.220] (-896.556) * [-891.239] (-891.815) (-892.706) (-892.306) -- 0:00:48
224500 -- (-892.936) (-893.225) [-895.190] (-891.574) * (-891.729) [-893.844] (-890.887) (-892.309) -- 0:00:48
225000 -- (-894.131) (-901.201) (-891.953) [-896.140] * (-893.917) [-893.857] (-896.030) (-892.658) -- 0:00:48
Average standard deviation of split frequencies: 0.015253
225500 -- [-891.579] (-896.241) (-893.269) (-894.228) * (-891.437) (-894.128) [-894.120] (-892.205) -- 0:00:48
226000 -- (-892.970) [-892.794] (-891.549) (-894.133) * [-892.292] (-896.632) (-891.106) (-891.784) -- 0:00:47
226500 -- (-893.887) (-893.032) (-894.469) [-892.441] * [-893.618] (-898.490) (-892.012) (-892.591) -- 0:00:47
227000 -- (-891.833) (-894.172) [-892.842] (-892.131) * (-894.570) (-897.743) (-892.860) [-892.529] -- 0:00:47
227500 -- [-892.418] (-892.102) (-894.410) (-891.896) * (-897.925) [-891.779] (-894.757) (-891.861) -- 0:00:47
228000 -- (-893.779) (-895.653) [-891.116] (-892.168) * (-891.857) (-891.778) [-899.980] (-895.586) -- 0:00:47
228500 -- (-894.671) [-892.556] (-893.460) (-893.850) * (-893.667) (-892.131) (-891.102) [-897.423] -- 0:00:47
229000 -- (-891.804) (-895.629) (-892.391) [-891.453] * (-893.825) (-891.660) (-891.764) [-899.225] -- 0:00:47
229500 -- [-892.866] (-891.349) (-895.923) (-892.967) * (-895.893) (-892.156) (-895.706) [-891.362] -- 0:00:47
230000 -- (-894.147) [-892.125] (-897.889) (-892.122) * (-894.973) (-899.730) (-895.372) [-892.936] -- 0:00:46
Average standard deviation of split frequencies: 0.014433
230500 -- (-893.495) [-892.686] (-892.415) (-894.009) * (-893.842) [-895.831] (-894.469) (-891.395) -- 0:00:46
231000 -- (-892.297) (-892.896) [-893.422] (-893.520) * (-891.694) (-896.580) [-893.431] (-891.118) -- 0:00:46
231500 -- (-897.655) (-893.003) [-896.041] (-893.919) * (-891.487) (-892.671) [-895.348] (-893.083) -- 0:00:46
232000 -- (-895.502) [-893.030] (-896.610) (-895.424) * (-892.549) (-893.751) (-894.080) [-893.930] -- 0:00:49
232500 -- (-895.745) (-893.752) [-894.204] (-892.273) * (-893.888) (-894.300) [-894.171] (-893.621) -- 0:00:49
233000 -- (-893.623) (-892.317) (-892.482) [-892.537] * (-893.375) (-894.092) (-893.843) [-892.213] -- 0:00:49
233500 -- [-894.020] (-891.872) (-892.464) (-893.763) * [-892.099] (-895.306) (-898.363) (-895.896) -- 0:00:49
234000 -- [-894.885] (-898.073) (-893.540) (-893.086) * (-892.556) [-894.159] (-897.664) (-891.363) -- 0:00:49
234500 -- (-893.193) [-892.737] (-897.494) (-894.322) * [-894.100] (-894.950) (-895.794) (-892.423) -- 0:00:48
235000 -- [-892.540] (-893.177) (-891.584) (-895.241) * [-892.997] (-893.148) (-895.786) (-892.273) -- 0:00:48
Average standard deviation of split frequencies: 0.013982
235500 -- (-896.095) [-894.209] (-894.924) (-896.793) * (-893.226) (-891.398) [-891.987] (-893.382) -- 0:00:48
236000 -- (-891.824) (-896.184) [-895.798] (-895.467) * (-892.151) (-894.826) (-894.545) [-894.009] -- 0:00:48
236500 -- (-891.805) (-898.898) (-897.080) [-895.224] * (-892.923) (-892.434) (-893.673) [-896.140] -- 0:00:48
237000 -- (-892.168) [-892.544] (-892.359) (-898.883) * [-892.950] (-896.021) (-894.301) (-896.055) -- 0:00:48
237500 -- [-893.260] (-892.784) (-891.983) (-892.398) * (-894.261) (-891.855) [-894.308] (-892.523) -- 0:00:48
238000 -- (-892.256) [-892.571] (-895.745) (-893.112) * [-895.079] (-891.321) (-894.362) (-891.953) -- 0:00:48
238500 -- [-893.052] (-893.400) (-892.022) (-893.881) * (-892.612) [-891.328] (-896.932) (-891.667) -- 0:00:47
239000 -- [-896.350] (-894.555) (-891.312) (-891.963) * [-892.363] (-892.688) (-897.985) (-893.508) -- 0:00:47
239500 -- [-893.145] (-894.241) (-892.453) (-891.049) * (-892.254) (-891.312) [-893.565] (-893.101) -- 0:00:47
240000 -- (-891.909) (-892.674) [-892.933] (-892.838) * (-891.803) (-893.401) [-891.344] (-891.926) -- 0:00:47
Average standard deviation of split frequencies: 0.014625
240500 -- (-892.506) (-896.422) [-893.820] (-892.629) * [-892.299] (-892.606) (-894.792) (-891.192) -- 0:00:47
241000 -- [-895.660] (-895.431) (-894.648) (-896.896) * (-892.820) (-891.252) (-896.116) [-891.198] -- 0:00:47
241500 -- (-892.664) [-894.095] (-894.227) (-895.595) * (-893.910) (-893.945) (-892.679) [-892.064] -- 0:00:47
242000 -- [-895.348] (-895.272) (-894.011) (-893.465) * [-894.086] (-894.458) (-892.152) (-896.417) -- 0:00:46
242500 -- (-896.181) (-893.595) [-892.448] (-891.571) * (-893.788) (-894.428) [-895.858] (-893.379) -- 0:00:46
243000 -- (-896.911) (-896.371) (-894.264) [-894.507] * [-894.164] (-895.183) (-892.969) (-892.229) -- 0:00:46
243500 -- (-900.933) [-898.214] (-901.725) (-892.594) * (-895.567) (-892.786) (-894.113) [-891.514] -- 0:00:46
244000 -- (-900.769) [-893.290] (-899.582) (-891.948) * (-892.488) (-891.590) (-894.163) [-892.212] -- 0:00:46
244500 -- [-895.832] (-892.793) (-895.270) (-897.013) * (-893.613) [-891.668] (-894.497) (-891.209) -- 0:00:46
245000 -- [-896.103] (-894.828) (-891.940) (-896.292) * (-893.724) (-894.752) (-892.160) [-892.982] -- 0:00:46
Average standard deviation of split frequencies: 0.014372
245500 -- (-892.785) (-899.050) [-893.575] (-895.943) * (-894.095) [-895.134] (-894.321) (-899.127) -- 0:00:46
246000 -- (-891.885) [-897.035] (-893.911) (-895.290) * (-893.912) (-896.617) (-891.711) [-894.229] -- 0:00:45
246500 -- [-892.105] (-897.561) (-894.937) (-892.867) * [-892.793] (-893.182) (-892.874) (-893.986) -- 0:00:45
247000 -- [-892.284] (-893.760) (-894.182) (-892.683) * (-894.115) (-894.456) (-896.391) [-895.726] -- 0:00:45
247500 -- (-896.828) [-892.806] (-893.893) (-892.342) * (-893.239) (-893.318) (-895.236) [-893.411] -- 0:00:45
248000 -- (-895.032) (-896.496) (-892.903) [-892.712] * (-893.030) (-893.457) (-893.266) [-894.647] -- 0:00:45
248500 -- (-892.440) (-893.798) [-893.229] (-892.547) * [-895.010] (-892.928) (-899.209) (-894.720) -- 0:00:48
249000 -- (-895.346) (-894.199) (-895.255) [-896.490] * (-893.909) (-896.570) [-895.680] (-895.487) -- 0:00:48
249500 -- (-893.008) (-893.990) [-892.494] (-895.359) * (-892.869) (-898.146) [-894.569] (-892.252) -- 0:00:48
250000 -- (-893.226) [-891.991] (-894.120) (-896.062) * [-892.873] (-893.716) (-896.690) (-893.570) -- 0:00:48
Average standard deviation of split frequencies: 0.013869
250500 -- (-893.269) (-894.208) (-894.319) [-892.039] * [-893.475] (-893.950) (-895.273) (-895.151) -- 0:00:47
251000 -- (-893.548) (-892.976) (-894.624) [-892.295] * (-892.085) [-895.021] (-894.252) (-893.228) -- 0:00:47
251500 -- (-892.382) (-892.318) [-893.125] (-893.820) * [-892.206] (-894.415) (-893.427) (-891.546) -- 0:00:47
252000 -- (-892.367) (-891.390) [-893.948] (-894.480) * [-892.916] (-892.183) (-892.604) (-893.842) -- 0:00:47
252500 -- (-892.020) (-892.675) (-898.674) [-892.957] * [-893.838] (-893.432) (-891.846) (-893.842) -- 0:00:47
253000 -- (-895.853) [-893.630] (-894.312) (-897.348) * (-891.060) [-895.103] (-893.768) (-894.271) -- 0:00:47
253500 -- (-892.891) [-891.760] (-895.264) (-893.202) * (-891.695) [-892.695] (-900.754) (-894.765) -- 0:00:47
254000 -- (-893.346) [-892.582] (-893.704) (-891.667) * [-890.944] (-896.129) (-892.232) (-893.436) -- 0:00:46
254500 -- (-894.868) (-895.229) [-894.050] (-893.482) * (-894.115) (-893.498) (-893.631) [-892.174] -- 0:00:46
255000 -- (-895.626) [-890.978] (-893.231) (-891.578) * [-892.384] (-892.366) (-896.126) (-892.602) -- 0:00:46
Average standard deviation of split frequencies: 0.014271
255500 -- (-892.693) [-895.967] (-893.284) (-892.073) * (-891.569) (-892.207) [-892.226] (-891.371) -- 0:00:46
256000 -- (-892.854) (-894.651) [-894.860] (-894.601) * [-891.906] (-891.280) (-892.380) (-891.411) -- 0:00:46
256500 -- [-892.724] (-893.782) (-892.797) (-894.414) * (-892.569) (-891.447) (-894.856) [-891.773] -- 0:00:46
257000 -- (-895.960) (-891.558) [-892.112] (-892.853) * (-892.486) (-891.952) (-893.802) [-893.992] -- 0:00:46
257500 -- (-897.670) (-891.736) (-892.892) [-891.838] * [-895.896] (-891.246) (-892.840) (-891.626) -- 0:00:46
258000 -- (-894.501) [-892.250] (-898.435) (-893.325) * [-892.430] (-892.462) (-892.545) (-891.591) -- 0:00:46
258500 -- [-891.735] (-892.538) (-893.948) (-894.464) * (-892.746) [-892.266] (-892.374) (-891.405) -- 0:00:45
259000 -- (-893.772) (-894.862) (-894.038) [-892.819] * (-892.640) (-899.907) [-893.547] (-894.292) -- 0:00:45
259500 -- (-899.780) (-893.699) (-892.787) [-892.248] * (-892.757) (-900.953) [-892.978] (-894.588) -- 0:00:45
260000 -- (-897.857) (-892.555) [-892.096] (-893.439) * [-893.386] (-893.671) (-892.248) (-899.141) -- 0:00:45
Average standard deviation of split frequencies: 0.015372
260500 -- (-894.018) (-892.104) (-899.144) [-893.204] * (-894.395) (-891.375) (-894.421) [-893.438] -- 0:00:45
261000 -- [-893.043] (-892.072) (-895.956) (-897.494) * (-894.382) (-891.413) (-894.956) [-892.883] -- 0:00:45
261500 -- (-892.926) [-891.283] (-892.546) (-892.121) * (-895.507) [-892.580] (-898.932) (-896.075) -- 0:00:45
262000 -- (-896.691) (-892.052) [-893.395] (-895.016) * [-892.504] (-897.751) (-892.434) (-892.497) -- 0:00:45
262500 -- (-892.283) (-893.732) [-892.715] (-893.484) * (-899.702) (-897.546) [-892.651] (-892.926) -- 0:00:44
263000 -- (-892.708) (-893.107) (-893.141) [-893.975] * (-893.118) (-892.978) [-893.935] (-900.064) -- 0:00:44
263500 -- (-898.435) (-894.282) [-894.196] (-892.869) * (-893.834) (-893.286) [-891.349] (-897.438) -- 0:00:44
264000 -- [-893.500] (-894.579) (-892.383) (-892.974) * (-894.002) (-894.812) (-893.472) [-893.615] -- 0:00:44
264500 -- [-894.885] (-891.506) (-893.201) (-892.021) * [-892.332] (-895.035) (-893.813) (-892.414) -- 0:00:44
265000 -- (-895.587) (-893.150) (-891.611) [-892.319] * (-891.805) (-893.752) (-893.013) [-893.668] -- 0:00:47
Average standard deviation of split frequencies: 0.014288
265500 -- (-894.960) (-894.915) (-894.318) [-893.509] * [-892.809] (-896.028) (-892.995) (-893.296) -- 0:00:47
266000 -- (-893.444) [-894.572] (-893.487) (-892.994) * (-895.598) [-894.513] (-892.617) (-896.113) -- 0:00:46
266500 -- [-891.549] (-893.768) (-893.961) (-893.924) * [-894.456] (-896.209) (-895.571) (-893.968) -- 0:00:46
267000 -- (-894.591) (-891.621) [-892.031] (-893.080) * [-893.873] (-892.978) (-895.088) (-894.712) -- 0:00:46
267500 -- [-892.177] (-893.838) (-896.023) (-892.314) * (-893.574) (-891.022) (-897.739) [-893.511] -- 0:00:46
268000 -- [-894.349] (-892.886) (-896.466) (-891.878) * (-892.354) [-893.034] (-894.899) (-895.542) -- 0:00:46
268500 -- (-892.754) (-893.163) (-892.794) [-892.449] * (-894.742) [-894.765] (-892.089) (-894.373) -- 0:00:46
269000 -- (-895.299) (-897.249) (-892.908) [-891.928] * (-892.622) (-892.683) [-892.690] (-891.526) -- 0:00:46
269500 -- [-893.308] (-893.493) (-892.699) (-894.006) * (-893.277) (-899.547) [-892.168] (-893.494) -- 0:00:46
270000 -- (-892.642) [-892.763] (-892.246) (-893.513) * (-892.654) (-896.979) [-892.062] (-894.146) -- 0:00:45
Average standard deviation of split frequencies: 0.014151
270500 -- (-893.789) [-892.467] (-892.713) (-893.198) * (-892.397) [-893.024] (-895.236) (-893.880) -- 0:00:45
271000 -- [-898.097] (-893.469) (-893.438) (-896.050) * (-893.811) [-891.822] (-896.585) (-896.891) -- 0:00:45
271500 -- [-894.036] (-893.363) (-893.754) (-896.616) * (-892.846) (-901.199) [-895.725] (-894.097) -- 0:00:45
272000 -- (-897.218) (-891.595) (-896.281) [-896.124] * (-891.430) (-892.921) [-892.154] (-893.384) -- 0:00:45
272500 -- (-899.402) [-892.300] (-893.031) (-893.155) * (-891.297) [-893.417] (-893.966) (-895.449) -- 0:00:45
273000 -- (-895.838) [-893.220] (-892.649) (-893.810) * [-895.072] (-891.778) (-894.321) (-898.944) -- 0:00:45
273500 -- [-894.485] (-892.704) (-894.929) (-892.439) * (-901.680) (-897.444) (-892.964) [-893.146] -- 0:00:45
274000 -- (-898.150) (-892.595) (-894.525) [-894.248] * [-896.829] (-893.370) (-894.981) (-893.156) -- 0:00:45
274500 -- (-893.113) (-892.451) (-893.168) [-893.681] * (-895.047) (-894.491) (-891.074) [-894.259] -- 0:00:44
275000 -- (-892.080) (-893.933) [-892.147] (-893.735) * (-896.923) (-894.159) [-891.004] (-892.945) -- 0:00:44
Average standard deviation of split frequencies: 0.013877
275500 -- (-892.071) (-895.557) [-891.937] (-895.440) * (-899.731) (-895.116) (-896.814) [-894.661] -- 0:00:44
276000 -- (-892.472) (-893.233) [-893.938] (-891.886) * (-897.298) (-893.242) (-892.248) [-895.579] -- 0:00:44
276500 -- [-892.132] (-891.519) (-892.338) (-898.022) * (-893.608) (-891.439) [-893.181] (-896.525) -- 0:00:44
277000 -- (-892.828) (-892.245) [-891.789] (-896.251) * (-896.561) (-892.231) (-895.714) [-893.585] -- 0:00:44
277500 -- (-894.133) (-893.470) [-894.576] (-894.776) * (-893.689) (-894.141) (-896.398) [-891.972] -- 0:00:44
278000 -- (-892.119) [-893.007] (-896.715) (-894.675) * [-891.732] (-901.888) (-892.407) (-891.243) -- 0:00:44
278500 -- (-892.919) [-893.711] (-892.549) (-898.076) * (-895.501) (-892.552) (-892.904) [-891.675] -- 0:00:44
279000 -- (-894.299) (-893.108) [-891.199] (-892.890) * (-898.754) [-892.718] (-893.279) (-892.799) -- 0:00:43
279500 -- (-893.546) (-893.980) (-893.710) [-895.917] * (-898.234) (-892.574) (-898.554) [-895.467] -- 0:00:43
280000 -- (-895.448) [-894.345] (-893.239) (-891.307) * (-899.076) (-892.546) [-893.014] (-894.180) -- 0:00:43
Average standard deviation of split frequencies: 0.013752
280500 -- (-892.580) [-894.706] (-892.525) (-891.682) * (-897.271) [-892.792] (-896.548) (-895.462) -- 0:00:43
281000 -- (-892.009) (-893.241) [-896.897] (-893.750) * (-894.086) [-893.394] (-892.468) (-898.305) -- 0:00:43
281500 -- (-893.360) (-893.868) [-896.575] (-894.871) * (-895.455) [-892.921] (-896.314) (-892.389) -- 0:00:45
282000 -- (-896.011) (-892.037) [-896.751] (-892.693) * [-894.091] (-894.217) (-893.687) (-894.646) -- 0:00:45
282500 -- (-893.690) (-893.649) (-893.615) [-894.087] * (-893.213) (-893.236) (-896.371) [-892.074] -- 0:00:45
283000 -- (-893.856) (-893.245) [-894.069] (-895.366) * (-892.100) (-892.432) (-893.727) [-893.295] -- 0:00:45
283500 -- (-892.848) [-891.074] (-891.456) (-893.969) * [-893.299] (-892.860) (-898.230) (-891.730) -- 0:00:45
284000 -- (-893.203) (-896.447) (-892.665) [-894.268] * (-892.684) (-892.804) (-895.530) [-892.016] -- 0:00:45
284500 -- (-894.680) (-895.349) [-891.104] (-893.219) * (-895.937) [-892.179] (-891.483) (-891.413) -- 0:00:45
285000 -- [-895.219] (-893.467) (-895.419) (-892.467) * (-894.048) (-894.715) [-892.029] (-894.533) -- 0:00:45
Average standard deviation of split frequencies: 0.013804
285500 -- (-894.387) (-893.591) [-893.890] (-891.171) * [-896.140] (-893.792) (-892.533) (-893.264) -- 0:00:45
286000 -- (-895.128) [-893.588] (-893.623) (-894.824) * (-894.095) (-892.614) [-892.418] (-893.758) -- 0:00:44
286500 -- (-897.017) [-894.012] (-891.875) (-893.516) * [-894.481] (-895.943) (-894.673) (-895.067) -- 0:00:44
287000 -- (-894.233) (-895.301) [-891.708] (-892.969) * (-891.286) (-892.460) [-894.961] (-892.974) -- 0:00:44
287500 -- (-891.210) (-895.223) (-892.322) [-892.521] * [-891.074] (-892.221) (-901.719) (-892.444) -- 0:00:44
288000 -- [-891.989] (-893.402) (-894.126) (-892.927) * [-891.403] (-891.103) (-892.213) (-891.663) -- 0:00:44
288500 -- (-891.836) [-894.813] (-897.062) (-894.289) * (-892.573) (-892.381) [-893.143] (-892.996) -- 0:00:44
289000 -- [-892.216] (-897.767) (-892.248) (-896.805) * (-893.667) (-895.691) [-892.567] (-893.859) -- 0:00:44
289500 -- (-893.486) (-893.805) (-892.038) [-892.492] * (-894.516) (-895.354) [-892.096] (-892.155) -- 0:00:44
290000 -- (-894.358) (-892.891) (-892.081) [-892.861] * (-892.817) [-892.789] (-892.024) (-893.707) -- 0:00:44
Average standard deviation of split frequencies: 0.013583
290500 -- (-893.984) (-893.738) [-893.443] (-894.770) * (-893.874) (-892.206) [-894.725] (-891.907) -- 0:00:43
291000 -- (-895.442) [-893.290] (-891.320) (-893.466) * (-898.119) (-892.087) (-892.885) [-894.397] -- 0:00:43
291500 -- (-892.225) (-892.213) [-897.730] (-895.064) * (-898.992) [-892.705] (-894.305) (-893.875) -- 0:00:43
292000 -- (-894.204) (-898.953) (-894.648) [-893.035] * (-896.766) (-893.936) [-892.336] (-893.549) -- 0:00:43
292500 -- [-894.050] (-894.264) (-893.336) (-892.442) * [-894.607] (-892.666) (-892.189) (-895.598) -- 0:00:43
293000 -- [-893.424] (-892.348) (-892.384) (-892.903) * (-893.083) (-895.008) [-891.478] (-893.630) -- 0:00:43
293500 -- [-895.618] (-896.722) (-895.952) (-892.252) * (-892.437) (-894.551) (-893.347) [-894.866] -- 0:00:43
294000 -- (-894.064) (-892.245) [-893.104] (-893.136) * (-895.933) [-891.895] (-894.388) (-891.819) -- 0:00:43
294500 -- [-892.482] (-893.180) (-894.074) (-896.764) * (-892.838) [-893.307] (-893.910) (-891.819) -- 0:00:43
295000 -- (-893.427) [-892.432] (-892.535) (-893.483) * (-891.128) (-895.635) (-891.991) [-891.672] -- 0:00:43
Average standard deviation of split frequencies: 0.014758
295500 -- (-895.759) [-891.839] (-892.929) (-892.388) * (-891.843) (-893.066) [-891.840] (-894.484) -- 0:00:42
296000 -- (-898.817) (-895.006) (-892.877) [-898.433] * (-895.148) (-892.638) (-894.955) [-892.654] -- 0:00:42
296500 -- (-894.298) [-893.453] (-893.387) (-893.502) * (-893.400) (-892.868) [-894.325] (-896.143) -- 0:00:42
297000 -- [-893.373] (-892.016) (-891.571) (-897.298) * (-891.497) (-893.079) [-894.345] (-894.070) -- 0:00:42
297500 -- (-894.071) (-893.640) [-891.587] (-896.297) * (-892.562) [-891.369] (-895.214) (-893.720) -- 0:00:42
298000 -- (-891.880) (-892.182) (-891.572) [-892.848] * (-895.584) [-892.316] (-900.401) (-893.859) -- 0:00:44
298500 -- (-892.684) (-892.946) [-892.033] (-892.310) * [-891.882] (-895.442) (-895.778) (-894.222) -- 0:00:44
299000 -- (-893.463) (-893.091) [-893.187] (-895.425) * (-892.806) [-891.587] (-895.125) (-891.581) -- 0:00:44
299500 -- (-894.579) (-892.034) (-891.892) [-895.966] * (-892.415) (-891.543) (-896.203) [-891.628] -- 0:00:44
300000 -- (-894.187) [-893.064] (-892.764) (-893.829) * (-893.329) (-896.857) (-892.728) [-892.127] -- 0:00:44
Average standard deviation of split frequencies: 0.014529
300500 -- (-895.507) (-893.740) [-892.314] (-897.310) * (-892.193) (-895.193) (-895.766) [-892.638] -- 0:00:44
301000 -- (-891.790) (-894.532) [-892.816] (-894.021) * [-891.655] (-893.556) (-897.255) (-892.671) -- 0:00:44
301500 -- (-895.208) [-893.351] (-894.628) (-894.121) * (-893.129) [-893.982] (-894.739) (-892.788) -- 0:00:44
302000 -- (-892.866) (-891.611) (-895.399) [-895.618] * (-895.989) (-893.358) (-892.100) [-894.997] -- 0:00:43
302500 -- (-891.144) (-892.633) [-894.819] (-897.960) * (-892.928) (-896.382) [-896.164] (-892.127) -- 0:00:43
303000 -- (-891.427) (-894.014) (-896.620) [-892.044] * [-893.221] (-893.913) (-892.920) (-891.624) -- 0:00:43
303500 -- (-892.048) [-891.140] (-892.955) (-892.058) * (-892.864) (-894.700) [-897.000] (-893.188) -- 0:00:43
304000 -- [-892.994] (-890.932) (-896.038) (-895.622) * (-895.601) (-892.938) (-898.405) [-895.517] -- 0:00:43
304500 -- [-894.517] (-892.522) (-894.694) (-895.224) * [-893.354] (-894.070) (-893.802) (-894.529) -- 0:00:43
305000 -- (-895.916) [-893.076] (-893.950) (-894.432) * (-892.767) [-893.890] (-892.708) (-895.745) -- 0:00:43
Average standard deviation of split frequencies: 0.014584
305500 -- (-894.632) (-892.842) (-892.822) [-891.943] * (-891.725) (-893.427) (-892.823) [-891.653] -- 0:00:43
306000 -- (-895.799) [-892.224] (-893.974) (-891.607) * (-896.315) (-898.419) [-894.877] (-893.606) -- 0:00:43
306500 -- (-894.658) [-894.549] (-894.621) (-891.929) * (-893.977) (-900.393) [-895.689] (-895.645) -- 0:00:42
307000 -- [-894.618] (-893.823) (-894.469) (-892.155) * (-893.480) [-896.217] (-897.225) (-897.317) -- 0:00:42
307500 -- (-893.453) [-892.943] (-891.590) (-893.627) * (-899.302) [-895.687] (-891.617) (-893.099) -- 0:00:42
308000 -- [-891.441] (-895.991) (-893.620) (-893.115) * (-893.260) (-897.487) (-893.885) [-893.903] -- 0:00:42
308500 -- [-891.350] (-894.972) (-893.213) (-892.753) * (-891.514) (-893.571) (-893.885) [-896.345] -- 0:00:42
309000 -- (-892.835) (-893.624) [-890.943] (-893.678) * (-892.084) (-893.349) [-893.854] (-892.739) -- 0:00:42
309500 -- [-893.101] (-892.032) (-892.021) (-893.185) * [-892.039] (-896.112) (-894.203) (-893.343) -- 0:00:42
310000 -- (-894.575) [-892.317] (-892.594) (-891.738) * (-897.838) [-892.032] (-891.190) (-892.503) -- 0:00:42
Average standard deviation of split frequencies: 0.013758
310500 -- (-895.150) [-894.278] (-891.431) (-892.185) * (-896.460) [-891.948] (-891.598) (-893.569) -- 0:00:42
311000 -- [-894.617] (-891.694) (-891.838) (-893.434) * (-895.557) [-894.335] (-892.164) (-896.872) -- 0:00:42
311500 -- (-895.031) (-893.051) (-890.979) [-892.229] * (-892.582) (-893.935) (-892.734) [-894.671] -- 0:00:41
312000 -- (-892.882) (-895.431) [-891.258] (-891.516) * [-892.353] (-893.810) (-896.809) (-894.959) -- 0:00:41
312500 -- (-893.423) (-891.786) (-892.890) [-894.933] * (-892.804) (-893.908) [-893.922] (-892.729) -- 0:00:41
313000 -- [-891.395] (-895.606) (-894.607) (-894.256) * (-891.933) [-895.162] (-893.310) (-894.897) -- 0:00:41
313500 -- (-894.283) (-894.204) [-892.442] (-892.304) * (-893.151) (-895.308) (-892.986) [-892.682] -- 0:00:41
314000 -- (-892.959) (-892.674) (-893.559) [-892.657] * [-892.813] (-898.696) (-891.593) (-891.867) -- 0:00:43
314500 -- (-892.214) (-893.497) [-893.066] (-895.226) * (-907.574) [-891.554] (-892.585) (-891.643) -- 0:00:43
315000 -- [-892.995] (-894.902) (-892.554) (-896.343) * (-895.618) [-893.490] (-897.127) (-893.938) -- 0:00:43
Average standard deviation of split frequencies: 0.013625
315500 -- (-893.475) [-896.249] (-891.807) (-893.254) * (-892.682) (-892.477) (-895.316) [-891.970] -- 0:00:43
316000 -- (-891.234) (-895.573) (-893.410) [-891.875] * (-893.619) [-892.251] (-892.053) (-894.849) -- 0:00:43
316500 -- (-892.271) (-892.973) [-896.658] (-892.811) * [-895.756] (-892.377) (-893.624) (-893.316) -- 0:00:43
317000 -- (-892.633) (-893.708) (-898.030) [-894.537] * (-892.074) [-892.391] (-893.781) (-891.817) -- 0:00:43
317500 -- (-894.011) (-895.944) [-893.592] (-894.628) * (-892.896) (-893.713) (-892.610) [-891.829] -- 0:00:42
318000 -- (-894.102) (-895.605) (-893.176) [-894.731] * (-893.229) [-892.836] (-892.533) (-892.876) -- 0:00:42
318500 -- (-894.757) (-892.377) [-892.697] (-891.774) * (-891.883) (-892.343) [-892.545] (-892.343) -- 0:00:42
319000 -- (-894.227) (-894.781) [-892.928] (-891.570) * (-891.033) [-893.077] (-896.076) (-892.627) -- 0:00:42
319500 -- [-892.691] (-895.607) (-893.801) (-891.766) * (-892.194) (-893.820) (-893.299) [-891.946] -- 0:00:42
320000 -- (-892.454) [-896.634] (-893.412) (-893.043) * (-891.482) (-894.709) [-893.815] (-894.527) -- 0:00:42
Average standard deviation of split frequencies: 0.013231
320500 -- (-892.500) (-891.899) (-896.637) [-892.201] * (-892.125) [-895.526] (-898.519) (-893.946) -- 0:00:42
321000 -- [-892.607] (-893.891) (-892.865) (-893.128) * [-894.311] (-892.976) (-892.442) (-899.344) -- 0:00:42
321500 -- (-893.002) (-894.470) [-897.200] (-892.129) * (-896.596) [-895.398] (-891.494) (-894.564) -- 0:00:42
322000 -- (-893.810) (-894.029) (-891.353) [-891.095] * (-892.238) (-902.924) [-892.073] (-894.329) -- 0:00:42
322500 -- [-892.056] (-892.386) (-893.883) (-895.917) * (-894.188) [-893.965] (-893.761) (-895.022) -- 0:00:42
323000 -- (-892.779) (-893.472) [-892.415] (-894.820) * (-892.826) [-895.308] (-894.859) (-893.054) -- 0:00:41
323500 -- (-893.366) (-892.923) [-892.419] (-895.115) * (-893.097) [-894.453] (-893.346) (-895.636) -- 0:00:41
324000 -- (-893.125) (-895.533) [-893.755] (-892.310) * (-900.933) (-896.646) (-893.941) [-892.607] -- 0:00:41
324500 -- (-894.755) [-894.434] (-895.814) (-893.810) * [-898.058] (-891.471) (-893.683) (-893.089) -- 0:00:41
325000 -- (-895.847) (-894.831) [-894.104] (-892.326) * (-899.199) [-893.165] (-894.313) (-897.827) -- 0:00:41
Average standard deviation of split frequencies: 0.012147
325500 -- (-894.131) (-897.829) [-894.588] (-892.698) * [-892.044] (-893.902) (-893.200) (-896.163) -- 0:00:41
326000 -- [-893.677] (-894.459) (-896.524) (-899.046) * (-895.375) (-895.256) (-892.763) [-896.851] -- 0:00:41
326500 -- [-893.552] (-893.900) (-893.548) (-891.407) * (-892.539) [-894.391] (-893.065) (-892.374) -- 0:00:41
327000 -- (-894.909) (-894.161) [-894.613] (-891.215) * [-892.470] (-891.609) (-896.634) (-893.451) -- 0:00:41
327500 -- [-892.029] (-892.154) (-894.370) (-892.882) * (-894.341) (-891.988) [-894.388] (-896.097) -- 0:00:41
328000 -- (-893.004) (-894.512) (-892.408) [-893.222] * (-893.933) [-896.970] (-892.610) (-896.768) -- 0:00:40
328500 -- (-891.970) (-893.249) (-902.311) [-892.586] * [-894.287] (-891.115) (-892.313) (-894.857) -- 0:00:40
329000 -- (-892.717) (-892.915) (-893.042) [-892.762] * (-891.935) (-892.438) (-893.250) [-893.169] -- 0:00:40
329500 -- (-894.083) (-893.355) [-897.199] (-893.580) * (-893.862) [-891.639] (-895.423) (-899.084) -- 0:00:40
330000 -- (-891.657) (-892.180) [-891.372] (-893.611) * [-893.769] (-892.512) (-900.382) (-896.257) -- 0:00:40
Average standard deviation of split frequencies: 0.012070
330500 -- (-893.542) [-892.269] (-892.194) (-893.593) * (-893.324) [-892.329] (-900.080) (-893.014) -- 0:00:42
331000 -- (-891.996) (-892.056) [-893.553] (-891.493) * [-891.843] (-895.754) (-893.931) (-897.972) -- 0:00:42
331500 -- (-892.918) (-893.649) (-894.773) [-891.980] * (-893.813) (-893.919) (-894.652) [-895.746] -- 0:00:42
332000 -- [-895.651] (-895.351) (-891.702) (-893.309) * [-892.328] (-893.595) (-894.343) (-896.262) -- 0:00:42
332500 -- (-891.734) [-892.748] (-892.346) (-892.955) * (-896.043) [-894.140] (-891.668) (-896.845) -- 0:00:42
333000 -- (-891.454) [-894.756] (-895.260) (-901.094) * (-893.950) (-893.871) [-893.767] (-893.336) -- 0:00:42
333500 -- (-892.979) (-894.259) [-892.917] (-894.767) * (-893.917) [-894.873] (-896.475) (-896.811) -- 0:00:41
334000 -- (-894.957) (-893.617) [-893.552] (-896.606) * (-894.618) (-893.133) (-899.562) [-893.221] -- 0:00:41
334500 -- (-894.947) [-892.660] (-894.601) (-897.166) * (-893.577) (-895.693) (-892.693) [-891.638] -- 0:00:41
335000 -- (-895.919) [-892.187] (-896.729) (-894.636) * [-893.340] (-892.724) (-891.609) (-893.599) -- 0:00:41
Average standard deviation of split frequencies: 0.011136
335500 -- (-895.220) (-892.690) (-894.856) [-897.258] * [-892.171] (-894.241) (-893.059) (-895.432) -- 0:00:41
336000 -- (-892.191) (-893.202) [-896.696] (-900.703) * [-893.028] (-894.904) (-893.038) (-892.936) -- 0:00:41
336500 -- [-894.406] (-893.528) (-895.346) (-899.236) * (-892.818) (-892.773) [-892.922] (-892.259) -- 0:00:41
337000 -- (-893.147) (-893.209) [-894.024] (-892.902) * (-895.314) (-892.179) [-893.042] (-892.354) -- 0:00:41
337500 -- (-892.443) (-892.557) (-892.305) [-893.064] * (-894.536) (-891.687) [-893.738] (-895.436) -- 0:00:41
338000 -- (-892.630) [-892.339] (-894.253) (-894.638) * [-897.354] (-899.123) (-898.752) (-893.336) -- 0:00:41
338500 -- [-892.735] (-894.296) (-892.475) (-894.249) * (-892.969) (-896.395) (-893.924) [-892.355] -- 0:00:41
339000 -- (-896.195) [-895.780] (-893.004) (-893.402) * (-892.163) (-895.502) [-892.426] (-891.935) -- 0:00:40
339500 -- (-891.401) (-892.451) [-894.050] (-891.672) * (-894.105) (-896.322) (-894.802) [-893.288] -- 0:00:40
340000 -- [-892.196] (-891.916) (-892.873) (-895.771) * (-892.218) (-893.208) [-894.231] (-891.893) -- 0:00:40
Average standard deviation of split frequencies: 0.010424
340500 -- (-893.816) (-894.876) [-893.887] (-895.263) * (-893.484) (-895.875) [-894.443] (-893.849) -- 0:00:40
341000 -- (-895.651) [-898.758] (-894.840) (-893.185) * (-896.227) (-895.413) [-894.166] (-894.086) -- 0:00:40
341500 -- (-892.363) [-892.239] (-896.570) (-891.564) * (-891.914) (-894.308) [-892.816] (-891.973) -- 0:00:40
342000 -- (-893.142) (-893.142) [-892.926] (-893.274) * (-894.157) [-895.848] (-898.680) (-891.765) -- 0:00:40
342500 -- (-896.952) [-893.227] (-895.084) (-895.841) * (-892.490) (-893.174) [-893.890] (-893.889) -- 0:00:40
343000 -- (-893.222) (-892.500) (-893.189) [-892.655] * [-896.934] (-892.710) (-895.556) (-893.433) -- 0:00:40
343500 -- (-893.857) (-892.562) [-892.475] (-892.523) * [-891.531] (-891.581) (-896.711) (-895.986) -- 0:00:40
344000 -- (-896.658) (-894.081) (-892.545) [-892.506] * (-893.610) (-892.474) (-894.713) [-893.001] -- 0:00:40
344500 -- (-891.618) [-893.358] (-893.445) (-892.806) * [-892.943] (-892.600) (-892.746) (-893.290) -- 0:00:39
345000 -- (-893.691) [-895.129] (-893.228) (-893.437) * (-892.544) (-896.982) (-893.371) [-893.183] -- 0:00:39
Average standard deviation of split frequencies: 0.010718
345500 -- [-892.881] (-896.488) (-891.282) (-892.746) * (-892.708) (-893.723) [-892.927] (-894.211) -- 0:00:39
346000 -- [-893.334] (-893.199) (-896.154) (-891.955) * (-893.677) (-892.700) (-892.018) [-892.459] -- 0:00:39
346500 -- (-896.601) (-895.715) (-896.280) [-893.934] * (-893.327) [-891.553] (-892.003) (-892.784) -- 0:00:39
347000 -- (-892.689) (-894.150) [-893.076] (-892.033) * (-891.661) (-892.074) (-892.666) [-892.093] -- 0:00:41
347500 -- (-894.251) (-897.338) (-897.305) [-891.925] * [-892.207] (-893.276) (-897.002) (-895.882) -- 0:00:41
348000 -- (-896.212) (-893.503) [-893.344] (-891.481) * (-896.659) [-891.215] (-892.758) (-892.197) -- 0:00:41
348500 -- (-896.036) [-893.190] (-895.722) (-892.190) * (-899.533) (-894.349) (-892.732) [-892.540] -- 0:00:41
349000 -- (-895.250) [-892.605] (-897.125) (-891.941) * (-895.302) (-896.467) [-891.715] (-895.016) -- 0:00:41
349500 -- [-894.096] (-895.254) (-892.858) (-895.523) * (-894.603) (-892.287) [-892.908] (-892.369) -- 0:00:40
350000 -- (-895.732) (-893.028) [-892.528] (-892.802) * (-893.087) [-893.424] (-894.947) (-894.003) -- 0:00:40
Average standard deviation of split frequencies: 0.011113
350500 -- (-893.715) (-894.527) [-892.176] (-894.095) * (-893.466) (-892.208) [-892.787] (-892.926) -- 0:00:40
351000 -- [-897.568] (-892.225) (-898.188) (-892.313) * (-895.503) (-895.306) [-892.339] (-894.119) -- 0:00:40
351500 -- (-899.828) [-892.297] (-892.978) (-892.866) * (-891.907) (-893.111) (-894.858) [-894.286] -- 0:00:40
352000 -- (-894.039) [-891.186] (-892.180) (-893.329) * (-891.711) (-892.522) (-895.637) [-893.158] -- 0:00:40
352500 -- (-891.288) (-892.839) [-891.547] (-893.835) * (-891.747) (-894.115) [-894.588] (-899.083) -- 0:00:40
353000 -- (-891.399) [-892.858] (-892.864) (-892.245) * (-893.757) (-894.669) (-894.298) [-892.567] -- 0:00:40
353500 -- [-892.441] (-891.557) (-892.418) (-894.795) * (-891.425) (-892.573) [-893.294] (-896.330) -- 0:00:40
354000 -- (-892.531) (-892.383) [-892.443] (-895.947) * (-894.606) (-892.332) [-892.525] (-893.859) -- 0:00:40
354500 -- [-891.683] (-891.463) (-892.223) (-895.028) * (-892.936) [-892.162] (-893.937) (-892.112) -- 0:00:40
355000 -- (-893.425) (-896.767) (-891.787) [-891.854] * (-892.548) (-892.387) (-900.403) [-892.123] -- 0:00:39
Average standard deviation of split frequencies: 0.010682
355500 -- (-898.096) (-894.778) (-894.362) [-892.246] * (-893.648) (-892.569) (-894.475) [-892.406] -- 0:00:39
356000 -- (-895.029) (-900.642) [-892.450] (-893.668) * (-893.793) (-892.734) [-891.989] (-893.710) -- 0:00:39
356500 -- (-891.634) [-894.987] (-893.722) (-893.961) * (-893.748) (-893.402) [-892.043] (-894.863) -- 0:00:39
357000 -- (-891.597) (-895.714) [-893.838] (-892.865) * (-893.086) (-893.456) (-891.813) [-893.641] -- 0:00:39
357500 -- (-893.767) [-892.410] (-894.917) (-892.168) * (-894.623) (-891.276) [-891.681] (-895.999) -- 0:00:39
358000 -- (-891.173) (-898.210) [-891.773] (-891.689) * (-895.886) (-893.426) [-891.631] (-894.857) -- 0:00:39
358500 -- (-891.647) (-894.416) (-895.205) [-892.132] * (-893.469) [-894.970] (-891.509) (-895.412) -- 0:00:39
359000 -- (-897.321) (-894.498) [-894.832] (-893.549) * [-894.366] (-896.302) (-891.583) (-893.168) -- 0:00:39
359500 -- (-892.240) (-893.523) (-892.919) [-892.737] * [-893.465] (-896.801) (-892.465) (-893.836) -- 0:00:39
360000 -- (-892.265) (-893.436) (-892.443) [-891.728] * (-895.559) [-895.474] (-892.786) (-895.864) -- 0:00:39
Average standard deviation of split frequencies: 0.010543
360500 -- (-891.590) [-894.378] (-892.900) (-894.974) * (-891.908) (-893.845) [-892.746] (-892.286) -- 0:00:39
361000 -- (-894.944) (-893.855) [-893.902] (-892.908) * (-897.953) (-891.189) (-894.145) [-892.825] -- 0:00:38
361500 -- [-892.654] (-891.659) (-892.066) (-895.164) * [-893.249] (-892.553) (-892.719) (-897.128) -- 0:00:40
362000 -- (-895.810) (-895.019) [-891.647] (-892.540) * [-893.018] (-893.377) (-893.100) (-893.648) -- 0:00:40
362500 -- (-892.227) [-892.996] (-891.832) (-894.760) * (-892.678) [-891.444] (-892.470) (-892.735) -- 0:00:40
363000 -- (-893.394) (-892.852) (-895.101) [-891.854] * [-897.141] (-897.020) (-896.319) (-892.541) -- 0:00:40
363500 -- (-892.520) [-891.824] (-896.493) (-893.076) * (-896.762) (-896.140) (-897.437) [-891.642] -- 0:00:40
364000 -- (-892.349) (-891.540) [-895.250] (-894.952) * [-894.915] (-893.562) (-892.476) (-891.211) -- 0:00:40
364500 -- [-892.517] (-892.647) (-892.135) (-895.583) * (-892.281) (-894.130) (-892.150) [-893.210] -- 0:00:40
365000 -- [-892.973] (-892.416) (-893.260) (-893.389) * (-894.060) (-894.223) [-892.648] (-892.305) -- 0:00:40
Average standard deviation of split frequencies: 0.010647
365500 -- (-893.448) (-892.155) (-892.329) [-893.619] * [-892.174] (-896.721) (-893.517) (-892.189) -- 0:00:39
366000 -- [-892.686] (-894.618) (-892.965) (-894.954) * [-891.426] (-892.331) (-894.312) (-892.446) -- 0:00:39
366500 -- [-892.557] (-895.644) (-896.338) (-892.254) * (-891.771) (-892.782) (-892.115) [-892.446] -- 0:00:39
367000 -- (-892.969) (-892.969) (-894.577) [-891.543] * [-894.973] (-895.249) (-892.665) (-892.653) -- 0:00:39
367500 -- (-894.044) (-896.320) [-894.428] (-892.000) * (-892.296) [-892.558] (-895.732) (-892.849) -- 0:00:39
368000 -- (-894.402) (-894.885) (-892.863) [-892.440] * [-894.228] (-894.018) (-892.016) (-891.416) -- 0:00:39
368500 -- [-893.651] (-892.700) (-891.840) (-892.724) * (-893.224) [-894.186] (-896.343) (-900.076) -- 0:00:39
369000 -- (-893.741) (-894.845) (-893.913) [-892.201] * [-891.880] (-893.448) (-893.181) (-897.459) -- 0:00:39
369500 -- (-895.763) (-897.124) (-893.798) [-892.130] * (-896.083) (-893.607) [-893.204] (-893.814) -- 0:00:39
370000 -- (-898.464) (-894.346) (-894.177) [-891.549] * [-894.277] (-896.392) (-893.826) (-894.560) -- 0:00:39
Average standard deviation of split frequencies: 0.011276
370500 -- (-892.208) (-891.461) (-893.877) [-894.803] * (-893.998) [-895.903] (-894.182) (-892.454) -- 0:00:39
371000 -- (-891.661) (-892.246) [-893.332] (-892.725) * (-892.091) (-893.778) (-894.661) [-893.469] -- 0:00:38
371500 -- (-892.059) (-892.770) (-891.379) [-891.827] * (-891.812) (-893.899) (-893.500) [-898.190] -- 0:00:38
372000 -- (-893.847) (-892.295) [-891.380] (-892.572) * [-891.755] (-894.214) (-893.756) (-892.469) -- 0:00:38
372500 -- (-897.946) (-891.727) (-891.479) [-892.764] * (-893.571) (-892.265) [-891.657] (-891.200) -- 0:00:38
373000 -- (-892.965) (-898.329) (-892.574) [-895.314] * (-896.858) [-893.205] (-891.383) (-892.955) -- 0:00:38
373500 -- (-892.154) (-898.385) (-894.218) [-892.636] * [-892.879] (-894.644) (-891.288) (-894.383) -- 0:00:38
374000 -- (-891.657) (-894.916) (-896.486) [-891.973] * (-894.430) (-892.649) [-892.087] (-893.061) -- 0:00:38
374500 -- (-894.721) (-897.974) [-895.460] (-894.057) * (-894.966) (-892.611) (-899.544) [-891.765] -- 0:00:38
375000 -- (-894.273) (-895.892) (-893.881) [-896.479] * (-892.829) [-895.865] (-896.011) (-891.576) -- 0:00:38
Average standard deviation of split frequencies: 0.010949
375500 -- (-893.635) [-895.210] (-892.668) (-893.189) * (-896.299) (-893.431) [-893.596] (-892.231) -- 0:00:38
376000 -- (-891.151) (-895.281) (-895.767) [-894.343] * (-891.535) (-892.973) (-892.643) [-891.297] -- 0:00:38
376500 -- (-892.129) (-893.651) [-892.978] (-893.239) * (-891.440) (-892.456) [-892.593] (-891.318) -- 0:00:38
377000 -- [-892.505] (-892.402) (-891.752) (-892.418) * [-892.409] (-893.574) (-891.406) (-893.015) -- 0:00:38
377500 -- (-893.416) [-896.874] (-891.708) (-893.416) * (-891.581) (-892.695) [-891.276] (-897.385) -- 0:00:37
378000 -- (-891.701) (-898.213) (-893.414) [-894.194] * (-892.748) (-894.319) [-893.379] (-894.393) -- 0:00:39
378500 -- (-893.081) (-893.439) [-895.541] (-894.177) * (-893.759) (-896.537) (-894.494) [-893.051] -- 0:00:39
379000 -- (-892.350) (-896.325) [-893.186] (-892.026) * (-892.723) (-893.839) [-894.651] (-893.797) -- 0:00:39
379500 -- (-892.540) (-895.904) (-894.753) [-893.175] * [-892.243] (-892.427) (-892.463) (-894.539) -- 0:00:39
380000 -- (-892.492) (-894.088) [-895.122] (-895.440) * [-893.259] (-893.598) (-891.875) (-896.402) -- 0:00:39
Average standard deviation of split frequencies: 0.010139
380500 -- (-896.657) (-892.263) [-893.124] (-894.783) * (-893.093) (-891.911) (-892.885) [-894.744] -- 0:00:39
381000 -- (-894.234) (-895.423) (-892.426) [-894.358] * (-891.970) (-892.535) (-895.667) [-895.079] -- 0:00:38
381500 -- [-896.298] (-896.175) (-892.058) (-893.775) * (-897.523) [-891.504] (-893.778) (-894.021) -- 0:00:38
382000 -- (-893.034) (-893.715) (-891.525) [-896.019] * (-893.534) (-892.943) (-895.452) [-892.090] -- 0:00:38
382500 -- (-895.234) (-896.713) (-893.514) [-895.028] * [-892.654] (-893.187) (-893.562) (-892.781) -- 0:00:38
383000 -- [-894.960] (-892.290) (-892.758) (-897.469) * (-892.156) (-894.038) [-892.016] (-893.734) -- 0:00:38
383500 -- (-894.472) (-891.858) [-891.193] (-896.013) * [-893.018] (-894.177) (-893.092) (-892.662) -- 0:00:38
384000 -- (-893.107) (-894.132) [-892.643] (-895.350) * (-898.271) [-895.649] (-893.473) (-895.953) -- 0:00:38
384500 -- (-891.253) (-892.903) (-892.559) [-893.025] * (-892.587) (-896.600) (-894.716) [-891.377] -- 0:00:38
385000 -- (-895.544) (-891.589) [-891.602] (-895.482) * (-895.210) (-893.031) [-892.371] (-891.212) -- 0:00:38
Average standard deviation of split frequencies: 0.010304
385500 -- (-897.793) (-891.093) (-893.172) [-896.417] * (-892.703) [-892.024] (-893.758) (-895.672) -- 0:00:38
386000 -- (-894.651) (-894.478) [-893.706] (-897.811) * [-895.304] (-891.673) (-892.444) (-895.357) -- 0:00:38
386500 -- (-892.368) (-894.970) (-892.623) [-895.991] * (-892.187) [-894.960] (-892.753) (-892.873) -- 0:00:38
387000 -- (-894.020) (-899.655) (-892.417) [-894.246] * [-894.330] (-894.483) (-892.567) (-894.804) -- 0:00:38
387500 -- [-892.518] (-894.062) (-898.669) (-893.200) * (-894.608) (-891.312) (-894.529) [-892.870] -- 0:00:37
388000 -- (-891.393) [-892.420] (-893.014) (-892.852) * [-892.341] (-893.246) (-891.902) (-892.473) -- 0:00:37
388500 -- (-891.200) (-892.149) [-893.774] (-896.491) * (-894.468) (-898.058) [-892.845] (-892.562) -- 0:00:37
389000 -- (-892.779) (-892.139) (-895.633) [-894.646] * (-894.008) (-892.913) [-894.428] (-894.519) -- 0:00:37
389500 -- (-897.899) (-892.743) (-895.587) [-896.295] * (-894.133) [-892.035] (-893.223) (-895.521) -- 0:00:37
390000 -- (-892.949) (-893.643) (-893.257) [-893.626] * (-891.919) [-893.976] (-895.362) (-891.522) -- 0:00:37
Average standard deviation of split frequencies: 0.010216
390500 -- (-891.106) (-894.317) (-892.482) [-892.136] * [-894.080] (-894.229) (-893.712) (-892.378) -- 0:00:37
391000 -- (-893.721) [-892.141] (-894.446) (-893.349) * (-895.179) [-892.508] (-895.057) (-891.685) -- 0:00:37
391500 -- (-894.357) [-891.660] (-894.281) (-892.958) * [-892.174] (-892.694) (-893.690) (-891.963) -- 0:00:37
392000 -- (-894.030) (-894.896) (-893.498) [-893.277] * (-892.078) (-892.415) [-893.963] (-891.476) -- 0:00:37
392500 -- (-892.477) [-893.210] (-893.525) (-893.310) * (-891.967) (-892.007) (-896.339) [-892.064] -- 0:00:37
393000 -- [-895.399] (-893.013) (-892.813) (-892.760) * [-892.884] (-893.547) (-892.191) (-893.747) -- 0:00:37
393500 -- (-892.075) (-895.545) (-891.810) [-891.058] * (-892.482) (-894.343) [-891.195] (-897.106) -- 0:00:36
394000 -- [-891.880] (-893.866) (-893.148) (-891.537) * [-892.887] (-895.433) (-894.735) (-891.395) -- 0:00:36
394500 -- (-892.577) [-891.403] (-898.215) (-891.537) * (-892.253) [-896.533] (-891.978) (-892.050) -- 0:00:38
395000 -- (-892.174) (-891.851) (-893.202) [-891.968] * [-891.291] (-897.116) (-894.076) (-891.125) -- 0:00:38
Average standard deviation of split frequencies: 0.010317
395500 -- (-892.524) (-892.774) (-892.805) [-892.352] * [-891.208] (-893.690) (-897.056) (-896.899) -- 0:00:38
396000 -- (-891.171) [-892.939] (-894.153) (-891.852) * (-892.700) [-893.352] (-896.383) (-893.867) -- 0:00:38
396500 -- (-891.104) (-893.043) [-891.935] (-893.027) * (-893.062) (-894.067) [-893.458] (-895.669) -- 0:00:38
397000 -- (-893.006) (-893.971) (-891.907) [-892.081] * (-890.906) (-893.346) (-894.664) [-892.611] -- 0:00:37
397500 -- (-893.084) (-892.169) [-893.962] (-893.842) * [-892.709] (-894.265) (-894.020) (-893.706) -- 0:00:37
398000 -- (-894.476) (-892.110) [-893.881] (-891.668) * (-896.277) (-893.496) [-893.262] (-894.164) -- 0:00:37
398500 -- (-895.291) [-892.286] (-894.728) (-892.965) * (-891.893) (-891.894) [-891.506] (-893.179) -- 0:00:37
399000 -- [-891.696] (-895.456) (-893.348) (-893.815) * (-892.169) [-900.248] (-891.680) (-894.166) -- 0:00:37
399500 -- (-891.456) [-893.543] (-892.885) (-896.067) * (-892.376) (-897.316) [-895.754] (-892.319) -- 0:00:37
400000 -- (-896.687) (-893.272) [-893.234] (-892.560) * (-893.592) (-894.164) [-893.607] (-893.511) -- 0:00:37
Average standard deviation of split frequencies: 0.010824
400500 -- (-894.173) (-893.936) (-892.865) [-892.445] * (-894.090) [-893.785] (-892.519) (-893.435) -- 0:00:37
401000 -- (-894.908) (-892.813) (-899.729) [-893.750] * (-893.508) (-893.549) [-892.914] (-894.048) -- 0:00:37
401500 -- (-893.003) (-891.741) [-892.683] (-893.745) * (-892.467) [-896.269] (-892.497) (-892.247) -- 0:00:37
402000 -- (-891.701) (-892.616) [-897.781] (-895.416) * (-893.883) (-894.797) (-892.522) [-892.751] -- 0:00:37
402500 -- (-892.193) [-895.819] (-895.393) (-894.739) * (-893.455) (-896.082) [-897.655] (-891.603) -- 0:00:37
403000 -- (-892.905) [-895.549] (-894.205) (-894.354) * (-893.310) (-896.014) [-893.281] (-894.224) -- 0:00:37
403500 -- (-892.375) [-893.022] (-893.710) (-893.301) * (-892.912) (-893.994) (-893.006) [-892.952] -- 0:00:36
404000 -- (-893.824) [-891.525] (-892.586) (-891.346) * (-893.548) (-895.343) (-895.343) [-892.000] -- 0:00:36
404500 -- (-892.616) (-896.532) [-896.658] (-891.414) * (-890.997) (-896.507) [-893.861] (-892.569) -- 0:00:36
405000 -- (-893.101) [-894.582] (-893.543) (-891.612) * (-891.492) [-895.467] (-895.920) (-894.268) -- 0:00:36
Average standard deviation of split frequencies: 0.010605
405500 -- [-891.980] (-892.771) (-893.912) (-891.344) * (-892.962) (-895.540) [-891.329] (-892.277) -- 0:00:36
406000 -- [-891.906] (-894.036) (-891.780) (-891.344) * (-891.210) [-895.386] (-894.425) (-892.191) -- 0:00:36
406500 -- (-893.227) [-894.872] (-891.894) (-894.770) * (-894.352) (-894.477) (-896.176) [-892.113] -- 0:00:36
407000 -- (-892.756) (-892.906) [-893.692] (-893.586) * (-903.209) (-894.288) (-892.608) [-892.236] -- 0:00:36
407500 -- (-893.393) (-893.698) (-895.923) [-893.691] * [-892.906] (-892.517) (-896.302) (-892.095) -- 0:00:36
408000 -- [-898.609] (-891.834) (-894.599) (-896.890) * [-895.444] (-894.444) (-892.617) (-892.988) -- 0:00:36
408500 -- (-898.878) [-894.126] (-894.131) (-897.375) * (-893.950) (-893.060) [-891.820] (-892.141) -- 0:00:36
409000 -- (-896.386) (-891.770) [-893.159] (-892.327) * [-894.611] (-892.125) (-891.911) (-894.668) -- 0:00:36
409500 -- (-891.641) [-891.604] (-893.830) (-892.242) * [-894.453] (-895.126) (-897.884) (-893.112) -- 0:00:36
410000 -- (-891.387) (-894.978) [-891.727] (-894.985) * [-893.267] (-892.640) (-898.956) (-893.124) -- 0:00:35
Average standard deviation of split frequencies: 0.009642
410500 -- [-892.155] (-893.296) (-892.867) (-894.057) * [-893.732] (-894.828) (-893.303) (-896.342) -- 0:00:35
411000 -- (-892.824) [-895.101] (-896.857) (-896.556) * (-891.572) [-893.166] (-894.993) (-893.732) -- 0:00:37
411500 -- (-891.792) [-892.382] (-896.320) (-893.064) * (-894.265) (-893.912) (-893.994) [-895.872] -- 0:00:37
412000 -- (-893.663) [-891.079] (-893.909) (-891.714) * [-893.630] (-894.069) (-894.133) (-898.316) -- 0:00:37
412500 -- (-892.436) (-891.567) [-892.436] (-892.169) * (-893.159) [-893.902] (-893.941) (-896.568) -- 0:00:37
413000 -- (-891.785) (-892.393) (-895.720) [-894.663] * (-893.722) (-895.278) (-893.946) [-893.783] -- 0:00:36
413500 -- [-892.366] (-892.216) (-894.677) (-896.196) * [-891.611] (-891.871) (-896.274) (-895.216) -- 0:00:36
414000 -- (-892.848) [-891.330] (-892.979) (-891.650) * (-891.781) [-891.497] (-893.983) (-894.634) -- 0:00:36
414500 -- (-892.904) (-892.806) (-895.886) [-891.238] * (-894.651) (-892.516) (-893.573) [-893.463] -- 0:00:36
415000 -- (-892.407) (-894.403) [-894.018] (-893.096) * [-891.199] (-899.777) (-891.388) (-898.441) -- 0:00:36
Average standard deviation of split frequencies: 0.009745
415500 -- (-893.912) (-893.312) [-891.186] (-893.047) * [-896.532] (-896.046) (-891.473) (-893.449) -- 0:00:36
416000 -- (-891.889) (-895.008) (-892.833) [-893.272] * (-898.282) (-893.529) (-891.270) [-894.490] -- 0:00:36
416500 -- [-892.272] (-892.727) (-891.782) (-893.535) * (-898.164) [-895.978] (-891.187) (-893.145) -- 0:00:36
417000 -- (-894.123) [-892.685] (-891.026) (-894.276) * (-893.467) (-895.247) [-892.028] (-894.045) -- 0:00:36
417500 -- (-892.022) (-893.360) [-892.520] (-897.989) * (-890.906) (-893.270) [-892.782] (-892.882) -- 0:00:36
418000 -- [-891.572] (-891.794) (-892.726) (-893.041) * [-890.906] (-893.958) (-895.222) (-892.395) -- 0:00:36
418500 -- [-891.037] (-891.700) (-894.450) (-897.718) * (-891.772) (-893.028) (-894.002) [-892.739] -- 0:00:36
419000 -- [-891.725] (-892.530) (-894.452) (-901.500) * (-892.336) [-892.904] (-896.089) (-900.249) -- 0:00:36
419500 -- (-891.609) [-894.532] (-894.488) (-892.767) * (-891.857) (-892.300) (-891.337) [-895.957] -- 0:00:35
420000 -- (-891.618) (-892.185) (-895.468) [-892.535] * [-894.210] (-892.677) (-894.130) (-892.865) -- 0:00:35
Average standard deviation of split frequencies: 0.009861
420500 -- (-894.842) (-891.570) [-896.300] (-891.931) * (-891.641) (-892.465) [-892.115] (-895.419) -- 0:00:35
421000 -- (-898.343) (-891.614) [-893.963] (-892.063) * (-895.138) [-897.522] (-891.811) (-892.194) -- 0:00:35
421500 -- [-895.103] (-897.546) (-893.879) (-893.376) * (-894.548) (-893.519) [-892.686] (-895.345) -- 0:00:35
422000 -- (-894.642) (-896.868) (-892.199) [-893.655] * [-896.884] (-894.731) (-894.317) (-891.878) -- 0:00:35
422500 -- (-895.213) (-894.854) (-894.523) [-893.092] * (-896.470) [-892.003] (-892.548) (-892.051) -- 0:00:35
423000 -- (-896.477) (-893.989) (-894.552) [-894.562] * [-893.719] (-891.641) (-892.783) (-893.945) -- 0:00:35
423500 -- (-892.639) (-892.649) (-897.803) [-895.023] * (-894.024) [-895.076] (-896.537) (-892.748) -- 0:00:35
424000 -- [-892.191] (-895.903) (-895.206) (-893.504) * (-891.485) (-892.069) (-894.084) [-896.162] -- 0:00:35
424500 -- (-896.853) [-893.128] (-892.903) (-892.740) * (-893.856) [-892.151] (-892.840) (-894.239) -- 0:00:35
425000 -- (-897.567) (-892.156) [-895.689] (-893.260) * (-900.499) [-891.077] (-891.851) (-892.436) -- 0:00:35
Average standard deviation of split frequencies: 0.009664
425500 -- (-894.736) [-892.061] (-893.183) (-892.653) * (-898.260) (-892.753) (-898.727) [-892.580] -- 0:00:35
426000 -- (-891.430) [-897.273] (-891.869) (-891.940) * (-894.190) (-894.491) (-892.460) [-891.983] -- 0:00:35
426500 -- (-892.879) (-892.117) (-896.298) [-894.342] * (-894.004) [-897.031] (-892.195) (-891.913) -- 0:00:34
427000 -- (-894.349) [-891.184] (-893.156) (-892.810) * [-892.152] (-899.322) (-893.971) (-892.406) -- 0:00:34
427500 -- (-895.109) (-894.085) (-893.532) [-894.355] * [-891.784] (-895.720) (-893.785) (-892.884) -- 0:00:36
428000 -- (-894.411) [-891.982] (-892.126) (-892.533) * [-898.236] (-894.129) (-893.760) (-892.778) -- 0:00:36
428500 -- (-893.208) [-892.987] (-895.154) (-894.095) * [-894.584] (-891.899) (-893.572) (-892.983) -- 0:00:36
429000 -- (-892.393) [-893.089] (-895.736) (-891.316) * (-894.455) (-891.565) [-892.762] (-894.459) -- 0:00:35
429500 -- [-892.405] (-893.208) (-895.495) (-893.279) * [-893.518] (-892.312) (-892.487) (-896.479) -- 0:00:35
430000 -- [-891.706] (-897.288) (-896.720) (-897.549) * (-892.968) (-894.171) (-894.759) [-892.021] -- 0:00:35
Average standard deviation of split frequencies: 0.009486
430500 -- (-892.966) [-894.764] (-892.354) (-891.973) * [-893.410] (-895.423) (-892.866) (-892.065) -- 0:00:35
431000 -- (-892.177) (-892.942) [-893.677] (-893.579) * (-891.837) (-892.210) [-894.041] (-891.741) -- 0:00:35
431500 -- (-896.013) (-892.446) (-892.538) [-893.430] * (-894.996) [-893.706] (-894.313) (-895.227) -- 0:00:35
432000 -- (-895.093) (-894.037) [-893.646] (-892.080) * (-891.981) (-895.309) (-894.191) [-894.597] -- 0:00:35
432500 -- (-897.014) (-894.435) (-896.753) [-891.582] * [-893.371] (-892.087) (-892.807) (-895.076) -- 0:00:35
433000 -- [-892.887] (-893.946) (-892.344) (-892.900) * (-892.892) (-896.330) [-893.299] (-896.056) -- 0:00:35
433500 -- [-892.216] (-892.804) (-894.361) (-896.157) * [-891.495] (-892.376) (-892.494) (-895.488) -- 0:00:35
434000 -- (-892.662) (-894.390) (-891.136) [-896.661] * (-895.681) (-892.094) [-892.816] (-894.998) -- 0:00:35
434500 -- (-892.323) (-891.813) [-891.345] (-896.145) * (-893.666) (-892.121) [-892.624] (-898.767) -- 0:00:35
435000 -- (-893.103) [-891.184] (-896.335) (-896.724) * (-893.267) (-893.152) [-892.597] (-892.276) -- 0:00:35
Average standard deviation of split frequencies: 0.009443
435500 -- (-894.520) (-891.327) [-894.561] (-892.603) * (-894.048) [-894.413] (-893.661) (-891.423) -- 0:00:34
436000 -- (-897.790) [-892.002] (-891.284) (-896.745) * (-892.568) (-893.531) [-894.112] (-892.717) -- 0:00:34
436500 -- [-891.745] (-891.866) (-891.749) (-892.505) * [-891.923] (-893.016) (-893.573) (-896.430) -- 0:00:34
437000 -- (-894.252) (-891.754) (-892.000) [-894.594] * (-891.903) (-893.598) (-892.832) [-894.447] -- 0:00:34
437500 -- (-892.505) [-894.885] (-894.423) (-893.321) * (-892.827) (-895.674) (-892.577) [-892.426] -- 0:00:34
438000 -- (-892.912) (-893.063) (-893.390) [-892.074] * (-893.570) (-897.446) [-892.328] (-892.259) -- 0:00:34
438500 -- (-892.819) (-892.509) [-894.148] (-891.721) * [-893.258] (-895.293) (-892.916) (-891.885) -- 0:00:34
439000 -- (-892.791) (-892.694) (-896.707) [-891.545] * (-893.856) (-892.310) [-892.641] (-891.398) -- 0:00:34
439500 -- (-892.005) [-892.469] (-895.155) (-892.157) * (-892.057) [-891.335] (-892.365) (-893.607) -- 0:00:34
440000 -- [-891.482] (-892.593) (-891.956) (-893.049) * [-893.752] (-893.371) (-891.908) (-896.132) -- 0:00:34
Average standard deviation of split frequencies: 0.009271
440500 -- (-891.419) [-894.204] (-893.656) (-894.826) * (-892.314) [-891.681] (-891.926) (-893.852) -- 0:00:34
441000 -- (-891.728) (-892.346) (-894.724) [-893.475] * (-892.600) (-891.506) (-892.292) [-892.217] -- 0:00:34
441500 -- [-897.606] (-892.289) (-892.386) (-896.517) * (-892.315) [-900.671] (-891.994) (-893.106) -- 0:00:34
442000 -- (-895.713) (-893.206) [-893.854] (-892.772) * [-892.069] (-892.109) (-891.436) (-891.866) -- 0:00:34
442500 -- (-891.623) (-891.485) [-893.588] (-892.040) * (-892.849) (-894.186) [-892.413] (-892.128) -- 0:00:34
443000 -- (-891.816) (-893.869) (-896.793) [-893.822] * [-892.074] (-891.994) (-893.514) (-894.295) -- 0:00:33
443500 -- (-891.879) (-893.814) [-892.181] (-894.568) * (-892.045) (-893.912) (-894.324) [-894.093] -- 0:00:33
444000 -- (-891.054) [-893.479] (-892.373) (-893.814) * [-892.760] (-892.981) (-894.201) (-891.983) -- 0:00:33
444500 -- (-892.520) [-894.402] (-892.396) (-893.505) * (-891.799) [-893.227] (-891.228) (-892.076) -- 0:00:34
445000 -- (-892.661) (-894.176) (-897.033) [-893.294] * (-891.233) (-892.342) (-892.473) [-895.790] -- 0:00:34
Average standard deviation of split frequencies: 0.008667
445500 -- [-892.736] (-893.214) (-896.170) (-892.065) * (-892.173) (-892.804) [-892.125] (-892.506) -- 0:00:34
446000 -- [-891.714] (-892.513) (-896.301) (-892.276) * (-896.177) [-893.043] (-891.336) (-895.269) -- 0:00:34
446500 -- [-893.326] (-893.552) (-892.589) (-893.172) * (-891.707) (-896.884) (-896.732) [-892.918] -- 0:00:34
447000 -- (-893.038) (-891.231) (-893.594) [-894.538] * (-893.513) (-894.572) (-894.383) [-892.588] -- 0:00:34
447500 -- (-896.219) (-891.559) [-893.642] (-892.939) * (-894.137) (-892.781) [-894.201] (-895.410) -- 0:00:34
448000 -- (-891.927) (-896.224) (-894.076) [-892.787] * (-897.313) [-892.546] (-892.604) (-893.070) -- 0:00:34
448500 -- (-894.387) (-893.809) (-893.422) [-895.971] * (-892.279) (-892.497) [-893.420] (-898.399) -- 0:00:34
449000 -- (-892.666) (-891.865) (-892.182) [-894.678] * (-892.419) (-893.989) [-892.035] (-893.572) -- 0:00:34
449500 -- (-895.443) [-894.092] (-892.084) (-895.133) * (-890.914) (-891.846) [-894.458] (-895.144) -- 0:00:34
450000 -- (-891.613) (-893.549) (-891.359) [-893.225] * (-895.650) [-891.549] (-893.779) (-891.430) -- 0:00:34
Average standard deviation of split frequencies: 0.008577
450500 -- [-891.380] (-895.565) (-892.164) (-892.008) * (-892.741) (-891.307) [-895.981] (-892.597) -- 0:00:34
451000 -- (-892.846) (-895.785) (-892.027) [-894.735] * (-899.599) (-891.459) [-891.410] (-892.796) -- 0:00:34
451500 -- [-891.861] (-895.131) (-894.233) (-897.283) * (-895.416) (-893.382) (-891.848) [-892.007] -- 0:00:34
452000 -- (-891.654) [-893.517] (-893.551) (-898.043) * (-891.557) (-894.334) [-891.689] (-894.293) -- 0:00:33
452500 -- (-893.562) [-892.324] (-895.451) (-900.121) * (-891.224) (-897.328) [-891.107] (-894.068) -- 0:00:33
453000 -- (-901.293) (-892.165) [-895.472] (-893.863) * [-895.115] (-894.771) (-891.866) (-895.852) -- 0:00:33
453500 -- [-893.214] (-892.298) (-895.350) (-892.520) * (-892.786) (-893.028) (-892.745) [-892.679] -- 0:00:33
454000 -- (-891.031) (-893.001) [-894.994] (-891.803) * (-893.465) (-896.481) (-891.696) [-893.397] -- 0:00:33
454500 -- (-891.573) (-894.340) (-893.703) [-894.442] * [-892.827] (-893.097) (-894.102) (-896.103) -- 0:00:33
455000 -- (-892.365) [-892.288] (-898.806) (-892.943) * (-892.967) (-893.554) [-892.532] (-896.212) -- 0:00:33
Average standard deviation of split frequencies: 0.007719
455500 -- (-893.137) (-892.519) (-900.871) [-892.386] * (-897.045) [-896.354] (-894.084) (-892.260) -- 0:00:33
456000 -- (-893.751) (-892.160) (-894.201) [-896.447] * (-892.966) (-891.798) [-893.594] (-893.254) -- 0:00:33
456500 -- (-896.119) (-892.193) [-892.647] (-892.509) * (-894.510) (-895.384) (-892.479) [-894.652] -- 0:00:33
457000 -- (-892.587) [-891.250] (-893.423) (-892.877) * (-893.305) [-896.398] (-892.776) (-893.051) -- 0:00:33
457500 -- (-892.095) (-893.207) (-892.608) [-893.804] * [-892.729] (-892.282) (-896.048) (-895.668) -- 0:00:33
458000 -- (-892.285) (-891.890) [-895.937] (-893.618) * [-892.250] (-893.946) (-892.925) (-894.621) -- 0:00:33
458500 -- (-892.149) (-893.607) [-892.768] (-892.244) * (-892.922) (-894.184) [-892.024] (-894.779) -- 0:00:33
459000 -- (-895.666) (-891.317) (-891.970) [-891.634] * (-893.556) [-892.068] (-899.391) (-893.065) -- 0:00:33
459500 -- (-892.369) (-891.317) [-891.812] (-892.182) * (-891.570) (-896.767) [-892.297] (-894.530) -- 0:00:32
460000 -- (-894.344) [-892.354] (-894.090) (-893.126) * [-891.669] (-895.281) (-891.334) (-893.588) -- 0:00:32
Average standard deviation of split frequencies: 0.008050
460500 -- (-893.864) [-893.993] (-896.122) (-893.546) * [-894.695] (-896.046) (-892.264) (-893.263) -- 0:00:32
461000 -- (-893.470) (-893.924) [-893.569] (-891.395) * (-896.774) [-895.293] (-893.416) (-892.436) -- 0:00:33
461500 -- (-895.780) [-893.513] (-894.588) (-892.902) * (-892.552) (-897.892) (-895.070) [-892.721] -- 0:00:33
462000 -- [-896.377] (-893.186) (-893.211) (-892.886) * (-892.693) (-896.353) [-892.151] (-892.827) -- 0:00:33
462500 -- (-894.467) [-892.392] (-892.373) (-891.336) * (-893.922) (-891.799) [-893.703] (-891.762) -- 0:00:33
463000 -- (-893.488) (-896.080) (-892.800) [-891.849] * (-892.101) (-894.831) [-893.298] (-892.222) -- 0:00:33
463500 -- [-894.701] (-893.420) (-894.743) (-891.799) * (-891.769) (-893.686) [-891.540] (-893.694) -- 0:00:33
464000 -- (-892.348) (-892.238) (-896.331) [-891.792] * [-892.612] (-897.946) (-892.579) (-891.433) -- 0:00:33
464500 -- (-892.482) [-893.103] (-894.637) (-893.004) * (-893.171) (-892.745) (-892.361) [-891.810] -- 0:00:33
465000 -- [-892.635] (-894.788) (-893.276) (-891.699) * (-894.212) (-892.522) (-896.195) [-893.132] -- 0:00:33
Average standard deviation of split frequencies: 0.007756
465500 -- (-893.497) (-895.614) [-892.080] (-894.245) * (-895.682) (-898.148) [-892.699] (-892.422) -- 0:00:33
466000 -- (-892.494) [-892.043] (-892.118) (-897.171) * (-892.395) (-895.026) (-897.739) [-892.094] -- 0:00:33
466500 -- [-893.663] (-891.869) (-894.160) (-894.944) * (-893.562) (-891.693) [-893.788] (-893.344) -- 0:00:33
467000 -- [-892.348] (-895.240) (-891.337) (-895.014) * (-893.426) (-892.213) (-893.189) [-892.592] -- 0:00:33
467500 -- (-892.152) (-892.717) [-891.701] (-895.330) * [-892.562] (-891.651) (-892.530) (-893.125) -- 0:00:33
468000 -- (-892.295) (-894.453) [-892.340] (-897.213) * [-891.584] (-891.646) (-893.373) (-893.291) -- 0:00:32
468500 -- (-891.020) [-894.937] (-892.742) (-892.836) * (-891.354) [-891.362] (-893.958) (-894.271) -- 0:00:32
469000 -- (-894.715) (-894.362) [-892.582] (-892.722) * [-895.179] (-891.259) (-895.279) (-894.031) -- 0:00:32
469500 -- (-894.527) (-894.276) (-895.018) [-891.817] * (-894.762) (-896.642) [-895.946] (-894.342) -- 0:00:32
470000 -- [-891.543] (-894.677) (-896.856) (-893.991) * (-893.835) (-895.980) (-894.107) [-892.981] -- 0:00:32
Average standard deviation of split frequencies: 0.007812
470500 -- (-892.732) (-892.700) [-893.451] (-895.111) * (-893.502) [-896.178] (-892.034) (-893.316) -- 0:00:32
471000 -- [-893.893] (-894.473) (-892.939) (-891.813) * (-891.840) (-896.678) [-893.491] (-893.436) -- 0:00:32
471500 -- (-894.448) (-895.211) (-896.061) [-895.082] * (-894.131) (-896.907) (-893.445) [-891.452] -- 0:00:32
472000 -- (-894.188) [-894.533] (-896.234) (-893.927) * (-892.321) (-894.980) (-894.255) [-895.038] -- 0:00:32
472500 -- (-894.859) (-893.819) [-892.863] (-894.677) * [-892.328] (-893.533) (-895.070) (-892.094) -- 0:00:32
473000 -- (-895.829) (-893.432) (-893.071) [-894.616] * [-892.373] (-894.840) (-894.948) (-891.510) -- 0:00:32
473500 -- (-892.913) (-893.547) [-893.596] (-895.696) * (-893.047) [-896.988] (-892.698) (-891.645) -- 0:00:32
474000 -- (-891.772) (-891.819) (-893.250) [-891.556] * [-894.251] (-896.837) (-893.324) (-894.375) -- 0:00:32
474500 -- (-892.268) [-892.849] (-895.841) (-894.627) * (-894.956) [-891.180] (-894.771) (-891.308) -- 0:00:32
475000 -- (-892.981) (-893.860) (-894.528) [-894.028] * (-895.380) [-892.501] (-894.741) (-891.178) -- 0:00:32
Average standard deviation of split frequencies: 0.007130
475500 -- (-892.401) (-895.694) [-891.727] (-894.474) * [-892.967] (-892.701) (-894.181) (-891.964) -- 0:00:31
476000 -- (-892.638) (-894.973) [-893.289] (-892.226) * (-894.730) (-893.251) (-897.579) [-894.742] -- 0:00:31
476500 -- (-892.437) [-892.989] (-894.334) (-895.195) * (-893.667) (-894.643) [-897.335] (-891.135) -- 0:00:31
477000 -- (-894.628) (-895.852) (-895.955) [-896.388] * (-892.296) [-892.896] (-894.337) (-892.321) -- 0:00:31
477500 -- [-891.841] (-896.136) (-894.067) (-898.913) * (-895.621) [-893.082] (-895.589) (-892.530) -- 0:00:32
478000 -- (-892.294) [-897.500] (-891.614) (-893.491) * (-896.253) (-892.480) (-892.525) [-897.089] -- 0:00:32
478500 -- (-892.538) (-892.929) (-891.305) [-892.804] * (-892.473) (-893.921) (-893.769) [-894.409] -- 0:00:32
479000 -- (-893.795) (-894.287) (-893.862) [-895.093] * (-892.673) (-892.497) (-894.373) [-898.305] -- 0:00:32
479500 -- (-892.162) (-892.967) (-893.056) [-892.924] * [-893.100] (-892.671) (-897.842) (-893.299) -- 0:00:32
480000 -- (-892.714) (-895.757) [-893.766] (-892.930) * (-898.662) (-892.659) [-892.411] (-892.229) -- 0:00:32
Average standard deviation of split frequencies: 0.009746
480500 -- (-892.623) [-892.789] (-894.600) (-893.323) * (-895.015) (-893.226) [-891.791] (-895.699) -- 0:00:32
481000 -- (-893.005) (-893.670) [-893.066] (-896.280) * [-893.203] (-894.019) (-892.368) (-895.638) -- 0:00:32
481500 -- (-895.600) (-893.635) [-893.595] (-900.067) * (-892.166) (-893.297) [-892.758] (-892.697) -- 0:00:32
482000 -- [-893.778] (-895.221) (-892.950) (-892.941) * [-891.616] (-893.532) (-892.643) (-895.859) -- 0:00:32
482500 -- (-892.136) (-896.165) (-891.174) [-897.808] * [-894.771] (-892.283) (-895.760) (-895.301) -- 0:00:32
483000 -- (-891.714) (-892.988) [-894.770] (-901.463) * (-891.910) (-891.773) [-892.975] (-896.813) -- 0:00:32
483500 -- (-891.708) (-891.456) (-895.700) [-894.776] * [-893.728] (-892.175) (-894.823) (-893.402) -- 0:00:32
484000 -- (-892.932) (-892.444) [-895.555] (-896.913) * (-892.894) (-893.031) (-895.083) [-898.399] -- 0:00:31
484500 -- (-894.554) [-892.374] (-897.243) (-895.489) * [-893.237] (-892.498) (-895.613) (-892.528) -- 0:00:31
485000 -- (-896.708) (-892.221) [-893.101] (-895.520) * (-892.016) [-894.390] (-891.825) (-891.956) -- 0:00:31
Average standard deviation of split frequencies: 0.009639
485500 -- (-897.641) (-894.538) [-894.945] (-895.395) * (-891.265) [-891.875] (-893.516) (-893.118) -- 0:00:31
486000 -- (-894.460) [-894.166] (-894.726) (-895.254) * (-891.133) [-895.665] (-893.454) (-892.844) -- 0:00:31
486500 -- (-894.533) [-895.003] (-894.446) (-893.161) * (-891.487) (-892.256) (-892.403) [-891.571] -- 0:00:31
487000 -- [-895.508] (-893.450) (-895.375) (-897.142) * (-894.978) (-892.689) (-892.854) [-894.091] -- 0:00:31
487500 -- (-895.173) [-896.234] (-893.780) (-900.140) * [-893.917] (-893.123) (-893.694) (-899.328) -- 0:00:31
488000 -- (-900.048) (-896.327) [-892.136] (-896.648) * [-895.660] (-893.386) (-891.217) (-899.247) -- 0:00:31
488500 -- (-900.310) (-895.152) (-892.658) [-891.840] * [-894.817] (-894.604) (-891.402) (-893.574) -- 0:00:31
489000 -- (-892.265) [-894.732] (-894.255) (-894.694) * [-895.449] (-897.813) (-897.775) (-895.721) -- 0:00:31
489500 -- (-894.250) (-894.832) [-893.771] (-892.877) * [-891.458] (-896.520) (-893.740) (-891.137) -- 0:00:31
490000 -- (-895.685) (-892.535) (-895.260) [-893.126] * (-893.861) (-892.041) (-892.803) [-895.012] -- 0:00:31
Average standard deviation of split frequencies: 0.009287
490500 -- [-891.340] (-893.309) (-894.025) (-894.254) * (-891.774) (-895.536) (-894.460) [-892.304] -- 0:00:31
491000 -- (-892.281) (-895.445) [-892.035] (-893.580) * (-892.585) [-894.355] (-894.282) (-891.409) -- 0:00:31
491500 -- (-893.885) (-899.254) (-892.449) [-892.224] * (-893.698) (-895.563) [-894.155] (-895.338) -- 0:00:31
492000 -- (-892.555) (-894.088) [-891.724] (-891.724) * (-893.612) [-893.621] (-894.032) (-892.263) -- 0:00:30
492500 -- (-893.960) [-895.152] (-893.533) (-893.917) * [-894.244] (-892.123) (-892.780) (-892.534) -- 0:00:30
493000 -- (-892.911) (-894.602) (-896.024) [-892.148] * (-891.870) [-891.637] (-896.868) (-892.075) -- 0:00:30
493500 -- (-892.498) (-892.679) [-897.429] (-895.169) * [-893.046] (-892.139) (-893.144) (-893.692) -- 0:00:30
494000 -- (-899.304) [-898.606] (-899.991) (-891.297) * (-896.168) [-891.003] (-893.107) (-896.687) -- 0:00:31
494500 -- (-898.932) [-895.662] (-892.488) (-891.577) * [-894.106] (-892.288) (-893.355) (-895.145) -- 0:00:31
495000 -- [-892.879] (-892.579) (-894.752) (-892.592) * (-895.994) (-892.904) (-894.509) [-892.668] -- 0:00:31
Average standard deviation of split frequencies: 0.009979
495500 -- [-892.033] (-892.631) (-892.599) (-892.737) * (-892.578) [-892.025] (-893.663) (-896.229) -- 0:00:31
496000 -- (-893.091) [-893.539] (-896.056) (-892.547) * (-892.706) (-895.607) (-892.022) [-892.168] -- 0:00:31
496500 -- [-896.054] (-892.008) (-895.168) (-895.371) * (-893.385) (-896.207) (-892.285) [-892.167] -- 0:00:31
497000 -- (-893.030) [-892.550] (-895.173) (-894.161) * (-892.790) (-892.580) [-892.378] (-891.894) -- 0:00:31
497500 -- (-894.847) (-895.096) [-892.455] (-893.309) * (-894.230) (-892.380) [-895.063] (-894.932) -- 0:00:31
498000 -- (-892.398) (-892.888) [-894.838] (-892.171) * (-893.984) (-893.007) [-895.680] (-891.666) -- 0:00:31
498500 -- (-895.188) (-891.896) (-891.305) [-892.164] * [-893.608] (-898.462) (-895.954) (-893.765) -- 0:00:31
499000 -- [-893.280] (-892.865) (-893.708) (-892.910) * (-893.991) (-896.297) (-894.042) [-891.840] -- 0:00:31
499500 -- (-896.132) (-897.107) (-896.209) [-891.420] * (-899.482) (-891.661) (-895.503) [-892.472] -- 0:00:31
500000 -- [-892.032] (-896.084) (-893.484) (-891.658) * (-896.262) [-894.784] (-893.542) (-892.933) -- 0:00:31
Average standard deviation of split frequencies: 0.008976
500500 -- (-891.745) (-894.070) (-892.931) [-892.464] * (-893.505) [-891.624] (-892.653) (-895.622) -- 0:00:30
501000 -- [-892.078] (-893.503) (-894.454) (-894.200) * [-894.710] (-891.644) (-891.324) (-892.730) -- 0:00:30
501500 -- [-892.124] (-892.811) (-893.015) (-891.492) * [-893.425] (-892.915) (-896.294) (-892.040) -- 0:00:30
502000 -- (-891.845) [-892.499] (-893.732) (-891.478) * (-895.678) (-893.228) [-893.145] (-891.920) -- 0:00:30
502500 -- (-892.740) [-892.167] (-896.483) (-894.346) * (-893.070) [-893.539] (-892.573) (-897.240) -- 0:00:30
503000 -- (-897.721) (-891.644) [-894.274] (-894.574) * (-894.089) (-891.765) (-896.081) [-893.640] -- 0:00:30
503500 -- (-893.929) [-892.601] (-894.648) (-898.186) * (-894.512) (-893.919) [-897.597] (-892.275) -- 0:00:30
504000 -- [-893.543] (-892.801) (-892.969) (-891.527) * [-891.730] (-896.995) (-893.314) (-892.339) -- 0:00:30
504500 -- [-894.816] (-892.132) (-894.853) (-891.426) * (-891.725) (-893.010) (-894.154) [-893.024] -- 0:00:30
505000 -- (-894.680) (-891.392) [-893.217] (-897.359) * (-892.033) (-894.403) (-892.215) [-894.020] -- 0:00:30
Average standard deviation of split frequencies: 0.009724
505500 -- (-893.743) (-891.850) [-891.575] (-894.540) * (-891.662) (-894.438) [-891.823] (-894.273) -- 0:00:30
506000 -- (-893.162) (-892.447) [-893.056] (-894.113) * (-896.686) (-893.685) [-891.237] (-893.072) -- 0:00:30
506500 -- (-892.055) (-893.756) (-893.731) [-893.324] * [-893.322] (-893.667) (-894.012) (-893.458) -- 0:00:30
507000 -- (-893.419) (-895.079) (-891.576) [-893.419] * (-891.116) [-893.140] (-896.814) (-892.662) -- 0:00:30
507500 -- (-892.728) (-894.339) [-891.327] (-893.030) * (-891.301) (-894.816) [-895.905] (-894.327) -- 0:00:30
508000 -- (-892.361) (-892.447) (-894.374) [-892.549] * (-892.237) (-892.934) [-892.831] (-893.304) -- 0:00:30
508500 -- (-894.809) (-892.183) [-894.265] (-898.126) * (-893.890) [-892.518] (-892.630) (-895.438) -- 0:00:29
509000 -- [-892.829] (-895.383) (-893.608) (-892.285) * (-891.971) (-892.646) (-894.780) [-892.245] -- 0:00:29
509500 -- [-895.920] (-892.265) (-891.716) (-895.380) * (-892.127) (-893.378) (-893.747) [-891.864] -- 0:00:29
510000 -- (-896.162) (-893.804) [-891.981] (-894.333) * (-893.568) (-892.099) (-892.538) [-893.552] -- 0:00:29
Average standard deviation of split frequencies: 0.008185
510500 -- [-894.496] (-895.759) (-893.361) (-894.140) * (-894.190) (-891.410) [-891.924] (-893.051) -- 0:00:30
511000 -- [-892.362] (-893.395) (-893.437) (-893.742) * (-892.434) (-893.025) (-892.795) [-893.778] -- 0:00:30
511500 -- (-893.543) (-894.614) (-895.538) [-892.125] * [-892.113] (-893.228) (-894.116) (-892.826) -- 0:00:30
512000 -- [-892.780] (-891.677) (-894.786) (-892.818) * [-891.817] (-893.023) (-891.885) (-895.439) -- 0:00:30
512500 -- [-892.958] (-891.979) (-898.611) (-893.088) * (-893.514) (-892.683) (-894.246) [-900.854] -- 0:00:30
513000 -- (-893.660) (-891.144) (-896.633) [-892.378] * [-892.336] (-892.391) (-892.989) (-893.469) -- 0:00:30
513500 -- (-893.385) (-891.216) (-892.667) [-892.685] * (-893.165) [-893.221] (-892.589) (-893.426) -- 0:00:30
514000 -- [-893.138] (-895.272) (-895.592) (-893.786) * (-892.951) [-891.806] (-891.710) (-893.031) -- 0:00:30
514500 -- (-893.663) [-891.648] (-901.413) (-894.676) * (-895.810) [-891.555] (-895.983) (-895.017) -- 0:00:30
515000 -- (-892.608) [-894.509] (-894.008) (-892.671) * [-893.033] (-891.841) (-898.071) (-893.626) -- 0:00:30
Average standard deviation of split frequencies: 0.007857
515500 -- (-892.281) [-891.484] (-893.738) (-895.246) * (-898.630) [-891.849] (-893.887) (-892.983) -- 0:00:30
516000 -- [-892.577] (-891.566) (-894.088) (-895.272) * (-894.346) [-894.545] (-892.436) (-892.220) -- 0:00:30
516500 -- (-896.292) (-894.528) [-892.027] (-895.307) * (-895.249) (-892.381) (-892.324) [-891.802] -- 0:00:29
517000 -- [-898.215] (-894.145) (-891.191) (-894.918) * (-893.722) [-891.356] (-892.612) (-892.785) -- 0:00:29
517500 -- (-893.681) (-893.499) [-891.893] (-894.511) * (-894.602) (-893.465) (-892.216) [-894.012] -- 0:00:29
518000 -- (-894.092) (-891.069) [-893.146] (-894.192) * [-893.679] (-894.320) (-893.496) (-896.254) -- 0:00:29
518500 -- (-893.370) [-892.383] (-891.848) (-893.131) * (-893.245) (-896.000) (-891.588) [-891.630] -- 0:00:29
519000 -- (-894.217) (-893.062) [-893.718] (-897.273) * (-891.940) [-897.617] (-893.983) (-895.999) -- 0:00:29
519500 -- [-893.387] (-895.947) (-893.653) (-894.462) * (-892.203) (-894.582) [-892.136] (-891.572) -- 0:00:29
520000 -- (-891.596) (-894.772) (-892.298) [-893.653] * (-891.727) [-896.275] (-891.961) (-891.820) -- 0:00:29
Average standard deviation of split frequencies: 0.007967
520500 -- (-892.868) (-897.469) [-893.884] (-894.722) * (-893.016) (-895.161) [-891.737] (-892.260) -- 0:00:29
521000 -- (-895.692) (-892.934) [-894.632] (-898.713) * [-893.406] (-893.335) (-891.747) (-891.165) -- 0:00:29
521500 -- (-896.242) (-894.221) [-893.395] (-894.991) * (-893.694) (-894.934) (-892.578) [-891.320] -- 0:00:29
522000 -- (-893.724) (-892.644) (-893.203) [-893.395] * [-892.179] (-893.896) (-892.812) (-895.237) -- 0:00:29
522500 -- (-893.500) [-892.688] (-895.812) (-894.862) * (-896.295) (-895.535) [-891.985] (-891.612) -- 0:00:29
523000 -- [-893.265] (-893.808) (-897.102) (-895.554) * (-892.985) [-892.863] (-898.104) (-892.386) -- 0:00:29
523500 -- (-892.603) (-893.604) [-891.858] (-895.838) * (-895.352) [-898.129] (-897.593) (-891.704) -- 0:00:29
524000 -- (-893.205) (-892.460) (-892.274) [-895.504] * (-894.107) [-897.393] (-896.137) (-891.917) -- 0:00:29
524500 -- [-894.792] (-893.415) (-895.882) (-895.862) * (-894.918) (-899.579) (-892.237) [-894.058] -- 0:00:29
525000 -- (-891.214) (-893.024) [-894.288] (-892.500) * (-894.947) (-894.980) [-894.167] (-895.485) -- 0:00:28
Average standard deviation of split frequencies: 0.008245
525500 -- (-892.795) [-893.169] (-892.960) (-891.849) * [-892.988] (-892.997) (-895.218) (-894.013) -- 0:00:28
526000 -- (-892.457) (-893.907) [-895.343] (-894.091) * (-891.719) (-895.115) (-891.048) [-892.435] -- 0:00:28
526500 -- (-892.481) (-894.716) [-891.791] (-894.443) * (-892.017) [-896.401] (-891.400) (-895.643) -- 0:00:28
527000 -- [-895.463] (-894.991) (-891.568) (-899.469) * [-894.356] (-892.632) (-891.570) (-892.971) -- 0:00:28
527500 -- (-892.987) (-893.385) (-892.631) [-892.430] * (-895.187) [-893.605] (-891.643) (-893.853) -- 0:00:29
528000 -- (-892.830) (-892.436) [-893.575] (-892.476) * (-891.792) (-894.851) [-894.349] (-894.289) -- 0:00:29
528500 -- [-895.661] (-893.482) (-895.276) (-895.342) * (-894.844) [-893.428] (-892.500) (-892.606) -- 0:00:29
529000 -- [-891.716] (-892.883) (-898.375) (-891.895) * (-895.049) (-894.624) [-895.728] (-892.476) -- 0:00:29
529500 -- (-892.831) (-893.097) [-896.271] (-893.081) * (-892.699) [-894.412] (-894.460) (-893.835) -- 0:00:29
530000 -- (-894.059) (-893.023) (-895.015) [-895.265] * (-896.646) [-899.089] (-892.032) (-894.490) -- 0:00:29
Average standard deviation of split frequencies: 0.008350
530500 -- [-894.375] (-892.964) (-891.452) (-892.808) * (-892.969) (-893.746) (-896.788) [-892.104] -- 0:00:29
531000 -- [-893.840] (-893.215) (-897.090) (-892.945) * (-898.150) (-893.862) [-894.599] (-897.565) -- 0:00:29
531500 -- (-894.705) (-893.983) (-901.774) [-891.639] * (-896.003) (-895.986) [-893.425] (-894.264) -- 0:00:29
532000 -- (-892.841) (-901.324) (-896.598) [-891.813] * (-897.648) (-894.169) [-891.836] (-895.302) -- 0:00:29
532500 -- (-895.088) [-892.340] (-893.152) (-891.677) * [-893.904] (-894.872) (-897.511) (-896.872) -- 0:00:28
533000 -- [-891.970] (-895.823) (-892.900) (-893.574) * (-892.281) (-893.379) (-897.805) [-892.557] -- 0:00:28
533500 -- (-891.974) [-892.118] (-893.696) (-894.194) * (-892.056) [-893.406] (-900.467) (-892.130) -- 0:00:28
534000 -- (-891.394) (-893.902) [-892.784] (-901.701) * (-896.893) (-892.410) (-896.994) [-892.402] -- 0:00:28
534500 -- [-893.046] (-894.897) (-892.267) (-893.423) * (-893.400) [-893.336] (-892.891) (-893.350) -- 0:00:28
535000 -- (-893.237) (-891.166) (-892.189) [-891.819] * [-895.982] (-895.176) (-891.505) (-894.308) -- 0:00:28
Average standard deviation of split frequencies: 0.008209
535500 -- (-896.133) (-891.169) (-892.623) [-892.064] * (-898.814) (-892.227) [-892.095] (-898.299) -- 0:00:28
536000 -- (-893.885) [-892.980] (-893.763) (-895.109) * (-891.034) (-895.321) [-893.032] (-896.540) -- 0:00:28
536500 -- (-892.954) (-893.077) (-891.379) [-893.770] * (-893.725) (-893.939) (-897.747) [-891.716] -- 0:00:28
537000 -- (-895.097) (-897.597) (-893.013) [-891.282] * (-896.613) (-893.516) [-891.868] (-894.381) -- 0:00:28
537500 -- [-895.985] (-895.852) (-893.438) (-895.276) * (-894.113) (-893.014) [-896.007] (-892.858) -- 0:00:28
538000 -- [-892.116] (-892.359) (-893.044) (-894.249) * (-895.261) [-896.270] (-895.859) (-892.807) -- 0:00:28
538500 -- [-892.857] (-893.047) (-892.762) (-894.083) * (-895.618) (-893.215) [-893.004] (-893.801) -- 0:00:28
539000 -- [-893.429] (-892.014) (-893.890) (-896.476) * [-900.375] (-893.776) (-893.057) (-892.129) -- 0:00:28
539500 -- (-893.122) [-891.356] (-898.334) (-891.815) * (-897.600) [-891.179] (-891.459) (-891.731) -- 0:00:28
540000 -- (-893.058) [-891.859] (-899.091) (-891.193) * (-895.242) (-892.606) (-891.452) [-892.275] -- 0:00:28
Average standard deviation of split frequencies: 0.007905
540500 -- (-893.204) [-891.890] (-894.682) (-894.417) * [-892.244] (-894.738) (-891.417) (-891.504) -- 0:00:28
541000 -- (-892.844) (-896.851) (-892.699) [-897.027] * (-893.052) (-894.617) [-893.205] (-892.149) -- 0:00:27
541500 -- (-893.523) [-893.651] (-891.637) (-893.416) * (-892.546) (-893.037) [-892.817] (-892.545) -- 0:00:27
542000 -- (-895.840) (-901.431) (-893.687) [-895.028] * (-896.721) (-891.979) [-892.708] (-893.205) -- 0:00:27
542500 -- [-896.655] (-897.805) (-893.445) (-896.709) * (-893.065) (-891.335) [-893.723] (-896.249) -- 0:00:27
543000 -- [-896.223] (-894.283) (-894.153) (-899.114) * (-893.169) [-891.620] (-891.112) (-892.837) -- 0:00:27
543500 -- (-895.188) [-892.571] (-896.935) (-895.835) * (-898.609) (-892.696) [-890.969] (-893.790) -- 0:00:28
544000 -- (-895.236) (-897.037) [-892.408] (-893.668) * (-892.061) [-892.724] (-893.446) (-892.477) -- 0:00:28
544500 -- (-894.746) (-891.185) [-892.516] (-893.013) * [-893.652] (-897.945) (-895.784) (-891.942) -- 0:00:28
545000 -- (-892.494) (-894.767) [-894.236] (-891.742) * [-891.497] (-894.711) (-893.325) (-897.631) -- 0:00:28
Average standard deviation of split frequencies: 0.008116
545500 -- (-900.185) [-895.728] (-894.937) (-892.599) * (-895.683) (-894.160) [-891.521] (-895.299) -- 0:00:28
546000 -- (-892.633) (-895.769) (-896.192) [-892.439] * (-892.171) (-894.700) (-894.776) [-892.160] -- 0:00:28
546500 -- (-891.265) [-892.575] (-892.874) (-892.641) * (-891.292) (-893.328) [-893.602] (-892.135) -- 0:00:28
547000 -- (-896.069) (-899.914) (-894.708) [-892.289] * (-900.089) (-892.595) (-895.129) [-892.826] -- 0:00:28
547500 -- (-896.090) (-897.750) [-895.984] (-894.053) * (-893.699) (-893.328) [-892.472] (-895.590) -- 0:00:28
548000 -- (-896.213) (-891.837) [-892.297] (-893.356) * (-892.079) [-894.086] (-891.683) (-895.331) -- 0:00:28
548500 -- (-895.643) (-891.770) (-898.220) [-891.759] * (-893.564) [-892.543] (-891.126) (-892.003) -- 0:00:27
549000 -- (-894.092) (-892.936) [-894.521] (-892.712) * (-894.234) (-894.234) [-892.925] (-891.839) -- 0:00:27
549500 -- (-892.372) (-896.193) (-892.454) [-893.203] * (-897.446) (-892.927) (-894.716) [-891.959] -- 0:00:27
550000 -- (-896.478) (-891.554) [-892.059] (-892.579) * (-893.283) [-893.813] (-895.952) (-891.743) -- 0:00:27
Average standard deviation of split frequencies: 0.007647
550500 -- (-893.924) [-891.979] (-892.561) (-894.400) * (-895.082) [-895.411] (-893.930) (-891.713) -- 0:00:27
551000 -- (-893.862) (-893.081) [-893.153] (-894.516) * [-896.880] (-892.087) (-895.588) (-891.464) -- 0:00:27
551500 -- [-894.644] (-892.152) (-892.912) (-893.560) * (-893.914) (-892.260) (-894.960) [-891.031] -- 0:00:27
552000 -- (-892.199) [-892.085] (-893.865) (-895.838) * (-893.807) (-893.949) (-891.303) [-892.306] -- 0:00:27
552500 -- (-894.775) (-893.199) [-894.846] (-893.755) * (-892.312) (-896.091) [-892.231] (-891.919) -- 0:00:27
553000 -- [-892.612] (-897.213) (-892.723) (-891.940) * [-893.558] (-895.879) (-893.247) (-896.285) -- 0:00:27
553500 -- [-894.297] (-895.878) (-894.060) (-892.791) * (-893.862) (-891.563) (-893.198) [-891.451] -- 0:00:27
554000 -- (-897.152) (-899.114) [-892.704] (-892.712) * [-896.066] (-891.163) (-892.397) (-894.468) -- 0:00:27
554500 -- [-891.803] (-893.989) (-892.414) (-893.702) * [-891.764] (-892.417) (-896.418) (-896.635) -- 0:00:27
555000 -- (-892.872) (-893.627) [-893.420] (-892.591) * (-891.101) (-891.535) [-892.716] (-896.273) -- 0:00:27
Average standard deviation of split frequencies: 0.006952
555500 -- (-894.440) (-891.657) [-893.218] (-892.403) * [-891.829] (-893.463) (-896.249) (-893.811) -- 0:00:27
556000 -- (-893.689) (-892.091) (-893.240) [-898.302] * (-891.333) [-895.284] (-893.020) (-892.379) -- 0:00:27
556500 -- [-896.473] (-893.689) (-893.422) (-891.823) * (-892.723) (-895.325) [-895.638] (-893.437) -- 0:00:27
557000 -- (-893.653) [-892.820] (-892.893) (-894.803) * (-893.151) (-894.042) (-893.443) [-895.550] -- 0:00:27
557500 -- (-893.810) [-892.059] (-893.726) (-894.012) * (-896.391) (-893.088) [-891.936] (-892.190) -- 0:00:26
558000 -- [-892.924] (-892.884) (-893.494) (-893.133) * (-892.556) (-891.264) [-894.699] (-891.386) -- 0:00:26
558500 -- [-895.734] (-892.711) (-894.505) (-898.918) * (-893.027) [-891.643] (-893.723) (-893.871) -- 0:00:26
559000 -- [-891.013] (-893.406) (-892.838) (-893.296) * (-893.877) [-893.794] (-892.607) (-895.153) -- 0:00:26
559500 -- (-891.829) (-899.327) [-893.864] (-891.974) * (-899.298) (-893.003) [-897.955] (-892.134) -- 0:00:26
560000 -- (-892.906) (-894.886) (-893.517) [-891.756] * (-895.519) [-892.456] (-893.782) (-893.993) -- 0:00:26
Average standard deviation of split frequencies: 0.007735
560500 -- [-892.265] (-893.817) (-894.946) (-892.463) * [-895.899] (-891.302) (-892.040) (-892.176) -- 0:00:27
561000 -- (-902.176) (-895.673) [-892.101] (-893.647) * [-891.689] (-893.076) (-891.237) (-897.800) -- 0:00:27
561500 -- (-898.536) (-896.094) (-893.846) [-893.571] * (-893.237) (-892.693) [-891.187] (-893.147) -- 0:00:27
562000 -- (-896.802) (-894.641) [-895.917] (-894.420) * (-895.588) [-894.729] (-892.889) (-892.262) -- 0:00:27
562500 -- (-896.445) (-895.049) (-893.685) [-893.329] * (-895.881) (-896.132) (-892.696) [-891.418] -- 0:00:27
563000 -- (-894.392) [-892.983] (-891.497) (-892.438) * (-893.473) (-896.695) [-892.618] (-893.403) -- 0:00:27
563500 -- (-894.959) [-893.051] (-891.577) (-893.081) * (-893.289) [-892.426] (-893.474) (-892.762) -- 0:00:27
564000 -- (-893.621) (-892.880) (-892.240) [-891.758] * (-893.696) [-894.255] (-893.560) (-896.000) -- 0:00:27
564500 -- [-891.316] (-891.759) (-895.878) (-894.434) * (-892.763) (-893.260) (-891.191) [-892.017] -- 0:00:27
565000 -- (-894.418) (-894.069) (-907.131) [-891.412] * (-893.561) [-893.124] (-893.507) (-891.845) -- 0:00:26
Average standard deviation of split frequencies: 0.007218
565500 -- (-894.107) (-893.332) (-893.081) [-892.862] * (-893.090) (-891.672) (-891.873) [-893.213] -- 0:00:26
566000 -- [-896.116] (-893.273) (-894.996) (-891.796) * (-893.544) (-893.287) [-893.341] (-894.626) -- 0:00:26
566500 -- (-894.073) (-893.190) (-891.751) [-893.260] * (-891.747) [-891.455] (-894.685) (-892.650) -- 0:00:26
567000 -- (-893.704) (-890.911) (-891.727) [-893.421] * [-893.240] (-893.808) (-893.461) (-894.458) -- 0:00:26
567500 -- (-894.353) (-891.351) [-892.159] (-893.963) * [-891.929] (-892.268) (-894.519) (-894.872) -- 0:00:26
568000 -- (-896.899) (-896.326) (-892.054) [-893.684] * (-895.318) [-891.475] (-895.091) (-893.649) -- 0:00:26
568500 -- (-892.540) (-895.890) (-891.690) [-891.981] * (-892.243) [-892.281] (-895.005) (-892.614) -- 0:00:26
569000 -- (-891.359) [-893.038] (-894.336) (-891.933) * [-893.071] (-893.765) (-896.182) (-897.718) -- 0:00:26
569500 -- [-891.788] (-893.937) (-893.458) (-893.574) * (-893.344) (-892.748) (-897.591) [-894.651] -- 0:00:26
570000 -- [-892.096] (-892.565) (-891.950) (-891.613) * (-895.450) (-892.018) (-896.264) [-895.042] -- 0:00:26
Average standard deviation of split frequencies: 0.007324
570500 -- (-899.546) (-895.445) [-891.110] (-892.022) * [-893.802] (-894.484) (-899.212) (-895.600) -- 0:00:26
571000 -- [-897.155] (-892.393) (-892.046) (-891.491) * [-894.913] (-895.290) (-894.488) (-893.396) -- 0:00:26
571500 -- (-894.374) [-891.775] (-893.811) (-891.268) * [-893.904] (-893.349) (-891.793) (-895.690) -- 0:00:26
572000 -- (-902.427) (-891.492) [-893.169] (-891.301) * (-894.688) [-897.811] (-893.423) (-894.613) -- 0:00:26
572500 -- (-892.046) (-891.307) [-891.869] (-891.301) * [-892.322] (-894.340) (-893.422) (-892.967) -- 0:00:26
573000 -- [-892.816] (-892.527) (-891.863) (-892.629) * (-899.855) [-891.757] (-893.285) (-896.618) -- 0:00:26
573500 -- (-892.628) [-891.939] (-894.011) (-891.241) * (-893.704) (-891.680) [-893.383] (-896.171) -- 0:00:26
574000 -- [-895.444] (-895.878) (-894.610) (-892.928) * [-893.936] (-894.052) (-893.770) (-891.894) -- 0:00:25
574500 -- (-894.355) (-894.594) (-893.374) [-892.713] * (-896.737) [-895.749] (-894.652) (-891.595) -- 0:00:25
575000 -- (-892.635) (-893.048) [-891.733] (-891.795) * [-896.631] (-891.953) (-894.487) (-891.536) -- 0:00:25
Average standard deviation of split frequencies: 0.007257
575500 -- [-892.988] (-892.009) (-892.431) (-890.860) * [-897.915] (-891.420) (-893.250) (-894.345) -- 0:00:25
576000 -- (-892.928) (-893.183) [-893.401] (-892.019) * (-892.093) (-891.808) (-894.277) [-891.693] -- 0:00:25
576500 -- [-892.108] (-891.911) (-893.498) (-893.842) * (-891.580) [-892.862] (-891.367) (-891.245) -- 0:00:25
577000 -- (-894.303) (-891.155) (-894.409) [-891.699] * [-893.828] (-892.444) (-893.464) (-893.463) -- 0:00:26
577500 -- (-893.822) (-891.713) [-894.822] (-892.871) * (-891.182) [-892.627] (-894.708) (-891.999) -- 0:00:26
578000 -- (-893.529) [-894.604] (-892.853) (-897.934) * (-893.204) [-898.366] (-894.344) (-894.369) -- 0:00:26
578500 -- (-893.529) (-897.413) [-893.028] (-898.354) * (-891.076) (-895.178) [-892.451] (-892.131) -- 0:00:26
579000 -- (-892.514) (-892.641) (-892.291) [-893.318] * (-891.484) (-892.652) [-893.563] (-894.905) -- 0:00:26
579500 -- [-891.562] (-891.745) (-894.078) (-894.939) * (-891.920) (-893.170) [-891.614] (-894.468) -- 0:00:26
580000 -- (-893.892) [-892.871] (-894.964) (-894.192) * (-894.488) (-891.533) [-895.014] (-892.749) -- 0:00:26
Average standard deviation of split frequencies: 0.007144
580500 -- (-892.491) [-891.788] (-891.826) (-892.519) * (-892.496) [-892.270] (-892.319) (-893.249) -- 0:00:26
581000 -- (-893.399) [-892.612] (-894.647) (-893.504) * [-891.509] (-892.874) (-892.373) (-892.453) -- 0:00:25
581500 -- (-897.691) [-894.492] (-892.621) (-892.018) * (-891.717) [-892.158] (-892.709) (-895.646) -- 0:00:25
582000 -- (-894.701) (-891.795) [-891.976] (-894.887) * [-894.293] (-895.095) (-895.565) (-894.367) -- 0:00:25
582500 -- (-898.364) (-892.934) [-894.799] (-896.484) * (-894.601) [-893.173] (-895.912) (-891.851) -- 0:00:25
583000 -- (-894.604) [-891.606] (-894.561) (-896.247) * (-897.000) (-891.720) [-896.328] (-892.333) -- 0:00:25
583500 -- (-897.781) (-895.250) (-893.681) [-894.991] * [-896.222] (-893.276) (-899.259) (-891.550) -- 0:00:25
584000 -- (-893.629) (-894.694) (-893.099) [-895.140] * (-895.283) (-892.888) [-892.418] (-895.822) -- 0:00:25
584500 -- (-895.651) (-891.843) (-891.885) [-893.849] * [-895.070] (-892.503) (-893.695) (-893.308) -- 0:00:25
585000 -- (-891.538) (-894.366) (-891.958) [-895.379] * [-892.982] (-897.819) (-893.818) (-895.077) -- 0:00:25
Average standard deviation of split frequencies: 0.007025
585500 -- (-891.262) [-892.666] (-892.970) (-895.267) * (-894.215) [-892.719] (-891.630) (-894.286) -- 0:00:25
586000 -- (-892.583) (-891.942) (-893.688) [-891.627] * [-892.684] (-894.306) (-891.231) (-897.672) -- 0:00:25
586500 -- (-893.751) (-894.328) [-895.137] (-896.770) * (-894.938) (-893.046) (-892.126) [-899.624] -- 0:00:25
587000 -- [-892.987] (-894.526) (-893.406) (-891.263) * (-895.783) [-893.054] (-895.343) (-892.142) -- 0:00:25
587500 -- (-893.733) (-892.230) (-893.483) [-891.625] * [-892.466] (-895.286) (-900.142) (-895.210) -- 0:00:25
588000 -- [-897.885] (-892.283) (-893.294) (-893.182) * [-892.165] (-894.413) (-896.549) (-896.035) -- 0:00:25
588500 -- (-895.213) (-896.204) [-893.317] (-895.559) * (-892.516) [-892.761] (-896.312) (-895.884) -- 0:00:25
589000 -- (-892.098) (-896.915) [-896.217] (-892.162) * (-897.653) [-893.375] (-893.667) (-891.232) -- 0:00:25
589500 -- (-891.238) (-898.949) (-898.024) [-892.759] * [-893.318] (-893.681) (-891.304) (-891.734) -- 0:00:25
590000 -- (-891.148) (-892.379) [-893.452] (-892.827) * (-894.184) [-892.489] (-895.330) (-892.025) -- 0:00:25
Average standard deviation of split frequencies: 0.007342
590500 -- (-892.308) [-894.549] (-895.679) (-892.969) * (-893.153) (-895.163) (-898.407) [-891.922] -- 0:00:24
591000 -- (-893.746) [-893.844] (-892.753) (-894.467) * [-892.577] (-893.132) (-891.836) (-892.750) -- 0:00:24
591500 -- [-892.430] (-897.729) (-891.694) (-891.956) * (-893.121) (-894.329) [-891.462] (-892.832) -- 0:00:24
592000 -- (-895.331) [-894.169] (-893.244) (-891.350) * (-898.512) (-891.757) (-893.326) [-892.817] -- 0:00:24
592500 -- (-896.691) (-892.297) (-892.470) [-896.183] * (-896.824) (-892.647) (-894.049) [-895.505] -- 0:00:24
593000 -- (-898.548) (-892.690) [-891.888] (-892.891) * (-892.409) (-892.147) [-894.214] (-896.300) -- 0:00:24
593500 -- [-895.032] (-893.735) (-895.044) (-897.072) * [-895.602] (-892.899) (-895.362) (-894.767) -- 0:00:25
594000 -- [-892.189] (-892.248) (-892.757) (-897.656) * (-895.728) [-892.889] (-892.521) (-893.036) -- 0:00:25
594500 -- [-894.910] (-891.432) (-892.632) (-895.011) * (-893.837) [-892.464] (-891.908) (-893.242) -- 0:00:25
595000 -- (-895.245) (-895.866) (-893.673) [-891.688] * (-892.537) (-892.464) [-893.464] (-897.953) -- 0:00:25
Average standard deviation of split frequencies: 0.007699
595500 -- (-891.650) (-897.183) (-892.621) [-891.758] * (-893.390) (-891.502) [-893.805] (-893.552) -- 0:00:25
596000 -- [-891.566] (-895.459) (-892.613) (-891.483) * (-895.314) (-894.137) (-891.101) [-893.288] -- 0:00:25
596500 -- (-892.752) [-893.704] (-891.900) (-891.676) * (-892.954) (-891.378) [-892.328] (-893.652) -- 0:00:25
597000 -- [-892.352] (-896.299) (-895.857) (-892.743) * (-895.053) (-891.360) [-893.906] (-894.760) -- 0:00:24
597500 -- (-893.258) (-893.634) (-892.635) [-893.788] * (-892.596) (-892.124) (-893.908) [-893.102] -- 0:00:24
598000 -- (-893.164) (-893.308) [-891.793] (-892.145) * (-893.751) (-893.805) [-893.564] (-892.522) -- 0:00:24
598500 -- (-891.387) (-896.439) [-893.111] (-893.310) * (-891.765) (-891.946) [-891.303] (-892.646) -- 0:00:24
599000 -- [-891.590] (-896.372) (-892.405) (-892.294) * (-895.100) [-893.618] (-892.319) (-892.090) -- 0:00:24
599500 -- (-893.782) (-894.147) [-895.325] (-892.666) * (-891.678) (-892.772) (-895.318) [-894.049] -- 0:00:24
600000 -- (-893.493) (-893.738) (-897.031) [-893.189] * (-893.784) [-892.141] (-901.012) (-896.678) -- 0:00:24
Average standard deviation of split frequencies: 0.008267
600500 -- (-893.095) (-894.199) [-895.850] (-893.541) * [-893.117] (-896.878) (-900.857) (-894.043) -- 0:00:24
601000 -- (-891.553) (-892.389) (-896.153) [-891.851] * [-896.858] (-895.588) (-893.057) (-892.717) -- 0:00:24
601500 -- (-893.964) (-892.666) [-895.465] (-893.254) * [-894.164] (-892.239) (-891.438) (-894.584) -- 0:00:24
602000 -- (-892.354) (-893.653) [-893.276] (-893.647) * [-892.581] (-892.508) (-893.790) (-896.396) -- 0:00:24
602500 -- (-892.670) (-894.448) [-892.449] (-891.134) * (-894.150) [-892.068] (-892.407) (-891.494) -- 0:00:24
603000 -- [-892.388] (-895.591) (-893.321) (-892.963) * [-893.002] (-893.646) (-897.183) (-894.764) -- 0:00:24
603500 -- (-894.584) [-895.885] (-891.099) (-892.296) * (-893.666) (-892.258) (-896.427) [-893.654] -- 0:00:24
604000 -- [-892.497] (-892.360) (-891.150) (-893.780) * [-893.028] (-894.170) (-892.892) (-892.933) -- 0:00:24
604500 -- (-891.426) [-892.215] (-891.086) (-895.666) * (-891.760) (-893.650) (-895.862) [-893.996] -- 0:00:24
605000 -- (-891.997) [-895.448] (-896.717) (-896.617) * [-895.836] (-892.597) (-891.890) (-893.060) -- 0:00:24
Average standard deviation of split frequencies: 0.008505
605500 -- [-893.357] (-896.906) (-898.759) (-895.236) * (-895.289) [-893.586] (-891.664) (-894.681) -- 0:00:24
606000 -- (-891.722) [-895.989] (-893.801) (-895.894) * (-892.526) (-895.512) [-894.666] (-892.049) -- 0:00:24
606500 -- (-893.078) [-893.324] (-897.158) (-894.097) * (-895.324) [-895.471] (-895.518) (-892.237) -- 0:00:24
607000 -- (-892.188) [-892.295] (-896.494) (-892.930) * (-892.209) (-893.723) (-892.010) [-893.787] -- 0:00:23
607500 -- (-893.608) (-892.759) [-891.761] (-894.700) * [-894.555] (-895.959) (-893.133) (-892.688) -- 0:00:23
608000 -- (-898.704) (-896.340) [-891.866] (-894.860) * (-891.594) [-895.404] (-894.534) (-892.727) -- 0:00:23
608500 -- (-893.525) (-893.903) [-895.367] (-892.359) * (-892.672) (-896.555) [-892.653] (-894.414) -- 0:00:23
609000 -- (-892.301) [-893.125] (-895.363) (-893.068) * (-892.475) (-893.385) [-891.838] (-894.744) -- 0:00:23
609500 -- (-891.767) [-893.010] (-891.516) (-892.348) * (-891.327) (-893.557) (-892.517) [-891.488] -- 0:00:23
610000 -- (-892.040) (-892.790) [-893.151] (-892.858) * (-892.780) [-892.703] (-895.942) (-891.619) -- 0:00:24
Average standard deviation of split frequencies: 0.009456
610500 -- (-897.935) (-894.179) (-893.186) [-895.762] * (-892.596) (-891.818) (-896.744) [-896.512] -- 0:00:24
611000 -- (-898.061) [-891.693] (-894.009) (-896.109) * (-897.746) (-892.374) (-896.920) [-893.491] -- 0:00:24
611500 -- (-895.182) [-891.608] (-895.130) (-894.666) * (-894.956) (-894.756) (-894.582) [-896.519] -- 0:00:24
612000 -- (-896.925) [-891.520] (-893.761) (-892.709) * [-891.555] (-891.068) (-895.635) (-892.796) -- 0:00:24
612500 -- (-892.847) [-892.677] (-891.739) (-893.042) * [-896.032] (-891.097) (-892.691) (-894.661) -- 0:00:24
613000 -- (-892.846) (-892.955) (-891.577) [-894.784] * (-892.989) [-895.758] (-894.635) (-893.317) -- 0:00:23
613500 -- (-894.679) (-893.829) [-892.005] (-893.312) * (-895.369) (-893.041) [-900.662] (-893.028) -- 0:00:23
614000 -- [-892.897] (-893.639) (-895.940) (-894.884) * (-894.241) [-895.474] (-895.158) (-897.032) -- 0:00:23
614500 -- [-891.381] (-893.417) (-891.041) (-891.435) * [-893.795] (-892.083) (-892.299) (-893.514) -- 0:00:23
615000 -- (-893.732) [-892.440] (-893.273) (-893.056) * [-891.625] (-892.794) (-891.838) (-892.758) -- 0:00:23
Average standard deviation of split frequencies: 0.008265
615500 -- (-893.243) [-892.290] (-891.134) (-895.297) * (-892.648) (-892.245) [-891.467] (-894.532) -- 0:00:23
616000 -- (-892.923) (-890.980) [-894.139] (-893.595) * (-894.009) (-894.638) (-895.635) [-892.453] -- 0:00:23
616500 -- (-893.294) [-891.642] (-893.091) (-899.599) * (-893.551) (-892.057) [-892.376] (-894.354) -- 0:00:23
617000 -- (-892.754) [-892.978] (-893.328) (-900.905) * (-904.097) (-893.610) [-893.808] (-893.061) -- 0:00:23
617500 -- (-891.757) [-892.609] (-895.099) (-892.040) * (-897.294) (-893.124) (-895.541) [-892.400] -- 0:00:23
618000 -- (-894.197) (-896.551) (-895.369) [-891.639] * [-891.198] (-892.045) (-894.702) (-892.818) -- 0:00:23
618500 -- [-893.283] (-893.203) (-895.852) (-892.766) * [-892.066] (-891.964) (-892.473) (-892.513) -- 0:00:23
619000 -- (-893.993) (-892.849) (-893.284) [-893.721] * (-895.236) [-892.826] (-895.077) (-893.339) -- 0:00:23
619500 -- (-891.866) [-892.499] (-891.789) (-892.257) * [-895.494] (-893.188) (-902.585) (-891.624) -- 0:00:23
620000 -- (-892.648) (-892.603) [-891.749] (-892.095) * (-892.512) (-892.298) [-895.972] (-891.694) -- 0:00:23
Average standard deviation of split frequencies: 0.008253
620500 -- (-891.315) (-893.026) [-896.229] (-893.860) * (-895.007) [-891.545] (-897.730) (-891.723) -- 0:00:23
621000 -- (-893.606) (-891.903) (-897.796) [-895.889] * [-892.512] (-893.331) (-892.140) (-892.391) -- 0:00:23
621500 -- [-892.206] (-892.433) (-899.442) (-897.655) * (-892.260) (-894.067) [-892.270] (-895.230) -- 0:00:23
622000 -- (-892.935) [-893.358] (-894.932) (-894.231) * (-892.003) (-891.369) (-891.831) [-891.398] -- 0:00:23
622500 -- (-894.088) (-894.063) [-892.743] (-895.102) * (-896.185) (-893.346) [-891.881] (-891.858) -- 0:00:23
623000 -- (-896.913) (-893.575) (-891.300) [-896.775] * (-897.833) [-892.689] (-892.199) (-896.263) -- 0:00:22
623500 -- (-893.305) (-892.904) [-893.299] (-894.673) * (-897.399) (-892.108) [-892.780] (-897.152) -- 0:00:22
624000 -- (-893.977) (-895.374) (-898.610) [-892.129] * [-891.529] (-893.535) (-893.271) (-895.630) -- 0:00:22
624500 -- (-891.846) (-895.899) (-894.024) [-894.058] * (-894.793) (-893.315) [-891.773] (-891.805) -- 0:00:22
625000 -- (-891.378) [-896.365] (-894.064) (-895.029) * (-894.131) [-893.981] (-893.657) (-894.843) -- 0:00:22
Average standard deviation of split frequencies: 0.008095
625500 -- (-891.664) (-891.952) (-895.040) [-893.527] * (-895.338) (-892.688) [-893.784] (-893.178) -- 0:00:22
626000 -- [-891.204] (-893.916) (-895.866) (-892.740) * [-894.336] (-894.148) (-894.480) (-892.126) -- 0:00:22
626500 -- (-894.044) (-894.033) (-893.992) [-892.758] * (-892.754) (-893.593) [-891.798] (-894.545) -- 0:00:22
627000 -- (-892.397) (-893.230) (-893.439) [-893.606] * (-891.548) (-892.392) [-893.232] (-893.600) -- 0:00:23
627500 -- [-893.947] (-894.552) (-892.851) (-893.227) * (-893.551) (-894.423) (-895.345) [-892.182] -- 0:00:23
628000 -- (-891.062) (-891.329) (-895.951) [-892.061] * (-892.335) (-893.316) [-891.370] (-892.102) -- 0:00:23
628500 -- (-891.453) (-891.243) (-893.738) [-891.759] * [-891.775] (-897.129) (-895.723) (-892.555) -- 0:00:23
629000 -- (-891.972) (-892.120) [-894.079] (-892.057) * (-892.701) [-893.603] (-895.304) (-891.701) -- 0:00:23
629500 -- (-905.158) (-894.242) (-898.959) [-894.356] * [-891.714] (-894.619) (-895.236) (-893.369) -- 0:00:22
630000 -- (-895.072) (-895.369) (-895.417) [-893.087] * [-896.277] (-896.149) (-894.717) (-892.487) -- 0:00:22
Average standard deviation of split frequencies: 0.008362
630500 -- (-893.923) (-894.648) (-893.315) [-892.414] * (-894.077) [-894.174] (-891.816) (-893.170) -- 0:00:22
631000 -- (-895.174) [-893.524] (-894.670) (-897.239) * (-892.478) (-893.276) [-893.575] (-892.369) -- 0:00:22
631500 -- [-894.206] (-894.109) (-892.476) (-894.034) * [-893.721] (-893.998) (-894.510) (-896.932) -- 0:00:22
632000 -- (-899.605) (-892.904) [-893.157] (-894.341) * (-896.353) (-892.430) [-893.881] (-893.317) -- 0:00:22
632500 -- [-891.711] (-893.550) (-893.151) (-893.292) * (-895.781) (-893.349) (-896.829) [-892.715] -- 0:00:22
633000 -- [-893.770] (-892.507) (-894.594) (-892.958) * [-891.494] (-897.180) (-892.887) (-893.288) -- 0:00:22
633500 -- [-894.110] (-892.196) (-895.716) (-892.147) * (-891.675) (-894.995) [-891.745] (-893.931) -- 0:00:22
634000 -- (-891.422) [-892.696] (-898.883) (-897.496) * (-892.825) (-893.637) (-894.746) [-892.828] -- 0:00:22
634500 -- (-892.992) (-893.674) [-892.509] (-895.050) * (-892.341) (-892.648) (-891.048) [-891.618] -- 0:00:22
635000 -- (-892.801) (-893.582) (-895.188) [-895.552] * [-893.019] (-894.293) (-891.688) (-891.144) -- 0:00:22
Average standard deviation of split frequencies: 0.008252
635500 -- (-894.433) [-892.739] (-891.358) (-891.531) * (-891.934) (-891.903) (-893.754) [-897.634] -- 0:00:22
636000 -- (-898.339) [-893.827] (-892.871) (-893.950) * (-891.575) (-892.933) [-892.672] (-892.788) -- 0:00:22
636500 -- (-896.869) (-891.938) [-891.688] (-892.805) * (-895.659) (-893.304) [-893.128] (-893.155) -- 0:00:22
637000 -- [-892.765] (-897.368) (-891.248) (-895.413) * (-891.446) [-894.683] (-891.937) (-892.013) -- 0:00:22
637500 -- (-892.045) (-893.360) [-892.820] (-894.015) * (-894.125) [-892.196] (-891.203) (-892.333) -- 0:00:22
638000 -- [-892.674] (-894.020) (-892.832) (-894.131) * [-892.477] (-892.659) (-892.526) (-892.565) -- 0:00:22
638500 -- (-891.856) (-893.364) (-894.003) [-892.741] * (-891.900) [-893.450] (-892.996) (-892.126) -- 0:00:22
639000 -- (-896.100) [-893.721] (-891.499) (-895.036) * (-897.663) (-894.092) (-891.511) [-892.310] -- 0:00:22
639500 -- (-893.880) (-893.020) [-892.013] (-895.699) * (-897.882) (-893.976) (-893.377) [-892.723] -- 0:00:21
640000 -- (-893.125) [-893.757] (-893.378) (-892.094) * (-893.657) (-893.825) [-891.762] (-894.534) -- 0:00:21
Average standard deviation of split frequencies: 0.008682
640500 -- (-892.947) [-891.921] (-893.013) (-893.756) * (-894.526) (-893.261) [-893.011] (-893.228) -- 0:00:21
641000 -- (-893.139) (-893.506) [-891.974] (-892.911) * (-891.216) [-896.565] (-893.001) (-893.426) -- 0:00:21
641500 -- (-896.177) (-891.958) [-894.189] (-892.156) * (-893.824) [-891.956] (-892.801) (-894.898) -- 0:00:21
642000 -- [-891.762] (-891.089) (-894.924) (-892.370) * (-893.795) (-893.596) [-893.653] (-895.001) -- 0:00:21
642500 -- (-893.434) (-892.591) (-896.841) [-893.721] * [-892.481] (-902.544) (-892.905) (-891.884) -- 0:00:21
643000 -- (-894.919) (-892.733) (-897.670) [-893.402] * (-892.591) (-894.439) [-895.307] (-893.677) -- 0:00:21
643500 -- (-894.130) (-895.400) [-892.603] (-892.320) * (-891.633) (-891.436) (-895.193) [-898.055] -- 0:00:22
644000 -- [-891.764] (-895.401) (-892.168) (-890.908) * (-894.568) (-892.386) [-893.813] (-892.744) -- 0:00:22
644500 -- (-891.291) (-893.109) (-894.097) [-890.908] * (-892.573) (-896.802) [-891.933] (-893.113) -- 0:00:22
645000 -- (-891.283) (-894.870) (-896.331) [-892.069] * [-891.376] (-892.867) (-894.145) (-892.657) -- 0:00:22
Average standard deviation of split frequencies: 0.008708
645500 -- (-891.408) (-893.063) (-895.108) [-891.809] * (-901.105) (-895.615) (-893.072) [-899.463] -- 0:00:21
646000 -- (-893.527) (-893.535) (-895.536) [-892.410] * (-892.725) [-893.020] (-893.887) (-897.251) -- 0:00:21
646500 -- (-892.316) (-892.529) (-899.320) [-891.855] * (-892.295) [-894.021] (-894.402) (-896.448) -- 0:00:21
647000 -- [-891.253] (-892.458) (-897.098) (-894.277) * [-898.153] (-894.215) (-894.486) (-896.366) -- 0:00:21
647500 -- (-895.525) (-896.160) (-899.567) [-895.070] * (-892.214) (-894.376) [-891.832] (-894.517) -- 0:00:21
648000 -- (-892.656) (-896.649) [-892.713] (-896.749) * [-892.468] (-893.764) (-894.129) (-893.828) -- 0:00:21
648500 -- (-893.251) (-894.692) (-894.390) [-892.061] * (-894.222) (-893.157) [-892.854] (-892.707) -- 0:00:21
649000 -- [-891.658] (-892.947) (-895.100) (-893.367) * (-900.925) [-893.926] (-898.054) (-894.053) -- 0:00:21
649500 -- (-891.415) (-892.359) [-891.901] (-893.163) * (-894.321) (-891.506) (-893.095) [-894.282] -- 0:00:21
650000 -- (-892.264) [-893.283] (-900.543) (-893.057) * (-891.513) [-894.040] (-891.445) (-892.947) -- 0:00:21
Average standard deviation of split frequencies: 0.008784
650500 -- (-892.161) (-893.444) (-895.577) [-892.784] * (-893.450) (-895.789) (-895.557) [-893.606] -- 0:00:21
651000 -- (-893.734) (-893.012) [-891.078] (-892.490) * [-894.475] (-894.874) (-892.850) (-891.938) -- 0:00:21
651500 -- (-891.712) [-892.455] (-891.078) (-891.337) * (-895.790) [-891.586] (-892.948) (-892.108) -- 0:00:21
652000 -- (-891.555) (-892.759) [-893.608] (-894.794) * (-892.254) (-891.632) [-893.845] (-893.410) -- 0:00:21
652500 -- (-892.899) [-891.476] (-898.394) (-895.290) * (-892.490) (-892.215) [-896.371] (-892.972) -- 0:00:21
653000 -- [-893.709] (-891.693) (-891.808) (-891.881) * [-894.517] (-893.455) (-894.172) (-894.113) -- 0:00:21
653500 -- (-895.330) (-892.302) [-891.129] (-894.030) * (-893.145) [-892.430] (-892.876) (-892.915) -- 0:00:21
654000 -- (-893.752) [-892.819] (-893.257) (-892.536) * (-893.301) (-895.467) [-892.438] (-891.806) -- 0:00:21
654500 -- (-893.473) (-892.014) [-893.611] (-891.787) * (-894.703) [-892.299] (-892.697) (-894.142) -- 0:00:21
655000 -- (-893.315) (-891.676) (-893.878) [-893.087] * [-896.238] (-896.643) (-892.620) (-891.905) -- 0:00:21
Average standard deviation of split frequencies: 0.008578
655500 -- [-896.429] (-893.103) (-893.677) (-896.403) * (-892.529) [-893.823] (-893.699) (-893.332) -- 0:00:21
656000 -- (-892.928) [-894.069] (-900.382) (-893.502) * (-892.071) (-892.601) (-892.684) [-893.145] -- 0:00:20
656500 -- (-891.624) (-893.953) [-892.043] (-896.361) * (-894.497) (-891.389) (-896.724) [-893.542] -- 0:00:20
657000 -- (-892.104) (-893.372) (-891.975) [-895.186] * (-894.322) (-892.236) [-895.077] (-897.054) -- 0:00:20
657500 -- (-892.102) (-894.492) [-894.228] (-896.058) * (-894.359) [-892.511] (-895.459) (-894.625) -- 0:00:20
658000 -- (-892.439) (-892.463) (-896.100) [-895.314] * (-895.024) (-892.327) (-896.338) [-892.749] -- 0:00:20
658500 -- [-891.384] (-892.018) (-894.384) (-894.647) * (-897.314) (-892.357) (-894.298) [-893.337] -- 0:00:20
659000 -- (-895.711) (-894.512) (-893.898) [-893.757] * (-895.717) (-892.478) [-892.720] (-892.187) -- 0:00:20
659500 -- [-893.454] (-892.021) (-895.094) (-892.394) * (-893.228) [-892.640] (-893.861) (-898.313) -- 0:00:20
660000 -- (-894.472) (-895.159) [-892.728] (-895.609) * (-892.296) [-895.491] (-900.088) (-898.472) -- 0:00:21
Average standard deviation of split frequencies: 0.008039
660500 -- (-898.992) (-898.020) (-892.827) [-893.056] * [-891.612] (-891.957) (-891.962) (-892.156) -- 0:00:21
661000 -- (-893.983) (-893.716) [-893.018] (-895.100) * [-892.160] (-895.313) (-891.423) (-896.745) -- 0:00:21
661500 -- (-897.082) [-895.309] (-892.866) (-895.734) * (-896.854) (-892.445) [-891.726] (-896.491) -- 0:00:20
662000 -- (-893.420) (-892.154) [-895.347] (-892.665) * [-893.886] (-894.831) (-891.810) (-894.359) -- 0:00:20
662500 -- [-894.045] (-894.350) (-894.160) (-898.286) * (-896.100) (-893.261) [-891.779] (-891.340) -- 0:00:20
663000 -- (-891.683) [-894.266] (-894.040) (-893.464) * [-896.116] (-894.259) (-893.183) (-891.405) -- 0:00:20
663500 -- [-892.158] (-893.056) (-894.337) (-891.772) * (-896.448) (-897.308) [-894.387] (-892.720) -- 0:00:20
664000 -- (-893.005) (-892.002) (-892.538) [-891.939] * (-894.111) (-899.650) (-892.761) [-894.604] -- 0:00:20
664500 -- [-892.778] (-893.009) (-892.035) (-895.588) * [-893.768] (-896.248) (-893.167) (-893.462) -- 0:00:20
665000 -- [-891.759] (-894.654) (-898.246) (-892.082) * [-892.333] (-900.444) (-892.425) (-894.803) -- 0:00:20
Average standard deviation of split frequencies: 0.008494
665500 -- (-895.346) (-894.639) [-893.525] (-892.785) * (-891.986) (-895.080) [-893.568] (-894.266) -- 0:00:20
666000 -- [-893.166] (-891.556) (-893.922) (-893.542) * [-893.089] (-894.491) (-895.697) (-897.210) -- 0:00:20
666500 -- (-901.058) (-893.824) (-897.736) [-891.633] * [-893.667] (-892.638) (-894.537) (-898.120) -- 0:00:20
667000 -- (-893.302) [-892.088] (-897.224) (-891.632) * (-894.166) (-891.669) [-896.412] (-892.799) -- 0:00:20
667500 -- [-894.969] (-892.117) (-894.560) (-895.020) * (-893.526) (-891.863) [-892.735] (-892.768) -- 0:00:20
668000 -- (-898.724) [-891.563] (-892.403) (-893.643) * [-892.881] (-895.797) (-892.680) (-893.196) -- 0:00:20
668500 -- (-891.713) [-891.751] (-892.983) (-893.305) * (-898.267) (-893.488) [-891.398] (-894.233) -- 0:00:20
669000 -- (-893.583) [-892.635] (-892.832) (-893.314) * (-897.761) [-893.930] (-894.148) (-895.223) -- 0:00:20
669500 -- [-894.557] (-892.548) (-892.665) (-892.058) * [-894.257] (-892.443) (-893.696) (-891.857) -- 0:00:20
670000 -- [-893.375] (-892.635) (-898.146) (-892.805) * (-893.593) (-893.022) [-892.480] (-892.946) -- 0:00:20
Average standard deviation of split frequencies: 0.007966
670500 -- [-893.029] (-894.599) (-892.165) (-892.216) * [-892.890] (-894.717) (-892.094) (-893.903) -- 0:00:20
671000 -- (-891.783) (-891.770) (-895.240) [-892.015] * (-895.548) (-892.523) (-893.711) [-895.689] -- 0:00:20
671500 -- (-891.734) [-891.607] (-894.533) (-891.898) * (-894.647) (-893.837) [-893.044] (-893.654) -- 0:00:20
672000 -- [-891.748] (-892.166) (-892.036) (-892.019) * (-897.270) [-892.907] (-892.080) (-893.299) -- 0:00:20
672500 -- (-891.835) [-893.079] (-892.805) (-893.318) * [-893.815] (-893.818) (-892.358) (-895.138) -- 0:00:19
673000 -- (-893.170) (-893.724) [-892.617] (-891.926) * [-893.808] (-892.601) (-892.385) (-896.333) -- 0:00:19
673500 -- (-894.527) [-892.412] (-892.775) (-895.921) * [-891.893] (-892.258) (-892.650) (-893.276) -- 0:00:19
674000 -- (-895.557) [-892.461] (-892.491) (-893.137) * [-898.892] (-894.584) (-893.204) (-892.053) -- 0:00:19
674500 -- [-892.809] (-897.768) (-892.183) (-892.441) * [-893.658] (-896.334) (-896.947) (-892.539) -- 0:00:19
675000 -- (-893.628) (-893.261) (-892.663) [-893.061] * (-897.842) (-900.140) (-892.778) [-892.395] -- 0:00:19
Average standard deviation of split frequencies: 0.008089
675500 -- (-892.744) (-893.498) (-892.150) [-892.937] * (-893.845) (-898.182) (-893.946) [-891.828] -- 0:00:19
676000 -- [-892.154] (-891.973) (-891.325) (-894.831) * (-893.608) (-893.514) (-891.427) [-891.577] -- 0:00:19
676500 -- [-896.029] (-896.313) (-894.124) (-892.135) * [-892.941] (-892.359) (-892.899) (-892.027) -- 0:00:20
677000 -- (-894.210) (-898.365) (-893.319) [-891.426] * (-891.677) [-895.200] (-893.825) (-891.872) -- 0:00:20
677500 -- (-895.435) [-892.196] (-894.769) (-892.716) * (-893.715) [-894.294] (-891.404) (-897.954) -- 0:00:19
678000 -- (-895.593) (-893.335) [-891.228] (-893.235) * (-893.541) [-893.759] (-892.372) (-892.751) -- 0:00:19
678500 -- [-894.196] (-892.853) (-891.631) (-892.893) * (-893.066) (-896.645) [-894.064] (-892.807) -- 0:00:19
679000 -- [-893.536] (-892.624) (-891.663) (-898.156) * (-895.005) (-894.771) [-892.805] (-890.985) -- 0:00:19
679500 -- (-893.977) [-892.628] (-892.700) (-892.444) * (-896.144) [-891.508] (-894.930) (-895.866) -- 0:00:19
680000 -- (-893.512) [-895.468] (-892.623) (-894.087) * (-894.007) [-894.195] (-895.271) (-893.426) -- 0:00:19
Average standard deviation of split frequencies: 0.007803
680500 -- [-893.347] (-892.120) (-895.824) (-891.799) * (-891.883) (-893.855) [-893.645] (-891.913) -- 0:00:19
681000 -- [-895.606] (-894.545) (-894.638) (-891.779) * [-898.423] (-893.073) (-892.757) (-892.065) -- 0:00:19
681500 -- (-893.284) [-891.720] (-894.797) (-891.592) * (-892.827) (-892.124) (-893.446) [-892.648] -- 0:00:19
682000 -- (-894.531) (-892.790) (-896.572) [-895.211] * (-891.414) [-893.574] (-893.306) (-892.090) -- 0:00:19
682500 -- (-896.095) (-891.959) [-891.226] (-896.602) * [-893.685] (-895.647) (-892.195) (-891.647) -- 0:00:19
683000 -- [-894.697] (-892.485) (-894.243) (-892.403) * (-895.813) (-894.201) (-892.496) [-892.609] -- 0:00:19
683500 -- (-892.659) (-892.480) (-894.922) [-892.823] * (-894.275) (-896.742) [-896.469] (-893.633) -- 0:00:19
684000 -- [-895.076] (-891.707) (-892.916) (-894.785) * (-893.524) [-892.097] (-901.539) (-892.412) -- 0:00:19
684500 -- (-892.506) [-896.852] (-896.334) (-893.855) * (-893.469) [-893.586] (-904.286) (-893.457) -- 0:00:19
685000 -- (-899.798) [-892.901] (-892.377) (-893.267) * (-892.619) (-899.339) (-898.157) [-893.026] -- 0:00:19
Average standard deviation of split frequencies: 0.007925
685500 -- [-896.530] (-894.088) (-896.649) (-894.661) * (-892.122) [-891.591] (-897.648) (-894.487) -- 0:00:19
686000 -- (-893.722) (-894.869) (-895.900) [-895.639] * (-891.693) (-894.058) (-893.067) [-894.673] -- 0:00:19
686500 -- [-894.511] (-893.630) (-895.032) (-896.019) * (-895.097) [-894.206] (-891.719) (-894.661) -- 0:00:19
687000 -- (-892.951) (-893.085) [-898.540] (-894.245) * (-894.731) [-892.119] (-894.644) (-894.237) -- 0:00:19
687500 -- (-896.264) (-893.093) [-899.080] (-892.358) * (-894.559) [-891.459] (-894.653) (-892.607) -- 0:00:19
688000 -- (-893.530) [-893.452] (-898.559) (-894.505) * [-892.307] (-891.337) (-891.871) (-893.195) -- 0:00:19
688500 -- (-895.820) [-895.720] (-891.972) (-894.233) * (-893.628) (-892.035) [-893.019] (-893.790) -- 0:00:19
689000 -- (-897.613) (-894.668) [-891.647] (-892.086) * (-891.553) (-894.678) [-891.566] (-893.741) -- 0:00:18
689500 -- (-892.206) [-897.775] (-891.610) (-893.055) * (-892.740) (-892.013) (-891.916) [-891.467] -- 0:00:18
690000 -- (-893.703) (-895.492) (-892.485) [-894.216] * [-892.885] (-892.526) (-892.484) (-891.467) -- 0:00:18
Average standard deviation of split frequencies: 0.007553
690500 -- [-893.754] (-892.977) (-892.967) (-894.501) * [-891.722] (-892.305) (-893.864) (-893.788) -- 0:00:18
691000 -- (-892.141) (-896.978) [-891.833] (-892.516) * (-893.114) [-894.587] (-892.545) (-893.562) -- 0:00:18
691500 -- (-891.217) [-895.556] (-892.290) (-893.743) * [-892.548] (-892.151) (-892.491) (-891.863) -- 0:00:18
692000 -- (-891.075) [-892.733] (-894.098) (-894.571) * (-892.330) [-892.452] (-894.704) (-893.951) -- 0:00:18
692500 -- (-894.721) (-894.813) (-892.269) [-892.250] * (-897.901) [-892.912] (-894.512) (-894.146) -- 0:00:18
693000 -- (-891.610) [-894.731] (-893.824) (-891.869) * (-892.169) (-894.080) (-895.148) [-892.881] -- 0:00:19
693500 -- (-892.400) (-894.583) [-891.750] (-892.361) * (-893.261) (-894.286) [-892.023] (-893.438) -- 0:00:19
694000 -- (-892.972) (-895.553) [-891.638] (-893.375) * [-892.925] (-895.047) (-895.643) (-891.842) -- 0:00:18
694500 -- (-895.466) [-896.958] (-895.339) (-893.473) * [-892.147] (-894.212) (-899.907) (-892.505) -- 0:00:18
695000 -- (-896.448) [-896.447] (-894.662) (-892.868) * (-893.817) [-891.991] (-894.075) (-893.131) -- 0:00:18
Average standard deviation of split frequencies: 0.007450
695500 -- (-895.024) (-891.646) [-898.730] (-892.724) * [-891.020] (-895.350) (-894.443) (-893.727) -- 0:00:18
696000 -- (-894.990) (-892.514) [-891.524] (-892.297) * (-895.288) (-896.737) [-892.412] (-892.773) -- 0:00:18
696500 -- (-895.270) (-892.772) [-891.673] (-891.310) * (-895.227) [-894.354] (-896.033) (-892.354) -- 0:00:18
697000 -- (-895.589) [-892.393] (-892.855) (-892.117) * (-897.561) [-894.485] (-894.298) (-893.316) -- 0:00:18
697500 -- (-894.727) (-892.433) (-892.034) [-892.439] * (-898.441) (-894.969) (-893.323) [-893.137] -- 0:00:18
698000 -- (-893.290) (-892.959) [-891.942] (-891.625) * (-895.050) (-893.290) [-894.334] (-893.012) -- 0:00:18
698500 -- (-892.679) (-892.760) (-892.458) [-894.281] * (-891.613) (-893.728) (-895.428) [-891.733] -- 0:00:18
699000 -- [-897.565] (-891.599) (-891.797) (-893.388) * (-892.290) (-895.405) [-892.370] (-896.901) -- 0:00:18
699500 -- [-891.431] (-892.166) (-892.292) (-899.738) * [-891.386] (-896.701) (-891.721) (-893.963) -- 0:00:18
700000 -- (-891.407) (-892.068) (-891.403) [-896.827] * (-892.201) (-895.234) [-893.569] (-893.239) -- 0:00:18
Average standard deviation of split frequencies: 0.007401
700500 -- (-893.787) (-896.887) [-892.870] (-892.871) * (-893.834) [-898.486] (-892.616) (-893.800) -- 0:00:18
701000 -- [-894.434] (-893.038) (-893.014) (-896.231) * (-893.997) (-894.491) [-895.877] (-892.880) -- 0:00:18
701500 -- (-894.400) (-892.845) [-894.841] (-897.013) * (-893.930) [-892.893] (-895.467) (-893.012) -- 0:00:18
702000 -- (-893.403) (-893.228) (-892.146) [-892.952] * (-893.843) [-894.953] (-896.902) (-893.883) -- 0:00:18
702500 -- (-891.993) (-891.876) [-892.497] (-891.220) * (-893.418) (-896.293) [-896.372] (-900.165) -- 0:00:18
703000 -- (-894.071) (-895.139) [-893.060] (-893.636) * (-895.041) [-894.350] (-895.244) (-891.534) -- 0:00:18
703500 -- (-895.487) (-891.803) (-892.542) [-892.727] * (-897.197) [-892.231] (-893.179) (-893.077) -- 0:00:18
704000 -- (-893.539) (-891.288) (-891.099) [-892.199] * (-896.259) (-896.573) (-896.050) [-891.486] -- 0:00:18
704500 -- (-896.038) (-891.424) [-892.005] (-893.062) * (-894.342) [-898.178] (-895.092) (-892.051) -- 0:00:18
705000 -- (-893.610) (-891.527) (-894.468) [-893.593] * [-894.210] (-895.653) (-891.578) (-894.506) -- 0:00:17
Average standard deviation of split frequencies: 0.007834
705500 -- (-895.487) [-895.470] (-892.096) (-892.230) * (-896.691) [-894.523] (-891.652) (-893.649) -- 0:00:17
706000 -- (-891.726) (-892.276) (-892.009) [-893.400] * (-893.508) (-892.819) (-893.327) [-891.701] -- 0:00:17
706500 -- [-893.752] (-891.876) (-891.079) (-891.414) * (-894.157) (-892.352) (-894.548) [-892.949] -- 0:00:17
707000 -- (-893.224) (-891.366) (-891.104) [-891.701] * (-891.835) [-892.263] (-895.055) (-896.824) -- 0:00:17
707500 -- (-891.870) (-893.483) [-891.066] (-892.623) * [-895.487] (-897.798) (-896.463) (-898.025) -- 0:00:17
708000 -- (-895.907) (-893.174) (-892.145) [-891.950] * (-895.895) (-894.550) [-893.661] (-901.391) -- 0:00:17
708500 -- (-899.402) (-891.994) (-891.790) [-895.563] * (-891.798) (-895.240) (-895.473) [-892.885] -- 0:00:17
709000 -- (-896.155) (-891.829) (-893.964) [-895.028] * (-892.501) [-892.199] (-894.218) (-892.863) -- 0:00:17
709500 -- [-892.467] (-892.333) (-893.385) (-893.078) * [-892.338] (-892.297) (-892.340) (-896.477) -- 0:00:18
710000 -- (-893.631) (-891.991) (-896.148) [-893.247] * (-891.425) [-891.415] (-896.068) (-894.770) -- 0:00:17
Average standard deviation of split frequencies: 0.008093
710500 -- [-894.731] (-892.019) (-896.061) (-893.139) * (-895.838) (-892.180) (-896.766) [-896.649] -- 0:00:17
711000 -- [-893.611] (-892.494) (-895.986) (-893.100) * [-894.632] (-894.804) (-892.745) (-891.604) -- 0:00:17
711500 -- (-891.955) [-894.470] (-895.293) (-897.293) * [-892.045] (-892.658) (-895.498) (-893.907) -- 0:00:17
712000 -- (-894.137) (-892.555) [-892.043] (-893.861) * (-891.969) (-891.778) (-894.929) [-893.085] -- 0:00:17
712500 -- (-894.297) [-892.588] (-894.089) (-891.896) * (-891.524) [-892.051] (-893.189) (-891.622) -- 0:00:17
713000 -- (-894.973) [-892.752] (-896.045) (-892.213) * (-892.213) (-893.457) [-891.487] (-893.131) -- 0:00:17
713500 -- (-893.839) (-892.716) [-894.492] (-892.616) * (-894.113) (-896.116) [-892.522] (-892.356) -- 0:00:17
714000 -- (-891.347) [-894.319] (-897.580) (-893.079) * (-892.016) (-894.513) [-892.573] (-896.512) -- 0:00:17
714500 -- (-891.362) (-894.656) [-893.443] (-893.458) * (-892.940) (-896.763) [-894.764] (-897.197) -- 0:00:17
715000 -- (-891.362) (-891.745) (-893.591) [-893.145] * (-894.798) (-892.216) (-894.547) [-900.126] -- 0:00:17
Average standard deviation of split frequencies: 0.008076
715500 -- [-891.459] (-892.171) (-896.134) (-894.069) * [-892.939] (-892.446) (-893.838) (-903.302) -- 0:00:17
716000 -- (-891.223) (-891.554) (-895.918) [-893.756] * (-893.561) [-892.609] (-893.838) (-906.503) -- 0:00:17
716500 -- [-894.533] (-892.935) (-895.510) (-892.655) * (-894.200) (-893.233) (-892.896) [-895.541] -- 0:00:17
717000 -- (-892.356) (-892.842) (-891.487) [-894.572] * (-892.732) (-892.715) [-893.418] (-898.370) -- 0:00:17
717500 -- (-896.132) (-892.269) [-893.921] (-899.545) * (-892.825) (-894.222) (-893.112) [-893.878] -- 0:00:17
718000 -- (-896.828) (-892.792) [-893.302] (-892.802) * (-896.745) (-894.124) [-892.752] (-893.309) -- 0:00:17
718500 -- (-903.353) (-891.190) (-895.332) [-893.652] * [-892.438] (-894.875) (-893.480) (-893.220) -- 0:00:17
719000 -- (-894.129) (-898.250) (-897.388) [-893.976] * (-892.889) [-892.687] (-892.494) (-895.419) -- 0:00:17
719500 -- (-897.956) [-894.350] (-891.295) (-891.164) * (-892.495) (-894.558) [-892.905] (-893.164) -- 0:00:17
720000 -- (-895.933) (-892.527) [-891.242] (-891.160) * (-893.790) (-891.549) (-893.369) [-892.832] -- 0:00:17
Average standard deviation of split frequencies: 0.007893
720500 -- (-894.327) [-891.299] (-894.744) (-893.597) * (-891.585) (-894.249) [-897.907] (-894.402) -- 0:00:17
721000 -- [-894.517] (-895.165) (-892.414) (-892.569) * (-892.536) [-892.882] (-893.919) (-896.183) -- 0:00:17
721500 -- (-893.436) (-892.491) (-895.149) [-891.793] * [-891.698] (-893.834) (-891.926) (-894.895) -- 0:00:16
722000 -- (-895.110) (-892.003) (-897.509) [-895.655] * (-895.409) (-893.941) [-892.963] (-892.314) -- 0:00:16
722500 -- (-892.809) [-891.530] (-892.413) (-892.528) * (-896.152) (-893.608) [-898.793] (-891.369) -- 0:00:16
723000 -- (-892.613) (-895.210) [-892.418] (-892.784) * [-892.961] (-897.975) (-896.479) (-891.319) -- 0:00:16
723500 -- (-894.149) (-896.455) (-891.501) [-894.548] * [-895.900] (-895.729) (-894.777) (-893.001) -- 0:00:16
724000 -- (-894.618) (-893.121) [-893.281] (-892.446) * [-897.582] (-899.149) (-894.711) (-896.758) -- 0:00:16
724500 -- (-893.466) [-892.165] (-897.715) (-894.349) * [-894.438] (-900.606) (-893.875) (-891.354) -- 0:00:16
725000 -- [-892.631] (-892.415) (-894.563) (-898.970) * (-896.471) (-893.378) (-891.411) [-891.576] -- 0:00:16
Average standard deviation of split frequencies: 0.007575
725500 -- (-893.117) (-891.554) (-892.325) [-891.680] * (-893.016) (-895.986) (-894.269) [-891.601] -- 0:00:16
726000 -- (-893.965) [-892.822] (-892.433) (-893.576) * [-892.373] (-895.076) (-891.546) (-893.281) -- 0:00:16
726500 -- (-894.011) [-891.882] (-892.565) (-893.684) * (-893.388) [-892.609] (-891.509) (-892.468) -- 0:00:16
727000 -- [-893.688] (-892.650) (-893.669) (-894.154) * [-893.359] (-895.261) (-894.908) (-893.828) -- 0:00:16
727500 -- [-895.554] (-891.920) (-893.689) (-893.196) * (-893.405) (-894.544) (-896.266) [-892.307] -- 0:00:16
728000 -- (-893.584) (-893.922) (-893.005) [-898.078] * (-894.377) [-895.653] (-898.235) (-892.123) -- 0:00:16
728500 -- [-895.244] (-893.733) (-893.374) (-892.378) * (-892.791) [-892.449] (-892.830) (-891.814) -- 0:00:16
729000 -- (-892.717) (-894.654) (-893.517) [-897.193] * (-893.634) (-891.136) [-894.511] (-897.050) -- 0:00:16
729500 -- [-894.384] (-893.271) (-894.212) (-893.606) * (-896.628) [-892.674] (-892.705) (-893.697) -- 0:00:16
730000 -- (-894.544) (-897.993) [-894.156] (-893.175) * (-894.112) (-893.528) [-892.703] (-894.206) -- 0:00:16
Average standard deviation of split frequencies: 0.007782
730500 -- (-893.550) [-893.494] (-894.065) (-895.469) * (-896.291) [-893.535] (-895.122) (-894.549) -- 0:00:16
731000 -- (-894.415) [-893.357] (-895.420) (-893.894) * (-892.967) [-891.438] (-895.459) (-902.081) -- 0:00:16
731500 -- [-892.835] (-892.706) (-891.737) (-896.797) * (-894.855) (-893.626) [-893.650] (-891.783) -- 0:00:16
732000 -- (-893.364) (-895.342) (-891.284) [-892.927] * (-898.509) (-893.319) [-891.769] (-893.366) -- 0:00:16
732500 -- (-893.210) [-891.436] (-894.046) (-893.176) * [-894.092] (-899.493) (-893.439) (-894.040) -- 0:00:16
733000 -- (-895.321) (-891.910) (-891.670) [-892.885] * (-896.668) (-891.555) (-893.237) [-891.930] -- 0:00:16
733500 -- [-895.142] (-892.659) (-891.966) (-894.242) * (-892.500) (-900.464) (-892.998) [-892.757] -- 0:00:16
734000 -- [-893.667] (-897.692) (-892.218) (-896.923) * (-891.301) (-899.535) [-893.370] (-895.740) -- 0:00:16
734500 -- [-894.674] (-895.653) (-892.886) (-895.774) * (-893.612) [-893.039] (-896.528) (-891.779) -- 0:00:16
735000 -- (-894.543) [-893.662] (-893.054) (-893.902) * (-890.923) [-893.499] (-894.405) (-894.025) -- 0:00:16
Average standard deviation of split frequencies: 0.007686
735500 -- (-895.383) [-893.012] (-895.479) (-897.026) * (-892.870) (-891.191) [-891.373] (-892.643) -- 0:00:16
736000 -- (-893.201) [-894.576] (-894.463) (-897.141) * (-892.445) (-892.296) (-892.554) [-892.555] -- 0:00:16
736500 -- (-892.330) [-893.539] (-892.735) (-898.045) * [-893.243] (-892.439) (-896.709) (-894.731) -- 0:00:16
737000 -- (-892.447) (-891.667) (-892.627) [-893.410] * (-894.522) (-892.025) (-896.185) [-895.660] -- 0:00:16
737500 -- (-891.719) (-891.381) [-891.650] (-891.959) * (-896.286) [-891.527] (-894.202) (-892.580) -- 0:00:16
738000 -- (-891.681) [-891.566] (-891.687) (-896.570) * [-892.444] (-893.701) (-893.418) (-894.684) -- 0:00:15
738500 -- (-892.589) (-895.181) [-891.438] (-894.572) * [-891.680] (-892.447) (-893.716) (-895.021) -- 0:00:15
739000 -- (-891.977) [-892.585] (-891.502) (-891.594) * (-893.576) (-892.367) [-895.895] (-896.305) -- 0:00:15
739500 -- (-892.344) [-892.630] (-893.337) (-891.987) * (-892.489) (-892.130) (-893.149) [-893.543] -- 0:00:15
740000 -- (-893.737) (-892.001) [-899.020] (-898.636) * (-892.344) (-895.937) (-891.759) [-892.669] -- 0:00:15
Average standard deviation of split frequencies: 0.007638
740500 -- (-894.693) (-891.054) (-893.807) [-893.181] * (-891.793) (-893.327) [-896.266] (-892.152) -- 0:00:15
741000 -- (-895.309) [-891.581] (-893.442) (-893.906) * (-895.541) [-891.935] (-892.903) (-892.547) -- 0:00:15
741500 -- [-897.273] (-892.660) (-892.847) (-899.079) * [-895.736] (-894.916) (-892.368) (-894.879) -- 0:00:15
742000 -- [-892.631] (-894.871) (-897.367) (-893.551) * (-895.405) [-892.376] (-892.206) (-894.459) -- 0:00:15
742500 -- (-892.723) (-892.036) [-894.957] (-891.854) * (-891.708) (-891.363) (-892.687) [-893.099] -- 0:00:15
743000 -- (-893.294) (-891.189) (-892.946) [-893.061] * (-892.694) (-892.608) [-896.747] (-895.417) -- 0:00:15
743500 -- [-892.369] (-892.655) (-893.913) (-894.854) * (-892.948) (-893.392) [-892.511] (-893.683) -- 0:00:15
744000 -- [-894.413] (-892.725) (-892.802) (-893.546) * (-896.226) (-892.293) (-894.281) [-893.451] -- 0:00:15
744500 -- (-893.975) (-892.546) (-896.520) [-893.928] * (-894.515) [-893.631] (-896.498) (-893.974) -- 0:00:15
745000 -- [-894.560] (-891.625) (-894.509) (-892.928) * (-892.670) [-892.339] (-893.853) (-892.245) -- 0:00:15
Average standard deviation of split frequencies: 0.007836
745500 -- [-893.035] (-892.694) (-893.724) (-896.235) * (-893.920) (-892.613) [-893.243] (-895.968) -- 0:00:15
746000 -- (-892.777) (-891.193) (-894.208) [-897.292] * (-895.182) (-895.291) [-893.060] (-893.187) -- 0:00:15
746500 -- (-892.376) [-893.467] (-894.768) (-898.276) * (-893.130) [-900.423] (-896.655) (-893.006) -- 0:00:15
747000 -- (-891.332) (-893.661) [-892.915] (-892.306) * (-893.142) (-893.067) (-894.870) [-892.971] -- 0:00:15
747500 -- (-891.358) [-891.391] (-894.356) (-894.213) * (-893.088) (-893.622) [-894.931] (-895.114) -- 0:00:15
748000 -- (-892.532) [-892.354] (-894.556) (-896.639) * (-894.636) (-892.218) (-896.686) [-892.060] -- 0:00:15
748500 -- (-892.129) (-893.385) [-893.340] (-893.606) * (-894.303) (-892.915) (-891.615) [-894.855] -- 0:00:15
749000 -- (-893.687) [-893.021] (-895.661) (-892.411) * [-891.676] (-893.054) (-892.317) (-892.657) -- 0:00:15
749500 -- (-893.404) (-893.406) (-893.037) [-891.526] * (-892.394) [-891.821] (-894.615) (-891.869) -- 0:00:15
750000 -- (-892.155) (-891.962) [-893.766] (-893.398) * (-901.138) (-892.179) (-896.436) [-894.155] -- 0:00:15
Average standard deviation of split frequencies: 0.008206
750500 -- (-892.185) (-893.975) (-892.401) [-890.995] * (-896.997) (-892.194) [-896.375] (-894.076) -- 0:00:15
751000 -- (-892.185) [-891.880] (-891.943) (-891.008) * (-893.994) (-896.426) (-898.013) [-893.231] -- 0:00:15
751500 -- (-892.292) [-892.216] (-892.086) (-892.339) * (-893.285) (-899.558) [-891.196] (-893.036) -- 0:00:15
752000 -- (-892.562) [-895.281] (-893.906) (-893.809) * (-893.978) (-892.513) [-893.744] (-892.692) -- 0:00:15
752500 -- (-893.403) (-893.081) (-892.053) [-893.068] * (-894.105) [-891.507] (-893.884) (-895.005) -- 0:00:15
753000 -- (-894.906) (-894.462) [-892.305] (-892.988) * [-891.363] (-891.255) (-893.148) (-892.456) -- 0:00:15
753500 -- (-894.858) [-892.427] (-900.255) (-894.535) * [-892.931] (-895.044) (-894.805) (-896.018) -- 0:00:15
754000 -- [-893.613] (-891.426) (-901.291) (-895.440) * (-891.995) [-895.167] (-892.994) (-894.524) -- 0:00:15
754500 -- (-892.389) [-895.581] (-894.038) (-894.100) * [-894.720] (-893.077) (-891.790) (-893.336) -- 0:00:14
755000 -- (-892.802) [-895.109] (-892.526) (-891.744) * [-893.343] (-892.079) (-894.706) (-895.282) -- 0:00:14
Average standard deviation of split frequencies: 0.008189
755500 -- (-892.170) (-896.137) (-894.400) [-891.845] * (-892.930) (-892.882) (-893.075) [-893.110] -- 0:00:14
756000 -- (-892.411) [-901.308] (-892.485) (-893.618) * [-893.443] (-892.587) (-892.097) (-893.617) -- 0:00:14
756500 -- (-893.625) (-891.895) (-891.377) [-893.079] * (-897.395) (-891.965) [-892.955] (-897.118) -- 0:00:14
757000 -- (-894.454) (-892.737) (-891.359) [-896.892] * (-900.097) (-894.162) [-894.243] (-895.242) -- 0:00:14
757500 -- (-893.646) (-893.551) (-891.969) [-893.722] * (-896.961) [-892.707] (-892.079) (-896.254) -- 0:00:14
758000 -- (-895.847) [-893.499] (-893.256) (-894.803) * [-893.781] (-893.042) (-891.997) (-897.015) -- 0:00:14
758500 -- (-898.863) (-894.893) (-893.593) [-893.809] * (-894.030) (-892.815) (-895.675) [-892.238] -- 0:00:14
759000 -- (-892.902) (-894.572) (-891.340) [-893.704] * [-891.646] (-894.042) (-892.338) (-892.764) -- 0:00:14
759500 -- (-895.761) [-891.917] (-891.757) (-893.921) * (-893.048) [-894.277] (-892.605) (-893.037) -- 0:00:14
760000 -- (-893.851) [-892.278] (-891.582) (-895.908) * (-893.691) [-892.574] (-892.199) (-893.799) -- 0:00:14
Average standard deviation of split frequencies: 0.008594
760500 -- (-892.392) (-892.239) (-892.813) [-895.052] * (-891.936) (-891.471) [-891.444] (-897.452) -- 0:00:14
761000 -- (-897.888) (-893.031) (-891.722) [-892.811] * (-893.490) (-895.618) [-891.300] (-897.533) -- 0:00:14
761500 -- (-894.210) (-892.996) (-891.521) [-893.419] * (-891.318) (-894.880) (-893.378) [-899.377] -- 0:00:14
762000 -- (-892.869) (-895.647) (-893.384) [-894.404] * [-891.651] (-893.849) (-892.921) (-897.645) -- 0:00:14
762500 -- (-891.906) (-895.157) [-893.899] (-892.828) * (-893.110) (-892.394) [-892.987] (-891.466) -- 0:00:14
763000 -- [-891.529] (-893.833) (-892.565) (-894.043) * (-896.389) (-891.962) [-894.197] (-891.712) -- 0:00:14
763500 -- (-891.032) (-897.184) (-892.411) [-893.055] * [-896.180] (-891.736) (-892.056) (-892.950) -- 0:00:14
764000 -- (-894.017) (-893.690) (-894.022) [-892.825] * (-893.012) (-895.687) [-892.475] (-891.455) -- 0:00:14
764500 -- (-894.787) (-892.296) [-893.538] (-892.118) * (-892.008) [-894.285] (-891.332) (-892.158) -- 0:00:14
765000 -- (-891.299) (-893.915) (-894.218) [-891.254] * (-893.885) [-892.538] (-891.870) (-891.687) -- 0:00:14
Average standard deviation of split frequencies: 0.008205
765500 -- (-893.597) [-892.896] (-893.453) (-895.590) * [-895.345] (-893.201) (-891.994) (-892.826) -- 0:00:14
766000 -- (-894.769) (-891.836) [-893.748] (-891.684) * (-893.186) [-895.333] (-896.150) (-894.786) -- 0:00:14
766500 -- (-891.660) (-894.486) (-892.706) [-892.508] * (-896.994) (-892.428) (-896.277) [-891.991] -- 0:00:14
767000 -- [-891.089] (-893.009) (-892.765) (-891.168) * (-899.914) [-893.038] (-892.398) (-892.847) -- 0:00:14
767500 -- [-892.518] (-893.117) (-893.055) (-894.850) * (-895.524) [-892.223] (-893.270) (-893.478) -- 0:00:14
768000 -- (-893.689) (-896.015) [-893.466] (-893.549) * (-892.665) [-894.451] (-892.923) (-893.330) -- 0:00:14
768500 -- [-892.003] (-896.795) (-891.315) (-893.244) * (-891.687) [-893.278] (-892.415) (-892.470) -- 0:00:14
769000 -- (-895.269) (-894.970) [-891.082] (-891.951) * [-891.789] (-892.920) (-891.848) (-891.971) -- 0:00:14
769500 -- [-894.827] (-897.967) (-895.913) (-894.833) * (-894.209) (-891.183) (-894.204) [-895.040] -- 0:00:14
770000 -- (-894.008) [-894.330] (-893.237) (-892.345) * (-892.772) [-892.166] (-894.282) (-895.835) -- 0:00:14
Average standard deviation of split frequencies: 0.008033
770500 -- [-891.984] (-899.248) (-891.762) (-893.052) * (-894.628) (-892.285) [-892.897] (-893.761) -- 0:00:13
771000 -- [-892.350] (-892.503) (-891.745) (-891.171) * (-894.106) [-893.314] (-892.126) (-894.258) -- 0:00:13
771500 -- (-892.835) [-894.488] (-892.150) (-892.359) * [-891.450] (-894.917) (-894.015) (-892.346) -- 0:00:13
772000 -- [-895.380] (-895.220) (-892.136) (-892.624) * (-896.254) (-892.305) [-894.112] (-893.328) -- 0:00:13
772500 -- (-895.734) (-892.933) (-893.069) [-891.123] * [-894.693] (-891.394) (-892.860) (-893.761) -- 0:00:13
773000 -- (-895.314) (-894.815) (-892.941) [-893.477] * [-892.067] (-893.429) (-891.388) (-892.387) -- 0:00:13
773500 -- (-892.085) (-892.754) [-892.174] (-892.644) * (-893.252) (-892.164) [-894.239] (-893.566) -- 0:00:13
774000 -- [-891.305] (-891.936) (-893.460) (-894.486) * [-893.057] (-893.871) (-895.896) (-891.865) -- 0:00:13
774500 -- [-891.207] (-894.034) (-892.936) (-893.336) * (-892.353) (-892.377) [-893.283] (-891.657) -- 0:00:13
775000 -- (-891.648) (-893.833) (-897.672) [-893.397] * (-892.594) (-894.967) (-892.610) [-892.077] -- 0:00:13
Average standard deviation of split frequencies: 0.007695
775500 -- (-893.107) (-891.447) (-895.175) [-894.170] * (-893.712) (-898.273) (-892.546) [-891.692] -- 0:00:13
776000 -- (-893.172) [-892.831] (-892.636) (-893.604) * (-892.355) (-892.802) (-891.465) [-892.470] -- 0:00:13
776500 -- (-894.782) [-891.902] (-894.658) (-894.413) * (-892.745) [-892.044] (-896.528) (-896.304) -- 0:00:13
777000 -- [-893.060] (-894.444) (-895.127) (-891.855) * (-893.353) (-892.826) (-894.901) [-892.350] -- 0:00:13
777500 -- [-893.979] (-894.248) (-891.917) (-892.938) * (-895.222) (-896.402) (-897.103) [-893.063] -- 0:00:13
778000 -- (-893.651) [-891.266] (-895.520) (-891.304) * [-893.724] (-895.090) (-892.882) (-893.876) -- 0:00:13
778500 -- (-892.625) (-893.101) (-893.302) [-891.023] * (-893.460) (-892.635) [-891.367] (-894.141) -- 0:00:13
779000 -- (-892.618) (-899.335) [-894.158] (-896.924) * (-894.324) [-892.657] (-895.909) (-894.134) -- 0:00:13
779500 -- [-891.483] (-895.466) (-892.007) (-896.064) * (-894.605) (-892.303) (-891.601) [-893.318] -- 0:00:13
780000 -- (-894.442) (-895.651) [-893.135] (-894.240) * [-892.840] (-893.307) (-895.274) (-893.111) -- 0:00:13
Average standard deviation of split frequencies: 0.007206
780500 -- (-894.162) (-893.892) (-892.367) [-893.289] * (-893.405) (-892.797) [-894.595] (-892.100) -- 0:00:13
781000 -- (-895.515) (-892.789) [-892.301] (-893.857) * [-893.404] (-894.070) (-892.106) (-892.512) -- 0:00:13
781500 -- (-892.439) (-893.381) (-894.316) [-894.580] * (-892.713) (-891.597) (-893.162) [-891.827] -- 0:00:13
782000 -- [-894.552] (-899.264) (-896.745) (-893.367) * (-892.847) (-892.074) [-891.668] (-893.708) -- 0:00:13
782500 -- [-892.213] (-896.667) (-893.934) (-894.777) * (-892.897) [-893.575] (-897.325) (-893.218) -- 0:00:13
783000 -- [-894.579] (-893.292) (-892.936) (-895.306) * (-891.685) (-891.309) (-897.654) [-894.139] -- 0:00:13
783500 -- [-891.176] (-892.710) (-892.768) (-892.466) * [-891.750] (-892.676) (-894.092) (-894.627) -- 0:00:13
784000 -- [-891.609] (-893.092) (-893.061) (-892.166) * [-891.331] (-892.152) (-891.841) (-894.487) -- 0:00:13
784500 -- (-892.829) [-892.444] (-891.523) (-893.281) * (-893.271) (-893.034) (-891.530) [-894.152] -- 0:00:13
785000 -- (-896.064) (-892.724) (-893.244) [-891.867] * [-893.829] (-892.408) (-895.486) (-892.586) -- 0:00:13
Average standard deviation of split frequencies: 0.007197
785500 -- (-893.402) (-892.422) (-894.530) [-893.581] * (-897.752) [-893.003] (-898.806) (-891.274) -- 0:00:13
786000 -- (-904.563) (-892.460) (-891.196) [-891.740] * [-892.568] (-896.673) (-893.153) (-892.763) -- 0:00:13
786500 -- (-903.820) [-893.387] (-893.640) (-891.090) * (-892.647) [-897.393] (-892.604) (-893.389) -- 0:00:13
787000 -- (-894.992) [-893.692] (-896.189) (-891.304) * (-895.448) [-898.445] (-893.401) (-893.385) -- 0:00:12
787500 -- (-893.304) [-892.814] (-891.774) (-892.305) * (-901.953) (-895.898) [-894.617] (-891.776) -- 0:00:12
788000 -- [-894.371] (-892.521) (-894.217) (-894.182) * (-892.361) (-896.290) [-897.241] (-891.624) -- 0:00:12
788500 -- (-893.669) (-891.645) (-892.193) [-892.430] * (-893.249) (-896.242) (-892.025) [-891.321] -- 0:00:12
789000 -- (-892.292) [-894.158] (-892.225) (-893.623) * (-892.217) (-893.032) (-894.384) [-891.229] -- 0:00:12
789500 -- (-892.397) [-894.035] (-891.719) (-892.401) * (-892.428) [-892.430] (-896.726) (-891.396) -- 0:00:12
790000 -- (-896.668) (-892.017) (-899.079) [-892.845] * (-893.535) [-893.311] (-894.842) (-892.244) -- 0:00:12
Average standard deviation of split frequencies: 0.006678
790500 -- (-892.842) [-892.200] (-893.046) (-893.654) * (-892.744) (-892.138) (-893.920) [-893.632] -- 0:00:12
791000 -- (-893.882) [-893.566] (-892.087) (-892.654) * [-892.447] (-891.277) (-896.879) (-892.017) -- 0:00:12
791500 -- (-893.258) [-892.924] (-893.322) (-894.035) * [-893.061] (-895.580) (-891.195) (-891.747) -- 0:00:12
792000 -- [-895.931] (-892.272) (-898.930) (-892.669) * (-895.627) (-892.466) (-891.639) [-891.757] -- 0:00:12
792500 -- (-892.142) (-893.172) [-893.255] (-893.344) * (-896.488) (-894.823) (-891.298) [-894.897] -- 0:00:12
793000 -- (-893.748) (-891.690) [-894.566] (-893.991) * (-892.066) (-893.573) (-890.900) [-893.592] -- 0:00:12
793500 -- (-893.312) (-894.142) [-893.115] (-894.335) * (-894.687) (-894.814) [-891.100] (-892.215) -- 0:00:12
794000 -- (-894.639) (-892.916) [-892.026] (-893.104) * (-891.352) (-892.059) (-891.616) [-893.986] -- 0:00:12
794500 -- (-896.428) (-896.432) (-895.120) [-892.319] * (-891.478) (-893.303) [-892.676] (-894.155) -- 0:00:12
795000 -- (-892.601) (-894.253) (-891.673) [-893.232] * [-891.344] (-894.025) (-892.216) (-894.207) -- 0:00:12
Average standard deviation of split frequencies: 0.006120
795500 -- [-895.578] (-893.836) (-895.319) (-896.157) * (-892.325) (-892.770) (-893.440) [-892.769] -- 0:00:12
796000 -- (-892.815) (-892.035) [-891.845] (-896.333) * (-892.633) [-893.091] (-893.300) (-893.815) -- 0:00:12
796500 -- (-893.001) (-894.351) [-891.933] (-894.445) * (-893.202) [-892.070] (-892.789) (-892.659) -- 0:00:12
797000 -- (-895.191) (-896.328) [-892.237] (-896.322) * (-892.836) [-892.723] (-892.626) (-894.934) -- 0:00:12
797500 -- (-895.372) [-893.703] (-894.912) (-898.695) * (-892.834) [-893.589] (-894.449) (-893.042) -- 0:00:12
798000 -- (-893.591) (-891.402) [-893.022] (-890.908) * (-891.659) (-893.797) (-891.911) [-892.329] -- 0:00:12
798500 -- (-892.829) (-892.624) (-893.005) [-892.170] * [-893.536] (-893.365) (-894.992) (-893.890) -- 0:00:12
799000 -- (-893.836) [-895.672] (-894.563) (-893.037) * [-895.046] (-894.402) (-899.188) (-895.760) -- 0:00:12
799500 -- [-892.660] (-891.408) (-893.510) (-891.919) * (-894.009) (-895.448) (-897.070) [-892.599] -- 0:00:12
800000 -- (-897.117) (-893.041) [-893.199] (-897.139) * [-892.407] (-894.197) (-893.899) (-892.689) -- 0:00:12
Average standard deviation of split frequencies: 0.006162
800500 -- (-892.709) (-894.590) (-892.422) [-894.145] * (-892.472) [-893.014] (-892.069) (-892.537) -- 0:00:12
801000 -- (-895.141) (-894.337) [-894.419] (-893.050) * (-892.651) (-892.454) [-892.016] (-894.492) -- 0:00:12
801500 -- (-893.716) [-892.722] (-907.821) (-892.131) * (-891.226) (-893.652) (-892.041) [-896.082] -- 0:00:12
802000 -- (-894.907) (-893.072) [-893.829] (-894.085) * [-894.005] (-894.548) (-891.662) (-894.254) -- 0:00:12
802500 -- [-893.691] (-897.460) (-893.552) (-892.901) * (-893.491) (-894.659) (-891.907) [-895.043] -- 0:00:12
803000 -- (-893.222) (-902.147) (-904.017) [-893.051] * (-896.588) (-893.905) (-892.033) [-892.017] -- 0:00:12
803500 -- (-895.422) [-895.213] (-897.337) (-893.927) * [-892.148] (-891.754) (-892.780) (-896.499) -- 0:00:11
804000 -- (-896.277) [-892.114] (-895.806) (-892.616) * (-894.551) (-895.117) (-894.365) [-894.964] -- 0:00:11
804500 -- [-894.557] (-891.884) (-896.116) (-893.719) * (-895.753) (-892.992) (-892.885) [-891.586] -- 0:00:11
805000 -- (-894.011) (-893.389) (-896.620) [-891.766] * [-892.100] (-895.978) (-893.774) (-895.868) -- 0:00:11
Average standard deviation of split frequencies: 0.006434
805500 -- (-894.768) (-894.740) [-892.683] (-892.535) * (-892.319) [-894.686] (-892.691) (-893.802) -- 0:00:11
806000 -- (-894.522) (-891.695) (-893.343) [-892.468] * (-894.570) [-894.704] (-892.141) (-893.619) -- 0:00:11
806500 -- (-894.234) (-892.684) [-891.725] (-894.846) * (-898.192) [-893.453] (-896.305) (-894.772) -- 0:00:11
807000 -- (-892.351) (-892.529) [-892.445] (-894.392) * (-894.004) (-895.106) (-896.848) [-896.358] -- 0:00:11
807500 -- (-892.804) [-892.491] (-898.184) (-892.794) * [-894.084] (-890.999) (-895.032) (-894.384) -- 0:00:11
808000 -- (-894.205) [-896.270] (-893.631) (-896.303) * (-891.590) [-891.305] (-898.747) (-893.349) -- 0:00:11
808500 -- [-895.815] (-894.055) (-895.912) (-890.908) * [-892.909] (-893.901) (-891.756) (-891.997) -- 0:00:11
809000 -- (-891.752) (-893.285) [-892.557] (-891.995) * (-891.621) (-893.192) [-892.193] (-893.077) -- 0:00:11
809500 -- (-895.448) [-893.330] (-897.937) (-892.518) * (-893.738) [-891.842] (-891.711) (-894.535) -- 0:00:11
810000 -- [-895.287] (-893.047) (-894.822) (-891.326) * (-893.799) (-892.970) (-893.981) [-891.779] -- 0:00:11
Average standard deviation of split frequencies: 0.006125
810500 -- (-892.112) [-891.115] (-893.384) (-892.434) * (-896.794) (-899.025) [-892.448] (-894.553) -- 0:00:11
811000 -- (-894.594) (-895.637) [-892.625] (-892.543) * (-891.199) (-894.001) [-893.165] (-891.801) -- 0:00:11
811500 -- (-894.368) [-892.520] (-892.050) (-894.700) * [-891.075] (-893.662) (-891.469) (-891.776) -- 0:00:11
812000 -- (-892.649) [-891.436] (-893.665) (-894.621) * (-892.224) (-893.399) [-891.059] (-892.594) -- 0:00:11
812500 -- [-893.798] (-891.851) (-895.138) (-892.438) * (-893.214) [-891.719] (-890.916) (-892.663) -- 0:00:11
813000 -- (-896.436) (-891.741) (-893.038) [-893.452] * [-892.870] (-892.963) (-891.446) (-893.313) -- 0:00:11
813500 -- [-892.880] (-894.602) (-895.270) (-892.886) * (-893.511) (-891.915) [-894.818] (-894.983) -- 0:00:11
814000 -- [-892.996] (-894.031) (-894.491) (-894.957) * (-893.231) (-893.986) (-893.502) [-894.073] -- 0:00:11
814500 -- (-892.083) [-891.990] (-893.280) (-894.650) * (-892.260) (-891.780) (-893.146) [-896.894] -- 0:00:11
815000 -- [-892.711] (-894.462) (-893.870) (-896.257) * (-895.543) (-893.490) [-893.008] (-897.918) -- 0:00:11
Average standard deviation of split frequencies: 0.005970
815500 -- [-891.937] (-895.697) (-892.481) (-892.410) * (-894.752) (-892.083) [-891.631] (-893.875) -- 0:00:11
816000 -- [-891.682] (-896.924) (-891.619) (-891.606) * [-893.498] (-893.108) (-891.495) (-898.110) -- 0:00:11
816500 -- [-893.073] (-895.860) (-892.754) (-893.890) * [-893.429] (-894.020) (-892.870) (-899.649) -- 0:00:11
817000 -- [-894.016] (-895.631) (-892.555) (-891.408) * [-892.586] (-894.146) (-894.275) (-891.581) -- 0:00:11
817500 -- (-892.582) (-893.233) (-891.459) [-891.370] * [-892.442] (-892.071) (-892.525) (-892.278) -- 0:00:11
818000 -- [-895.176] (-891.903) (-900.269) (-892.478) * (-892.504) (-896.388) (-892.157) [-892.641] -- 0:00:11
818500 -- (-898.370) (-895.228) (-892.976) [-891.159] * (-891.901) (-892.007) (-892.384) [-892.569] -- 0:00:11
819000 -- (-891.920) [-893.964] (-892.826) (-891.964) * (-892.150) [-894.028] (-893.250) (-894.862) -- 0:00:11
819500 -- (-898.722) (-897.450) (-897.991) [-892.530] * (-893.186) (-894.425) (-893.719) [-894.689] -- 0:00:11
820000 -- (-896.390) (-895.094) (-891.856) [-892.565] * [-893.275] (-893.650) (-896.120) (-891.902) -- 0:00:10
Average standard deviation of split frequencies: 0.005859
820500 -- [-892.777] (-892.556) (-892.711) (-897.347) * (-894.670) [-893.062] (-892.073) (-894.149) -- 0:00:10
821000 -- (-892.268) [-892.423] (-894.545) (-892.662) * (-896.452) (-892.553) (-893.670) [-893.046] -- 0:00:10
821500 -- (-891.990) (-893.628) (-892.856) [-893.360] * (-892.088) (-896.141) [-891.410] (-893.019) -- 0:00:10
822000 -- [-891.366] (-893.037) (-894.048) (-891.162) * [-893.685] (-892.993) (-891.780) (-892.665) -- 0:00:10
822500 -- (-892.876) (-892.153) [-892.535] (-892.078) * (-892.749) [-893.999] (-896.097) (-892.949) -- 0:00:10
823000 -- (-894.556) [-893.246] (-894.595) (-892.785) * (-893.536) (-893.904) (-894.708) [-893.855] -- 0:00:10
823500 -- [-893.255] (-893.322) (-894.783) (-893.523) * (-898.214) (-894.837) (-894.885) [-895.449] -- 0:00:10
824000 -- (-894.184) (-894.468) [-896.292] (-895.050) * (-894.754) (-892.643) (-894.625) [-895.376] -- 0:00:10
824500 -- [-893.547] (-892.911) (-895.806) (-895.528) * (-894.671) [-892.651] (-896.016) (-891.415) -- 0:00:10
825000 -- [-895.113] (-892.069) (-894.359) (-894.810) * (-894.527) (-893.488) (-895.329) [-891.741] -- 0:00:10
Average standard deviation of split frequencies: 0.006011
825500 -- [-891.853] (-893.581) (-893.609) (-892.002) * (-893.920) (-891.589) (-894.432) [-893.175] -- 0:00:10
826000 -- [-892.060] (-893.262) (-891.763) (-891.601) * [-892.318] (-893.966) (-892.424) (-891.131) -- 0:00:10
826500 -- [-892.221] (-894.053) (-891.143) (-894.672) * (-893.974) (-891.597) [-892.700] (-892.320) -- 0:00:10
827000 -- (-894.916) (-893.671) [-891.470] (-894.184) * (-891.681) (-893.259) [-894.029] (-893.097) -- 0:00:10
827500 -- (-894.147) (-899.315) (-893.178) [-894.877] * [-891.842] (-894.523) (-894.277) (-896.588) -- 0:00:10
828000 -- (-893.374) [-892.553] (-894.998) (-891.338) * (-892.509) (-895.267) [-893.042] (-891.607) -- 0:00:10
828500 -- (-893.853) [-894.117] (-896.097) (-892.252) * [-896.504] (-896.642) (-895.734) (-892.759) -- 0:00:10
829000 -- (-893.346) (-892.928) (-892.266) [-893.097] * [-894.690] (-899.141) (-897.193) (-893.006) -- 0:00:10
829500 -- (-893.613) (-892.453) (-892.426) [-893.874] * (-895.493) (-893.655) (-899.648) [-891.803] -- 0:00:10
830000 -- (-892.853) (-891.628) [-891.663] (-892.183) * [-893.436] (-893.148) (-893.070) (-892.637) -- 0:00:10
Average standard deviation of split frequencies: 0.005713
830500 -- (-897.072) (-893.280) [-892.563] (-892.621) * (-893.243) (-892.900) (-892.600) [-892.915] -- 0:00:10
831000 -- [-895.764] (-894.620) (-891.261) (-892.830) * (-898.847) (-892.655) [-893.512] (-893.416) -- 0:00:10
831500 -- [-892.847] (-895.646) (-891.947) (-893.908) * [-895.075] (-895.417) (-891.420) (-893.605) -- 0:00:10
832000 -- (-891.327) [-896.484] (-893.426) (-892.214) * (-891.484) (-894.188) [-894.702] (-894.414) -- 0:00:10
832500 -- [-891.416] (-894.058) (-891.980) (-891.181) * (-891.756) (-893.548) [-892.291] (-895.007) -- 0:00:10
833000 -- (-892.135) (-892.532) (-892.395) [-891.636] * (-892.809) (-892.557) [-891.885] (-891.658) -- 0:00:10
833500 -- (-897.688) (-891.796) (-892.018) [-892.951] * (-892.443) [-895.092] (-891.682) (-895.837) -- 0:00:10
834000 -- (-892.657) (-892.199) [-891.884] (-893.520) * [-893.820] (-892.823) (-893.631) (-894.189) -- 0:00:10
834500 -- (-892.371) [-892.854] (-891.734) (-893.476) * (-896.428) (-892.310) (-897.874) [-894.101] -- 0:00:10
835000 -- (-894.344) (-892.855) [-891.957] (-898.056) * (-893.581) (-892.632) (-893.224) [-892.752] -- 0:00:10
Average standard deviation of split frequencies: 0.005639
835500 -- (-896.444) (-899.153) [-892.908] (-893.286) * [-893.158] (-898.672) (-894.347) (-891.555) -- 0:00:10
836000 -- (-897.009) (-894.832) [-894.073] (-892.891) * [-893.517] (-898.220) (-893.018) (-895.958) -- 0:00:10
836500 -- (-897.455) [-894.388] (-892.129) (-898.797) * (-895.411) (-893.041) [-892.027] (-893.078) -- 0:00:09
837000 -- (-898.117) [-892.144] (-892.410) (-891.311) * (-894.510) (-893.334) [-891.155] (-891.614) -- 0:00:09
837500 -- (-897.377) (-896.349) [-892.646] (-894.655) * (-893.711) (-897.435) (-891.268) [-892.803] -- 0:00:09
838000 -- (-895.992) (-894.672) (-893.742) [-892.164] * (-892.621) (-893.708) (-891.709) [-894.630] -- 0:00:09
838500 -- (-892.254) (-892.470) [-892.416] (-892.291) * (-892.249) (-892.657) (-891.549) [-897.067] -- 0:00:09
839000 -- (-892.005) (-894.806) (-893.498) [-894.244] * (-896.221) (-893.394) [-891.607] (-893.907) -- 0:00:09
839500 -- (-893.391) (-894.170) (-891.932) [-894.457] * (-894.968) [-895.031] (-892.875) (-893.492) -- 0:00:09
840000 -- (-896.039) [-895.508] (-891.044) (-893.072) * (-891.314) [-891.808] (-893.071) (-895.279) -- 0:00:09
Average standard deviation of split frequencies: 0.005720
840500 -- (-895.064) (-895.868) [-891.003] (-894.651) * (-894.054) (-893.842) (-892.411) [-895.874] -- 0:00:09
841000 -- (-893.788) [-893.973] (-891.510) (-892.666) * [-891.423] (-892.928) (-892.789) (-893.025) -- 0:00:09
841500 -- (-892.684) (-893.232) [-891.430] (-893.900) * (-891.435) (-892.608) (-892.292) [-892.810] -- 0:00:09
842000 -- (-893.574) [-892.840] (-892.062) (-895.927) * [-895.001] (-891.558) (-893.754) (-896.254) -- 0:00:09
842500 -- [-894.668] (-893.942) (-898.634) (-895.220) * [-891.369] (-894.088) (-892.201) (-895.137) -- 0:00:09
843000 -- (-892.002) (-896.838) [-893.668] (-892.590) * (-892.734) (-892.584) [-892.112] (-891.821) -- 0:00:09
843500 -- [-891.734] (-892.413) (-892.455) (-891.706) * [-892.288] (-892.987) (-891.961) (-893.171) -- 0:00:09
844000 -- (-892.422) (-896.862) [-891.795] (-892.969) * (-894.012) (-898.248) [-892.030] (-891.509) -- 0:00:09
844500 -- (-893.171) [-893.560] (-893.413) (-891.978) * (-891.685) (-898.113) [-893.110] (-893.274) -- 0:00:09
845000 -- (-894.368) (-893.239) (-896.262) [-891.603] * [-892.796] (-892.217) (-896.297) (-893.124) -- 0:00:09
Average standard deviation of split frequencies: 0.005275
845500 -- (-894.066) (-893.722) [-895.042] (-893.661) * [-892.276] (-893.110) (-893.902) (-892.797) -- 0:00:09
846000 -- (-894.708) (-892.174) (-894.591) [-894.904] * (-893.863) (-892.015) (-891.088) [-896.185] -- 0:00:09
846500 -- (-892.895) [-893.165] (-898.385) (-897.515) * [-894.288] (-892.004) (-891.332) (-900.079) -- 0:00:09
847000 -- (-891.363) (-892.953) [-893.108] (-893.240) * [-892.982] (-892.208) (-893.941) (-891.689) -- 0:00:09
847500 -- (-893.201) [-893.675] (-896.503) (-892.700) * (-891.370) (-892.166) [-893.412] (-895.002) -- 0:00:09
848000 -- (-894.634) (-894.756) (-894.254) [-891.891] * [-894.003] (-892.115) (-894.269) (-892.236) -- 0:00:09
848500 -- [-892.890] (-892.721) (-891.948) (-896.537) * (-895.310) (-893.786) (-893.158) [-892.932] -- 0:00:09
849000 -- [-892.272] (-891.690) (-892.807) (-892.492) * (-892.337) [-891.363] (-893.898) (-892.334) -- 0:00:09
849500 -- (-893.265) (-896.196) [-891.188] (-891.967) * (-891.482) (-894.154) [-891.756] (-892.460) -- 0:00:09
850000 -- (-894.304) (-896.864) (-894.965) [-891.759] * [-891.627] (-893.180) (-892.125) (-895.275) -- 0:00:09
Average standard deviation of split frequencies: 0.005098
850500 -- (-894.116) (-898.925) [-892.932] (-892.740) * [-895.442] (-896.709) (-893.126) (-895.123) -- 0:00:09
851000 -- [-891.186] (-893.212) (-899.010) (-892.017) * (-898.369) (-895.237) (-897.786) [-893.368] -- 0:00:09
851500 -- (-892.117) [-891.404] (-897.016) (-893.947) * [-897.049] (-892.879) (-891.688) (-895.210) -- 0:00:09
852000 -- (-892.975) [-892.364] (-895.623) (-895.730) * (-896.662) (-894.963) [-891.565] (-891.520) -- 0:00:09
852500 -- [-892.425] (-892.971) (-892.769) (-895.163) * (-896.718) (-895.429) [-892.684] (-891.388) -- 0:00:08
853000 -- (-892.604) (-895.874) [-892.647] (-893.148) * (-893.633) [-894.451] (-892.750) (-892.818) -- 0:00:08
853500 -- (-894.254) (-895.565) [-894.317] (-893.118) * (-892.485) (-894.461) (-894.000) [-893.926] -- 0:00:08
854000 -- (-892.097) [-895.457] (-891.333) (-893.383) * [-893.971] (-895.241) (-893.731) (-891.963) -- 0:00:08
854500 -- [-892.241] (-892.815) (-895.102) (-896.497) * (-893.260) (-895.380) (-892.795) [-892.933] -- 0:00:08
855000 -- (-892.203) (-895.559) [-893.506] (-893.104) * (-896.155) [-895.350] (-893.255) (-892.286) -- 0:00:08
Average standard deviation of split frequencies: 0.005030
855500 -- (-892.080) (-891.884) [-897.124] (-896.396) * (-892.180) (-893.879) (-891.644) [-894.114] -- 0:00:08
856000 -- (-893.581) (-892.976) [-893.200] (-893.511) * (-892.948) (-893.154) (-897.486) [-892.754] -- 0:00:08
856500 -- [-893.584] (-893.069) (-892.367) (-892.473) * (-892.684) [-892.993] (-895.776) (-892.055) -- 0:00:08
857000 -- (-891.046) [-893.373] (-894.514) (-892.091) * (-892.366) (-898.927) [-891.910] (-894.164) -- 0:00:08
857500 -- (-893.924) (-895.625) (-892.389) [-893.362] * (-894.959) (-895.510) (-893.148) [-893.425] -- 0:00:08
858000 -- [-896.212] (-895.010) (-898.900) (-893.322) * (-896.682) (-896.960) [-892.011] (-894.341) -- 0:00:08
858500 -- (-898.526) (-894.706) [-895.269] (-892.329) * (-892.546) (-895.678) (-892.296) [-892.983] -- 0:00:08
859000 -- (-899.473) (-894.103) [-895.649] (-893.562) * [-891.585] (-892.506) (-891.652) (-891.521) -- 0:00:08
859500 -- (-896.141) (-892.637) (-893.151) [-892.735] * (-891.678) [-892.732] (-895.475) (-892.217) -- 0:00:08
860000 -- (-893.687) (-892.987) (-892.858) [-897.389] * (-892.430) [-892.548] (-893.967) (-891.640) -- 0:00:08
Average standard deviation of split frequencies: 0.004966
860500 -- (-891.347) [-893.059] (-897.499) (-896.305) * (-891.420) [-891.006] (-892.788) (-893.036) -- 0:00:08
861000 -- [-891.955] (-895.332) (-901.192) (-895.281) * (-892.059) (-892.853) [-892.875] (-892.349) -- 0:00:08
861500 -- (-893.891) [-894.701] (-894.714) (-895.562) * (-892.554) (-894.821) [-893.673] (-902.620) -- 0:00:08
862000 -- (-891.758) (-894.874) [-895.164] (-892.983) * [-894.444] (-892.807) (-892.839) (-893.521) -- 0:00:08
862500 -- (-892.229) [-891.346] (-891.360) (-893.217) * (-892.489) [-893.492] (-895.355) (-893.900) -- 0:00:08
863000 -- (-891.626) (-897.889) [-893.750] (-893.631) * (-895.740) (-893.123) [-891.974] (-894.013) -- 0:00:08
863500 -- [-893.728] (-895.566) (-892.529) (-894.480) * (-896.547) (-893.461) (-893.428) [-894.718] -- 0:00:08
864000 -- (-892.887) (-894.400) [-892.466] (-898.449) * (-895.240) (-894.189) (-894.917) [-892.618] -- 0:00:08
864500 -- (-892.977) (-893.530) [-892.016] (-892.431) * (-893.059) (-893.054) (-897.210) [-894.120] -- 0:00:08
865000 -- (-896.002) [-891.574] (-891.615) (-894.291) * (-892.856) (-892.092) (-896.333) [-893.135] -- 0:00:08
Average standard deviation of split frequencies: 0.005443
865500 -- (-897.835) (-892.856) (-891.929) [-892.494] * (-892.926) (-894.714) (-892.564) [-893.624] -- 0:00:08
866000 -- (-895.776) [-895.185] (-891.905) (-895.842) * (-892.978) [-892.148] (-892.217) (-893.431) -- 0:00:08
866500 -- (-894.375) (-891.166) [-892.951] (-894.684) * (-893.869) (-891.327) (-894.856) [-891.887] -- 0:00:08
867000 -- [-894.190] (-892.074) (-892.354) (-891.983) * (-892.681) (-892.709) (-894.446) [-891.963] -- 0:00:08
867500 -- (-893.248) [-893.767] (-896.772) (-892.355) * [-893.683] (-892.448) (-891.807) (-894.512) -- 0:00:08
868000 -- (-892.844) (-893.560) (-895.262) [-894.239] * (-894.649) (-892.920) [-891.990] (-893.343) -- 0:00:08
868500 -- [-895.022] (-892.878) (-892.619) (-894.296) * (-892.624) (-892.421) [-892.964] (-899.642) -- 0:00:08
869000 -- [-893.202] (-891.426) (-891.491) (-894.110) * (-893.403) [-892.850] (-894.042) (-898.025) -- 0:00:07
869500 -- (-892.528) (-892.367) [-891.816] (-894.536) * (-895.131) [-891.306] (-892.546) (-897.395) -- 0:00:07
870000 -- (-892.616) (-894.166) [-891.803] (-895.285) * (-892.045) [-894.590] (-893.135) (-895.997) -- 0:00:07
Average standard deviation of split frequencies: 0.005144
870500 -- (-896.482) (-894.643) [-895.861] (-895.367) * (-892.253) [-892.933] (-891.610) (-896.723) -- 0:00:07
871000 -- (-893.629) [-893.050] (-893.100) (-896.372) * (-892.235) (-893.531) [-892.108] (-894.070) -- 0:00:07
871500 -- (-897.295) (-893.709) (-893.623) [-899.335] * [-893.630] (-892.570) (-891.458) (-893.320) -- 0:00:07
872000 -- (-892.871) [-894.476] (-893.393) (-896.795) * [-892.756] (-893.359) (-893.099) (-896.008) -- 0:00:07
872500 -- (-893.648) [-895.385] (-894.242) (-892.163) * (-892.834) (-893.495) [-892.979] (-892.349) -- 0:00:07
873000 -- (-891.214) (-894.746) [-891.946] (-894.526) * (-893.946) [-895.395] (-893.123) (-892.426) -- 0:00:07
873500 -- (-891.125) [-892.196] (-891.679) (-895.129) * (-895.321) (-893.601) (-892.132) [-892.272] -- 0:00:07
874000 -- (-893.076) [-892.358] (-891.497) (-896.158) * (-893.776) (-891.698) (-895.926) [-892.330] -- 0:00:07
874500 -- [-894.998] (-892.133) (-892.144) (-895.180) * (-894.849) (-891.638) [-891.835] (-900.470) -- 0:00:07
875000 -- (-892.078) (-894.353) [-891.455] (-892.926) * (-892.321) (-894.642) [-894.835] (-892.513) -- 0:00:07
Average standard deviation of split frequencies: 0.004843
875500 -- (-892.189) (-893.054) (-893.409) [-894.831] * (-894.032) (-892.658) [-893.554] (-893.095) -- 0:00:07
876000 -- (-891.387) [-891.532] (-893.397) (-891.969) * (-896.969) (-892.410) (-894.925) [-892.813] -- 0:00:07
876500 -- (-892.195) (-892.301) (-893.928) [-892.638] * (-892.353) (-894.013) (-893.299) [-894.012] -- 0:00:07
877000 -- (-894.737) (-895.861) [-893.196] (-896.121) * (-893.205) (-892.708) (-892.646) [-894.279] -- 0:00:07
877500 -- (-892.558) (-894.924) (-892.745) [-891.464] * [-891.869] (-892.827) (-892.618) (-894.447) -- 0:00:07
878000 -- [-892.696] (-894.166) (-896.947) (-894.149) * [-892.200] (-891.033) (-892.584) (-895.159) -- 0:00:07
878500 -- (-894.336) [-892.312] (-894.867) (-893.010) * (-894.690) [-895.658] (-892.720) (-894.127) -- 0:00:07
879000 -- [-894.490] (-893.810) (-896.630) (-892.637) * (-891.589) [-897.670] (-892.846) (-893.400) -- 0:00:07
879500 -- (-892.906) (-893.022) [-894.303] (-892.340) * [-894.166] (-894.098) (-892.474) (-894.391) -- 0:00:07
880000 -- (-894.177) [-893.147] (-896.196) (-893.953) * (-892.248) [-897.302] (-891.536) (-897.150) -- 0:00:07
Average standard deviation of split frequencies: 0.005353
880500 -- (-894.653) (-893.812) [-894.761] (-893.912) * (-897.203) [-893.258] (-892.828) (-892.961) -- 0:00:07
881000 -- (-895.173) (-896.922) (-892.428) [-895.976] * (-891.437) [-891.912] (-892.700) (-892.211) -- 0:00:07
881500 -- [-896.530] (-893.030) (-898.549) (-903.490) * (-893.781) [-891.334] (-893.696) (-897.324) -- 0:00:07
882000 -- (-896.157) (-894.777) [-894.865] (-893.618) * [-893.378] (-894.544) (-892.442) (-894.674) -- 0:00:07
882500 -- (-896.898) (-893.587) (-893.090) [-893.960] * (-891.582) [-893.819] (-896.836) (-896.521) -- 0:00:07
883000 -- (-892.780) (-898.996) (-894.108) [-892.215] * (-891.668) [-893.547] (-895.053) (-892.329) -- 0:00:07
883500 -- (-893.270) (-895.456) (-894.921) [-894.268] * (-891.461) (-895.698) (-894.838) [-893.977] -- 0:00:07
884000 -- [-891.615] (-895.629) (-891.992) (-894.798) * [-891.397] (-893.010) (-895.600) (-895.135) -- 0:00:07
884500 -- (-894.579) (-893.002) (-892.363) [-892.901] * (-891.807) [-898.130] (-893.416) (-899.907) -- 0:00:07
885000 -- (-893.597) (-891.544) [-891.810] (-893.523) * [-892.814] (-901.725) (-892.615) (-897.241) -- 0:00:07
Average standard deviation of split frequencies: 0.005088
885500 -- (-896.186) (-891.578) (-893.601) [-891.967] * [-895.202] (-892.979) (-892.850) (-897.410) -- 0:00:06
886000 -- (-893.080) [-891.914] (-894.824) (-891.753) * (-895.802) [-892.393] (-897.394) (-893.079) -- 0:00:06
886500 -- (-895.202) (-903.959) [-895.415] (-892.308) * (-894.221) [-893.187] (-893.158) (-892.397) -- 0:00:06
887000 -- (-894.796) [-901.415] (-897.302) (-894.157) * (-892.302) (-892.940) [-891.730] (-893.629) -- 0:00:06
887500 -- (-894.402) (-900.620) (-893.308) [-894.578] * (-893.890) (-893.664) [-892.913] (-892.178) -- 0:00:06
888000 -- (-894.062) (-894.996) [-892.889] (-896.872) * (-894.278) [-893.782] (-893.228) (-896.901) -- 0:00:06
888500 -- (-895.494) (-892.830) (-892.417) [-892.392] * (-891.096) [-894.933] (-892.834) (-894.378) -- 0:00:06
889000 -- (-893.040) (-896.572) (-895.527) [-891.759] * [-891.141] (-894.543) (-891.497) (-892.923) -- 0:00:06
889500 -- (-892.865) (-892.594) (-896.624) [-893.189] * [-891.463] (-891.563) (-893.609) (-891.438) -- 0:00:06
890000 -- (-894.804) (-896.577) (-893.607) [-895.800] * (-895.437) (-891.143) (-893.340) [-892.059] -- 0:00:06
Average standard deviation of split frequencies: 0.005425
890500 -- (-892.967) (-894.357) (-893.102) [-894.690] * (-894.009) [-893.128] (-892.629) (-897.251) -- 0:00:06
891000 -- (-894.474) (-892.863) [-895.056] (-893.453) * (-892.759) [-894.471] (-894.741) (-893.849) -- 0:00:06
891500 -- (-893.288) [-894.632] (-893.462) (-891.919) * (-895.333) (-894.146) (-892.046) [-895.145] -- 0:00:06
892000 -- (-893.005) (-896.666) [-893.881] (-893.236) * (-894.298) (-895.044) (-891.891) [-892.103] -- 0:00:06
892500 -- (-894.431) [-894.406] (-896.494) (-894.454) * [-892.900] (-892.236) (-894.704) (-894.016) -- 0:00:06
893000 -- (-892.824) (-896.420) (-894.831) [-893.313] * (-893.296) (-896.287) [-892.087] (-892.420) -- 0:00:06
893500 -- (-891.073) (-891.468) (-892.677) [-894.395] * (-892.458) (-894.636) (-892.603) [-891.573] -- 0:00:06
894000 -- (-892.559) (-893.811) (-893.143) [-893.011] * (-892.300) (-897.373) [-894.247] (-896.165) -- 0:00:06
894500 -- [-892.600] (-893.299) (-893.247) (-893.059) * [-893.048] (-892.242) (-895.367) (-893.391) -- 0:00:06
895000 -- (-892.449) (-891.737) (-894.543) [-892.955] * (-891.403) (-891.694) [-892.084] (-894.625) -- 0:00:06
Average standard deviation of split frequencies: 0.005557
895500 -- (-892.535) (-893.896) [-896.134] (-891.455) * [-892.436] (-893.977) (-892.907) (-894.087) -- 0:00:06
896000 -- (-892.444) [-891.584] (-892.900) (-891.134) * (-892.081) (-895.252) (-895.354) [-892.650] -- 0:00:06
896500 -- (-898.173) (-892.139) (-892.703) [-891.211] * (-895.578) [-893.686] (-891.409) (-895.775) -- 0:00:06
897000 -- (-895.347) (-895.092) [-893.423] (-893.510) * (-892.327) (-892.483) [-893.537] (-896.654) -- 0:00:06
897500 -- [-897.338] (-897.677) (-899.728) (-894.488) * (-892.528) (-894.539) [-892.531] (-891.774) -- 0:00:06
898000 -- (-894.349) (-893.720) [-898.754] (-891.971) * [-892.336] (-893.563) (-892.212) (-894.372) -- 0:00:06
898500 -- (-893.063) (-891.778) (-894.294) [-892.253] * (-892.021) (-892.141) [-892.015] (-895.517) -- 0:00:06
899000 -- (-892.783) (-892.444) [-891.602] (-892.219) * (-892.136) (-894.442) [-892.552] (-895.546) -- 0:00:06
899500 -- (-894.148) (-892.288) (-893.014) [-893.683] * [-891.356] (-895.378) (-892.329) (-893.819) -- 0:00:06
900000 -- (-894.430) (-892.782) (-892.253) [-892.790] * [-895.599] (-892.730) (-892.855) (-893.154) -- 0:00:06
Average standard deviation of split frequencies: 0.004920
900500 -- (-893.196) (-891.717) [-891.490] (-893.871) * [-891.989] (-894.968) (-891.710) (-891.547) -- 0:00:06
901000 -- (-892.893) [-891.726] (-897.493) (-893.617) * (-891.970) (-891.840) [-892.288] (-892.220) -- 0:00:06
901500 -- (-896.903) (-893.011) (-895.053) [-892.514] * [-899.154] (-894.169) (-893.068) (-892.375) -- 0:00:06
902000 -- (-894.019) [-892.705] (-892.347) (-898.876) * (-893.216) (-894.202) (-894.075) [-891.611] -- 0:00:05
902500 -- (-892.942) (-893.358) [-896.489] (-896.681) * (-896.302) [-892.451] (-894.396) (-894.734) -- 0:00:05
903000 -- (-892.064) [-895.259] (-898.388) (-895.064) * (-894.039) (-896.002) [-895.255] (-892.586) -- 0:00:05
903500 -- (-894.294) [-892.708] (-892.605) (-892.849) * [-894.295] (-893.877) (-902.039) (-892.992) -- 0:00:05
904000 -- (-898.914) (-895.183) (-892.361) [-891.781] * (-896.549) (-894.476) (-900.285) [-891.188] -- 0:00:05
904500 -- (-896.643) (-892.691) [-895.500] (-891.690) * (-892.875) (-892.866) [-893.498] (-892.302) -- 0:00:05
905000 -- [-896.584] (-894.276) (-893.003) (-891.762) * [-893.275] (-893.682) (-894.473) (-893.835) -- 0:00:05
Average standard deviation of split frequencies: 0.004613
905500 -- (-894.296) (-891.840) (-895.022) [-897.300] * (-894.113) [-894.608] (-893.042) (-899.094) -- 0:00:05
906000 -- [-891.986] (-891.752) (-893.816) (-895.579) * [-892.722] (-891.676) (-893.565) (-892.673) -- 0:00:05
906500 -- [-892.453] (-892.030) (-897.748) (-892.806) * (-891.444) (-892.775) (-891.826) [-892.255] -- 0:00:05
907000 -- [-892.436] (-892.858) (-898.690) (-895.717) * (-897.487) (-892.456) (-892.309) [-892.643] -- 0:00:05
907500 -- (-895.153) [-891.598] (-892.428) (-892.013) * (-893.420) (-892.569) (-898.878) [-892.652] -- 0:00:05
908000 -- [-896.177] (-892.578) (-896.953) (-894.920) * (-893.847) (-892.705) (-891.518) [-892.174] -- 0:00:05
908500 -- [-898.338] (-893.759) (-892.691) (-892.633) * (-892.317) (-896.455) (-891.723) [-892.067] -- 0:00:05
909000 -- [-896.221] (-894.967) (-897.742) (-893.864) * (-893.084) (-891.668) (-892.377) [-892.133] -- 0:00:05
909500 -- [-894.450] (-893.017) (-895.182) (-896.088) * (-893.905) [-893.476] (-891.550) (-892.133) -- 0:00:05
910000 -- (-894.496) (-893.652) [-892.301] (-892.721) * (-894.355) (-891.896) [-892.867] (-893.009) -- 0:00:05
Average standard deviation of split frequencies: 0.005079
910500 -- (-892.446) (-895.618) [-893.625] (-892.284) * [-894.869] (-893.383) (-898.564) (-893.840) -- 0:00:05
911000 -- [-893.091] (-895.507) (-893.245) (-891.860) * [-893.930] (-893.451) (-892.934) (-892.860) -- 0:00:05
911500 -- (-891.466) [-892.574] (-893.651) (-895.550) * (-891.922) (-894.101) [-892.321] (-895.127) -- 0:00:05
912000 -- [-891.520] (-892.199) (-891.238) (-895.628) * (-891.156) (-895.853) (-893.600) [-891.814] -- 0:00:05
912500 -- [-891.457] (-894.068) (-892.050) (-892.321) * [-891.981] (-896.510) (-896.231) (-894.813) -- 0:00:05
913000 -- [-891.272] (-896.142) (-892.051) (-894.111) * [-892.318] (-894.844) (-893.843) (-892.422) -- 0:00:05
913500 -- (-891.871) (-893.889) (-893.209) [-892.505] * (-893.582) (-902.137) [-891.589] (-896.100) -- 0:00:05
914000 -- (-897.767) [-892.880] (-892.898) (-893.254) * [-894.266] (-894.970) (-892.617) (-897.142) -- 0:00:05
914500 -- (-892.321) (-892.638) [-894.103] (-893.861) * (-891.911) (-892.368) (-892.149) [-892.005] -- 0:00:05
915000 -- (-894.711) (-891.944) (-897.089) [-892.525] * (-896.592) [-892.390] (-891.767) (-891.643) -- 0:00:05
Average standard deviation of split frequencies: 0.005404
915500 -- (-895.492) (-892.085) (-893.749) [-893.281] * (-895.340) (-893.250) (-895.584) [-892.325] -- 0:00:05
916000 -- (-893.925) (-893.949) [-893.259] (-895.972) * [-895.847] (-896.002) (-894.917) (-893.360) -- 0:00:05
916500 -- (-893.967) [-892.926] (-894.995) (-891.795) * (-893.388) (-893.744) (-892.045) [-893.951] -- 0:00:05
917000 -- (-893.633) (-893.803) [-892.995] (-892.633) * (-894.753) (-893.233) (-893.736) [-892.747] -- 0:00:05
917500 -- (-893.720) (-895.438) (-892.882) [-892.830] * [-893.243] (-893.910) (-893.086) (-894.252) -- 0:00:05
918000 -- (-892.088) [-893.553] (-892.282) (-892.094) * [-891.480] (-891.004) (-897.647) (-894.890) -- 0:00:05
918500 -- (-895.045) [-892.452] (-898.453) (-895.620) * (-891.572) [-891.570] (-893.293) (-893.217) -- 0:00:04
919000 -- (-898.719) (-892.881) [-894.016] (-894.325) * (-891.612) (-895.594) [-895.133] (-892.162) -- 0:00:04
919500 -- (-897.214) (-891.994) [-895.514] (-893.698) * [-891.708] (-895.868) (-891.459) (-892.065) -- 0:00:04
920000 -- (-894.138) (-893.287) [-895.583] (-896.699) * (-893.952) (-896.617) [-892.781] (-894.638) -- 0:00:04
Average standard deviation of split frequencies: 0.005903
920500 -- (-894.042) [-893.056] (-892.140) (-894.633) * (-895.241) (-892.461) [-893.215] (-891.631) -- 0:00:04
921000 -- (-893.223) [-897.913] (-892.224) (-891.606) * (-892.465) (-892.314) (-893.471) [-892.468] -- 0:00:04
921500 -- (-892.097) (-891.989) [-891.463] (-893.708) * (-893.062) (-891.497) (-892.090) [-892.992] -- 0:00:04
922000 -- (-894.148) (-892.355) [-891.608] (-897.575) * (-893.226) (-893.113) [-891.706] (-893.018) -- 0:00:04
922500 -- [-896.888] (-896.118) (-893.929) (-892.459) * (-894.293) (-897.308) [-892.949] (-894.273) -- 0:00:04
923000 -- (-893.632) (-893.165) (-892.557) [-893.494] * (-892.779) (-893.051) [-893.868] (-895.418) -- 0:00:04
923500 -- (-891.015) (-892.832) (-893.976) [-893.006] * [-894.731] (-894.953) (-893.152) (-892.716) -- 0:00:04
924000 -- (-893.606) [-891.783] (-893.093) (-893.625) * (-891.075) [-894.978] (-894.852) (-892.090) -- 0:00:04
924500 -- [-892.038] (-891.910) (-893.951) (-893.639) * (-892.778) [-892.039] (-894.331) (-892.707) -- 0:00:04
925000 -- (-892.736) [-891.249] (-893.946) (-893.981) * [-891.340] (-892.397) (-899.623) (-894.776) -- 0:00:04
Average standard deviation of split frequencies: 0.005780
925500 -- [-896.059] (-892.736) (-900.558) (-892.531) * [-891.506] (-893.231) (-895.981) (-891.824) -- 0:00:04
926000 -- (-897.606) (-892.396) [-893.279] (-898.568) * (-893.707) [-894.132] (-897.795) (-892.012) -- 0:00:04
926500 -- (-894.351) (-893.594) (-897.122) [-893.961] * (-892.163) (-896.113) (-892.008) [-891.846] -- 0:00:04
927000 -- (-892.916) (-892.370) (-896.086) [-891.828] * (-892.547) (-895.664) [-892.831] (-894.507) -- 0:00:04
927500 -- (-893.262) [-895.170] (-892.791) (-892.255) * (-893.125) (-891.587) (-896.692) [-893.441] -- 0:00:04
928000 -- (-892.457) (-892.035) [-891.618] (-894.272) * (-892.176) (-896.513) (-894.048) [-894.313] -- 0:00:04
928500 -- (-891.930) [-894.291] (-894.571) (-892.319) * [-891.868] (-894.080) (-893.346) (-894.743) -- 0:00:04
929000 -- [-891.192] (-892.114) (-893.144) (-896.147) * (-893.612) (-892.701) (-891.369) [-895.262] -- 0:00:04
929500 -- [-891.071] (-895.412) (-891.976) (-897.595) * (-895.216) (-892.806) (-892.723) [-894.312] -- 0:00:04
930000 -- (-891.812) (-896.708) [-894.887] (-898.184) * (-892.154) (-891.668) [-891.620] (-898.030) -- 0:00:04
Average standard deviation of split frequencies: 0.005870
930500 -- (-892.657) (-893.988) (-896.208) [-893.815] * (-891.584) (-892.688) [-891.876] (-896.983) -- 0:00:04
931000 -- (-893.508) (-894.451) [-896.100] (-891.882) * [-892.720] (-892.480) (-895.004) (-899.140) -- 0:00:04
931500 -- (-893.242) (-891.325) (-892.635) [-891.743] * (-893.158) [-892.245] (-892.799) (-892.630) -- 0:00:04
932000 -- (-894.679) (-891.316) [-892.787] (-894.492) * [-894.915] (-892.275) (-891.651) (-892.297) -- 0:00:04
932500 -- (-893.048) [-891.904] (-892.181) (-892.903) * (-896.126) (-892.803) [-891.586] (-892.409) -- 0:00:04
933000 -- [-893.745] (-891.355) (-892.128) (-892.662) * [-893.236] (-891.854) (-891.331) (-892.671) -- 0:00:04
933500 -- [-893.917] (-896.306) (-892.280) (-893.256) * (-891.313) (-893.394) (-893.143) [-892.086] -- 0:00:04
934000 -- (-892.492) (-893.590) [-892.947] (-895.969) * (-894.884) [-891.810] (-897.688) (-892.893) -- 0:00:04
934500 -- (-893.106) (-891.618) [-892.421] (-894.242) * (-895.308) (-890.897) (-897.419) [-894.238] -- 0:00:03
935000 -- (-892.754) [-891.365] (-896.175) (-893.001) * [-892.086] (-890.958) (-901.244) (-892.159) -- 0:00:03
Average standard deviation of split frequencies: 0.005036
935500 -- (-891.159) (-894.586) (-891.253) [-892.228] * (-891.946) [-891.637] (-896.234) (-893.976) -- 0:00:03
936000 -- (-891.125) (-893.962) [-893.478] (-893.235) * [-894.691] (-896.361) (-892.821) (-892.302) -- 0:00:03
936500 -- [-894.150] (-896.534) (-897.015) (-893.071) * [-893.163] (-893.650) (-893.577) (-893.116) -- 0:00:03
937000 -- (-893.499) (-892.523) (-893.731) [-891.365] * (-892.280) (-893.078) (-895.995) [-893.445] -- 0:00:03
937500 -- (-894.715) (-892.133) [-894.026] (-893.131) * (-891.964) (-893.428) [-891.879] (-895.049) -- 0:00:03
938000 -- (-894.802) [-892.586] (-891.841) (-895.315) * (-891.026) (-896.154) (-894.834) [-893.393] -- 0:00:03
938500 -- [-894.714] (-892.652) (-895.245) (-894.400) * (-891.230) [-895.326] (-895.067) (-893.773) -- 0:00:03
939000 -- (-893.710) (-891.645) [-892.428] (-892.508) * (-892.180) (-896.036) (-893.777) [-895.201] -- 0:00:03
939500 -- (-894.544) [-891.636] (-893.463) (-891.599) * (-892.759) (-893.901) (-894.656) [-892.488] -- 0:00:03
940000 -- [-892.840] (-891.703) (-891.645) (-891.382) * (-894.918) (-894.504) (-897.824) [-892.069] -- 0:00:03
Average standard deviation of split frequencies: 0.004778
940500 -- (-892.575) (-892.300) (-891.799) [-893.621] * (-893.537) (-895.180) [-891.456] (-891.277) -- 0:00:03
941000 -- (-892.035) (-893.157) [-894.944] (-893.208) * (-893.158) [-896.718] (-896.746) (-892.088) -- 0:00:03
941500 -- [-891.641] (-897.584) (-891.771) (-892.963) * [-892.878] (-892.633) (-900.238) (-892.224) -- 0:00:03
942000 -- (-893.532) [-892.838] (-891.327) (-895.048) * [-891.058] (-895.500) (-898.752) (-895.937) -- 0:00:03
942500 -- (-891.872) (-891.659) [-891.886] (-893.402) * (-895.546) (-897.345) [-892.997] (-896.682) -- 0:00:03
943000 -- (-891.789) [-893.148] (-891.396) (-892.967) * [-895.380] (-894.055) (-894.266) (-891.953) -- 0:00:03
943500 -- [-892.358] (-899.887) (-893.213) (-891.445) * (-891.754) [-892.130] (-892.674) (-891.982) -- 0:00:03
944000 -- (-891.104) (-897.090) [-894.265] (-894.489) * (-891.335) (-894.482) [-891.618] (-893.306) -- 0:00:03
944500 -- (-891.641) [-891.731] (-896.107) (-892.279) * (-891.905) (-894.474) [-893.317] (-895.604) -- 0:00:03
945000 -- (-892.790) (-894.282) (-897.696) [-891.402] * (-891.563) (-893.826) (-895.327) [-891.869] -- 0:00:03
Average standard deviation of split frequencies: 0.005201
945500 -- (-892.490) (-894.329) (-895.797) [-891.693] * [-892.380] (-893.461) (-897.280) (-893.690) -- 0:00:03
946000 -- (-893.319) [-891.488] (-895.988) (-891.112) * (-896.725) [-893.799] (-894.108) (-897.854) -- 0:00:03
946500 -- (-893.867) (-893.330) [-892.192] (-891.277) * (-893.650) (-898.259) (-897.634) [-897.709] -- 0:00:03
947000 -- [-892.154] (-893.819) (-891.789) (-892.986) * [-894.710] (-894.989) (-895.588) (-896.206) -- 0:00:03
947500 -- (-893.223) (-893.784) (-892.180) [-891.253] * (-892.832) [-895.362] (-894.131) (-893.761) -- 0:00:03
948000 -- [-891.396] (-894.435) (-892.295) (-891.633) * (-894.899) (-898.102) (-897.051) [-892.358] -- 0:00:03
948500 -- (-892.496) (-892.442) (-895.361) [-892.241] * [-894.074] (-893.676) (-893.296) (-892.105) -- 0:00:03
949000 -- (-898.269) [-891.718] (-893.006) (-894.856) * (-892.071) (-895.710) [-892.841] (-892.364) -- 0:00:03
949500 -- (-892.118) [-892.139] (-893.708) (-892.131) * (-891.908) (-891.732) [-894.599] (-893.190) -- 0:00:03
950000 -- [-892.034] (-892.661) (-892.635) (-894.711) * (-893.997) (-893.868) (-892.300) [-894.011] -- 0:00:03
Average standard deviation of split frequencies: 0.005486
950500 -- (-891.329) [-892.601] (-894.264) (-893.007) * (-892.906) (-891.096) (-896.550) [-894.242] -- 0:00:03
951000 -- (-896.910) (-891.372) (-892.746) [-898.678] * [-892.020] (-891.430) (-898.934) (-892.701) -- 0:00:02
951500 -- [-894.558] (-895.003) (-893.614) (-896.726) * [-892.001] (-892.944) (-893.091) (-893.857) -- 0:00:02
952000 -- (-893.141) (-892.148) (-892.636) [-897.654] * [-892.741] (-893.032) (-892.578) (-893.291) -- 0:00:02
952500 -- (-892.739) (-892.377) [-891.320] (-896.874) * [-893.939] (-893.031) (-894.320) (-894.686) -- 0:00:02
953000 -- (-898.775) (-892.291) [-893.734] (-894.192) * (-895.902) [-892.926] (-892.709) (-894.206) -- 0:00:02
953500 -- (-892.071) (-894.402) [-892.527] (-892.943) * (-895.269) [-893.083] (-894.534) (-892.466) -- 0:00:02
954000 -- (-895.740) [-892.611] (-893.864) (-895.853) * (-897.313) (-894.875) (-894.166) [-892.490] -- 0:00:02
954500 -- (-894.526) (-892.286) (-895.700) [-891.741] * (-893.777) (-897.978) (-895.034) [-894.978] -- 0:00:02
955000 -- (-895.750) (-892.838) [-892.993] (-891.717) * (-894.981) (-896.203) (-892.487) [-895.751] -- 0:00:02
Average standard deviation of split frequencies: 0.005455
955500 -- (-894.648) [-891.042] (-891.481) (-896.526) * (-899.812) (-891.132) (-891.927) [-896.727] -- 0:00:02
956000 -- (-892.414) (-892.522) (-891.609) [-892.114] * (-896.565) (-890.985) (-895.527) [-893.936] -- 0:00:02
956500 -- (-892.170) [-892.530] (-893.525) (-892.289) * [-892.657] (-893.337) (-891.836) (-893.091) -- 0:00:02
957000 -- (-891.531) (-893.637) (-894.713) [-893.439] * (-891.331) (-900.677) (-894.443) [-893.209] -- 0:00:02
957500 -- (-893.876) [-892.419] (-895.300) (-892.056) * (-892.836) [-896.137] (-894.610) (-891.848) -- 0:00:02
958000 -- (-892.283) (-893.626) [-894.088] (-891.761) * [-892.793] (-896.084) (-893.446) (-893.185) -- 0:00:02
958500 -- [-891.164] (-891.694) (-894.648) (-895.138) * (-893.540) (-898.283) (-892.713) [-893.157] -- 0:00:02
959000 -- [-891.461] (-892.133) (-893.761) (-893.507) * (-892.736) (-899.884) [-892.699] (-893.764) -- 0:00:02
959500 -- (-894.519) (-891.879) [-895.324] (-892.215) * (-892.612) (-892.752) [-893.109] (-893.221) -- 0:00:02
960000 -- (-893.846) (-894.478) (-896.748) [-892.841] * (-894.978) (-892.480) [-893.919] (-898.267) -- 0:00:02
Average standard deviation of split frequencies: 0.005551
960500 -- (-895.483) (-892.015) (-892.030) [-893.163] * [-893.014] (-894.658) (-893.624) (-898.582) -- 0:00:02
961000 -- (-892.217) (-895.323) [-892.137] (-892.119) * [-893.887] (-898.821) (-897.945) (-898.663) -- 0:00:02
961500 -- (-891.509) (-895.131) (-893.791) [-891.569] * (-892.942) (-891.476) [-893.387] (-894.077) -- 0:00:02
962000 -- (-891.379) (-894.765) (-895.610) [-895.592] * [-894.804] (-891.475) (-895.435) (-894.198) -- 0:00:02
962500 -- [-891.659] (-894.296) (-894.675) (-893.979) * (-891.507) [-892.072] (-895.294) (-892.049) -- 0:00:02
963000 -- [-891.745] (-893.864) (-892.353) (-891.894) * (-891.296) (-894.846) (-895.490) [-894.287] -- 0:00:02
963500 -- [-895.449] (-895.329) (-893.663) (-891.561) * (-892.132) (-893.191) [-896.598] (-893.425) -- 0:00:02
964000 -- (-898.310) [-893.308] (-895.907) (-891.931) * (-892.252) (-896.192) (-891.469) [-895.725] -- 0:00:02
964500 -- (-895.619) [-891.945] (-895.704) (-892.877) * (-891.916) (-892.381) [-891.225] (-893.579) -- 0:00:02
965000 -- (-892.391) [-893.101] (-894.938) (-892.497) * (-891.685) [-894.238] (-893.367) (-894.812) -- 0:00:02
Average standard deviation of split frequencies: 0.005185
965500 -- (-892.992) [-892.133] (-898.329) (-892.038) * (-891.449) (-892.038) (-892.066) [-896.759] -- 0:00:02
966000 -- (-894.452) [-892.647] (-891.691) (-891.589) * [-891.156] (-893.403) (-894.696) (-893.257) -- 0:00:02
966500 -- (-895.439) (-891.889) [-892.217] (-896.769) * [-894.929] (-893.061) (-895.766) (-893.439) -- 0:00:02
967000 -- (-893.538) [-892.446] (-893.954) (-895.195) * (-896.251) (-891.844) [-892.873] (-896.860) -- 0:00:02
967500 -- (-894.042) (-893.243) (-895.078) [-894.908] * (-895.226) (-895.798) (-892.679) [-900.838] -- 0:00:01
968000 -- [-892.674] (-893.703) (-899.130) (-894.613) * (-891.157) [-898.911] (-892.865) (-892.136) -- 0:00:01
968500 -- (-892.505) [-892.634] (-891.797) (-898.086) * [-896.442] (-895.756) (-893.068) (-895.166) -- 0:00:01
969000 -- (-893.982) (-891.912) (-894.458) [-898.072] * (-895.027) [-893.270] (-894.211) (-895.006) -- 0:00:01
969500 -- (-893.105) (-891.607) [-894.288] (-894.628) * [-892.380] (-892.794) (-891.857) (-896.775) -- 0:00:01
970000 -- (-892.161) [-894.372] (-893.600) (-892.497) * (-892.453) [-892.609] (-894.519) (-893.555) -- 0:00:01
Average standard deviation of split frequencies: 0.004735
970500 -- (-893.144) (-892.705) [-892.116] (-891.958) * (-892.451) (-892.299) (-892.193) [-894.490] -- 0:00:01
971000 -- (-891.407) [-894.680] (-894.086) (-891.554) * (-892.183) [-891.629] (-895.974) (-894.806) -- 0:00:01
971500 -- (-893.399) (-896.630) [-894.924] (-892.349) * (-891.787) [-891.205] (-894.701) (-896.225) -- 0:00:01
972000 -- (-892.244) (-891.192) (-897.635) [-892.933] * [-891.527] (-892.794) (-895.059) (-892.483) -- 0:00:01
972500 -- (-900.717) (-892.466) [-892.787] (-892.981) * (-891.216) (-894.717) (-892.436) [-892.733] -- 0:00:01
973000 -- (-893.223) [-891.870] (-892.070) (-895.833) * [-896.475] (-892.009) (-893.063) (-893.651) -- 0:00:01
973500 -- (-894.014) (-895.383) (-892.405) [-893.049] * (-892.391) (-891.972) (-898.142) [-892.772] -- 0:00:01
974000 -- (-891.580) (-891.629) [-891.710] (-893.998) * [-892.477] (-891.583) (-892.060) (-894.721) -- 0:00:01
974500 -- (-892.494) [-892.564] (-894.265) (-892.825) * (-891.416) (-894.667) [-895.053] (-892.258) -- 0:00:01
975000 -- (-893.132) (-892.324) (-892.262) [-892.841] * (-892.461) (-892.190) (-892.215) [-893.198] -- 0:00:01
Average standard deviation of split frequencies: 0.004800
975500 -- [-893.692] (-902.143) (-893.169) (-892.779) * (-893.483) [-893.539] (-894.080) (-895.487) -- 0:00:01
976000 -- (-895.278) (-895.172) (-892.416) [-893.231] * [-894.797] (-894.935) (-894.183) (-894.005) -- 0:00:01
976500 -- (-894.975) (-900.588) (-891.752) [-893.537] * (-894.257) (-893.135) [-893.447] (-891.291) -- 0:00:01
977000 -- (-895.238) (-894.500) [-893.218] (-895.107) * (-895.077) (-891.357) [-893.584] (-892.243) -- 0:00:01
977500 -- (-893.649) [-895.784] (-894.512) (-893.932) * (-892.593) (-894.791) (-893.121) [-891.855] -- 0:00:01
978000 -- (-894.178) [-895.289] (-892.447) (-891.638) * [-894.285] (-894.680) (-895.829) (-892.971) -- 0:00:01
978500 -- (-895.009) (-894.955) [-893.107] (-893.990) * (-892.140) (-895.806) (-892.291) [-891.688] -- 0:00:01
979000 -- (-893.948) (-893.504) (-898.212) [-893.285] * [-892.057] (-892.532) (-892.534) (-893.763) -- 0:00:01
979500 -- (-894.789) (-893.760) (-895.709) [-894.634] * (-893.264) [-891.901] (-895.091) (-892.534) -- 0:00:01
980000 -- [-892.789] (-893.117) (-899.499) (-893.325) * (-892.974) [-895.152] (-894.999) (-893.400) -- 0:00:01
Average standard deviation of split frequencies: 0.004837
980500 -- (-892.295) (-892.379) [-893.204] (-895.911) * [-891.991] (-894.269) (-895.114) (-894.079) -- 0:00:01
981000 -- [-892.603] (-896.368) (-891.927) (-896.439) * (-891.844) (-892.329) [-891.954] (-892.119) -- 0:00:01
981500 -- (-891.531) (-892.477) (-891.578) [-893.251] * (-893.079) (-893.913) (-891.837) [-892.269] -- 0:00:01
982000 -- (-893.069) [-891.278] (-895.641) (-893.849) * (-892.349) (-899.885) [-893.063] (-892.622) -- 0:00:01
982500 -- (-898.310) (-897.514) [-891.775] (-894.514) * (-892.311) (-895.557) (-895.539) [-892.443] -- 0:00:01
983000 -- (-892.833) [-893.158] (-893.351) (-893.198) * (-893.498) (-894.744) [-894.132] (-894.166) -- 0:00:01
983500 -- [-892.585] (-899.063) (-893.197) (-891.848) * [-893.575] (-892.919) (-897.306) (-899.861) -- 0:00:01
984000 -- [-891.564] (-893.986) (-896.690) (-891.765) * [-893.467] (-893.111) (-897.447) (-894.845) -- 0:00:00
984500 -- [-892.688] (-893.263) (-894.452) (-891.720) * [-892.483] (-892.404) (-892.940) (-891.605) -- 0:00:00
985000 -- [-891.778] (-897.196) (-891.478) (-893.894) * [-894.424] (-893.968) (-892.855) (-892.702) -- 0:00:00
Average standard deviation of split frequencies: 0.004871
985500 -- (-892.882) (-895.738) (-891.114) [-894.365] * [-891.281] (-893.058) (-892.800) (-894.864) -- 0:00:00
986000 -- (-891.548) [-891.551] (-891.509) (-894.667) * (-891.970) [-892.178] (-891.734) (-892.222) -- 0:00:00
986500 -- (-891.548) (-893.055) [-892.122] (-893.179) * [-891.477] (-892.480) (-893.034) (-895.073) -- 0:00:00
987000 -- [-894.283] (-891.863) (-891.424) (-892.525) * (-892.446) (-894.601) (-892.500) [-895.414] -- 0:00:00
987500 -- [-892.905] (-891.920) (-892.987) (-891.121) * (-892.781) [-893.019] (-892.795) (-894.678) -- 0:00:00
988000 -- (-893.701) (-892.922) [-892.133] (-894.482) * (-897.276) (-900.844) (-893.338) [-894.010] -- 0:00:00
988500 -- (-894.507) (-892.376) (-896.222) [-896.168] * (-895.836) (-896.051) (-892.031) [-892.413] -- 0:00:00
989000 -- [-893.961] (-892.829) (-894.419) (-893.267) * (-894.016) (-895.020) [-893.890] (-894.191) -- 0:00:00
989500 -- (-897.186) (-893.109) [-895.903] (-891.842) * [-892.361] (-893.377) (-896.507) (-893.051) -- 0:00:00
990000 -- (-893.542) [-895.630] (-894.276) (-892.749) * (-895.011) [-894.637] (-895.859) (-892.972) -- 0:00:00
Average standard deviation of split frequencies: 0.005561
990500 -- (-893.453) [-894.069] (-893.608) (-892.179) * (-895.301) [-895.175] (-893.770) (-891.668) -- 0:00:00
991000 -- (-893.792) [-893.514] (-898.353) (-891.905) * (-894.876) [-893.921] (-892.735) (-892.430) -- 0:00:00
991500 -- (-893.847) (-896.165) (-893.668) [-893.870] * (-893.252) (-892.972) [-897.235] (-893.033) -- 0:00:00
992000 -- [-894.524] (-893.290) (-897.522) (-893.223) * (-891.845) (-893.667) (-892.738) [-893.514] -- 0:00:00
992500 -- [-892.748] (-892.661) (-894.851) (-894.126) * (-892.362) [-893.002] (-892.486) (-897.439) -- 0:00:00
993000 -- (-900.692) (-892.067) (-894.240) [-892.453] * [-891.490] (-892.051) (-891.861) (-893.049) -- 0:00:00
993500 -- [-893.918] (-898.638) (-892.633) (-891.968) * (-892.474) (-894.362) [-891.990] (-894.366) -- 0:00:00
994000 -- (-894.709) [-892.999] (-892.710) (-891.148) * (-892.346) [-897.065] (-891.990) (-893.666) -- 0:00:00
994500 -- (-892.981) [-892.714] (-894.642) (-891.702) * (-893.590) (-899.414) [-890.923] (-892.945) -- 0:00:00
995000 -- (-893.793) [-892.018] (-893.252) (-893.086) * (-893.502) (-899.169) (-891.540) [-891.263] -- 0:00:00
Average standard deviation of split frequencies: 0.005384
995500 -- [-895.509] (-891.871) (-891.592) (-894.749) * (-892.547) (-893.081) [-891.540] (-891.665) -- 0:00:00
996000 -- (-893.833) (-894.855) [-891.595] (-892.909) * (-893.106) [-892.207] (-891.453) (-892.222) -- 0:00:00
996500 -- (-894.630) (-893.553) [-892.448] (-891.538) * (-895.693) (-894.809) [-891.487] (-896.287) -- 0:00:00
997000 -- (-893.986) (-893.702) (-894.598) [-891.457] * [-896.030] (-894.110) (-892.345) (-894.763) -- 0:00:00
997500 -- (-893.466) (-893.282) (-891.467) [-894.826] * (-895.205) (-892.616) [-891.608] (-892.886) -- 0:00:00
998000 -- (-894.487) (-893.253) [-896.902] (-892.436) * (-891.206) (-893.849) [-892.138] (-891.900) -- 0:00:00
998500 -- (-893.926) (-893.248) (-897.181) [-891.773] * (-892.714) (-895.416) [-895.814] (-893.159) -- 0:00:00
999000 -- (-892.782) [-891.993] (-894.689) (-894.866) * (-894.963) (-892.067) [-893.250] (-895.011) -- 0:00:00
999500 -- (-893.072) (-893.798) [-897.202] (-901.460) * (-895.490) (-894.171) [-892.241] (-896.286) -- 0:00:00
1000000 -- [-894.065] (-892.454) (-897.017) (-897.387) * [-892.873] (-893.637) (-895.966) (-891.757) -- 0:00:00
Average standard deviation of split frequencies: 0.005388
Analysis completed in 1 mins 1 seconds
Analysis used 59.68 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -890.84
Likelihood of best state for "cold" chain of run 2 was -890.84
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 74 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
27.9 % ( 20 %) Dirichlet(Pi{all})
30.6 % ( 37 %) Slider(Pi{all})
78.8 % ( 48 %) Multiplier(Alpha{1,2})
78.1 % ( 46 %) Multiplier(Alpha{3})
21.4 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.8 % ( 31 %) Dirichlet(Pi{all})
30.6 % ( 23 %) Slider(Pi{all})
78.8 % ( 48 %) Multiplier(Alpha{1,2})
78.1 % ( 55 %) Multiplier(Alpha{3})
21.3 % ( 17 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 34 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167247 0.82 0.67
3 | 166761 166490 0.84
4 | 165967 166906 166629
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167185 0.82 0.67
3 | 166236 166838 0.84
4 | 166541 166726 166474
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -892.49
| 1 2 1 |
| 2 1 1 |
|1 1 1 2 |
| 1 1 1 1 1 1 2 1 2 22 |
|2 2 1 22 11 1 * |
| 2 222 2 2 2 1 2 11 |
| 2 222 1 11 21 2* 1 2 11 222 21 2|
| 1 2 1 2 1 1 * 1 1 2 2 |
| * 1 *2 1 1 2 1 2 |
| 1 2 1 2 12 2 1 2 |
| 1 * 2 2 2 2 1 1 1 211 1|
| 2 2 |
| 2 2 11 2 |
| 1 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -894.33
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -892.55 -895.62
2 -892.57 -895.97
--------------------------------------
TOTAL -892.56 -895.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891336 0.087440 0.394933 1.505938 0.861274 1452.94 1476.97 1.000
r(A<->C){all} 0.160798 0.018944 0.000005 0.432358 0.123551 159.38 205.76 1.000
r(A<->G){all} 0.165671 0.020926 0.000171 0.469502 0.122877 116.65 173.61 1.001
r(A<->T){all} 0.171627 0.020165 0.000506 0.461164 0.137174 200.72 228.76 1.000
r(C<->G){all} 0.173495 0.022942 0.000078 0.494333 0.126775 154.04 155.76 1.004
r(C<->T){all} 0.173837 0.021256 0.000056 0.462386 0.136530 193.93 287.90 1.005
r(G<->T){all} 0.154572 0.017951 0.000182 0.430417 0.115562 88.06 115.36 1.004
pi(A){all} 0.230668 0.000267 0.198668 0.262116 0.230696 1277.21 1341.54 1.000
pi(C){all} 0.256357 0.000291 0.224832 0.290736 0.256066 956.38 1141.34 1.000
pi(G){all} 0.308229 0.000332 0.273518 0.343848 0.307769 1116.00 1214.94 1.000
pi(T){all} 0.204746 0.000245 0.176282 0.236711 0.204331 1255.90 1336.64 1.001
alpha{1,2} 0.418142 0.247079 0.000147 1.422119 0.239029 1171.20 1187.93 1.000
alpha{3} 0.460363 0.258399 0.000146 1.482566 0.288343 1077.52 1201.97 1.001
pinvar{all} 0.997559 0.000008 0.992018 0.999999 0.998521 978.83 1135.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ...**.
9 -- .*...*
10 -- ..**..
11 -- ...*.*
12 -- .*..*.
13 -- .**.**
14 -- .**...
15 -- .****.
16 -- ....**
17 -- .***.*
18 -- .*.*..
19 -- ..*..*
20 -- ..****
21 -- ..*.*.
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.002355 0.152565 0.155896 2
8 455 0.151566 0.006124 0.147235 0.155896 2
9 448 0.149234 0.004711 0.145903 0.152565 2
10 442 0.147235 0.004711 0.143904 0.150566 2
11 437 0.145570 0.003298 0.143238 0.147901 2
12 429 0.142905 0.011777 0.134577 0.151233 2
13 427 0.142239 0.001413 0.141239 0.143238 2
14 425 0.141572 0.008951 0.135243 0.147901 2
15 425 0.141572 0.005182 0.137908 0.145237 2
16 425 0.141572 0.007066 0.136576 0.146569 2
17 422 0.140573 0.002827 0.138574 0.142572 2
18 417 0.138907 0.007066 0.133911 0.143904 2
19 410 0.136576 0.001884 0.135243 0.137908 2
20 406 0.135243 0.005653 0.131246 0.139241 2
21 406 0.135243 0.001884 0.133911 0.136576 2
22 280 0.093271 0.011306 0.085276 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099747 0.009471 0.000072 0.288646 0.070488 1.000 2
length{all}[2] 0.100802 0.010415 0.000138 0.305717 0.069216 1.000 2
length{all}[3] 0.096045 0.009012 0.000064 0.281999 0.068377 1.000 2
length{all}[4] 0.098468 0.010024 0.000046 0.287335 0.067765 1.000 2
length{all}[5] 0.101465 0.010263 0.000067 0.297292 0.071665 1.000 2
length{all}[6] 0.099557 0.009428 0.000002 0.298919 0.068243 1.000 2
length{all}[7] 0.098808 0.009161 0.000157 0.296289 0.068114 1.002 2
length{all}[8] 0.099827 0.011048 0.000227 0.312282 0.070978 0.998 2
length{all}[9] 0.104790 0.010645 0.000855 0.307645 0.074005 0.998 2
length{all}[10] 0.100028 0.008820 0.000433 0.336089 0.080189 0.998 2
length{all}[11] 0.097732 0.008793 0.000232 0.283212 0.070079 1.013 2
length{all}[12] 0.103197 0.010656 0.000101 0.328008 0.068557 1.000 2
length{all}[13] 0.092677 0.008093 0.000136 0.277349 0.065598 0.998 2
length{all}[14] 0.095130 0.009409 0.000047 0.274610 0.065920 0.999 2
length{all}[15] 0.094135 0.010815 0.000177 0.298494 0.057486 1.000 2
length{all}[16] 0.098839 0.011052 0.000007 0.270921 0.071368 0.998 2
length{all}[17] 0.098960 0.009413 0.000584 0.301765 0.069444 1.002 2
length{all}[18] 0.095627 0.007739 0.000051 0.271466 0.071596 0.999 2
length{all}[19] 0.105521 0.011376 0.000021 0.314404 0.076626 0.999 2
length{all}[20] 0.102913 0.009203 0.000030 0.284889 0.075847 1.009 2
length{all}[21] 0.084955 0.007339 0.000016 0.265246 0.057242 1.000 2
length{all}[22] 0.104000 0.012647 0.000462 0.307448 0.070900 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005388
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 47 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 648
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 216 / 216 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 216 / 216 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080421 0.108124 0.060767 0.055109 0.073660 0.031018 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -955.330694
Iterating by ming2
Initial: fx= 955.330694
x= 0.08042 0.10812 0.06077 0.05511 0.07366 0.03102 0.30000 1.30000
1 h-m-p 0.0000 0.0001 521.7855 ++ 915.841414 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0123 85.6751 ++ 900.501844 m 0.0123 24 | 2/8
3 h-m-p 0.0000 0.0001 884.5718 ++ 893.623461 m 0.0001 35 | 3/8
4 h-m-p 0.0000 0.0000 47967.3301 ++ 883.066289 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0001 83.6191 ++ 882.570118 m 0.0001 57 | 5/8
6 h-m-p 0.0000 0.0002 93.8622 ++ 878.640355 m 0.0002 68 | 6/8
7 h-m-p 0.0002 0.0072 51.3847 +++ 867.732111 m 0.0072 80 | 7/8
8 h-m-p 1.6000 8.0000 0.0002 ++ 867.732110 m 8.0000 91 | 7/8
9 h-m-p 0.0050 1.0907 0.3839 ++++ 867.731953 m 1.0907 105 | 8/8
10 h-m-p 0.0160 8.0000 0.0000 N 867.731953 0 0.0160 117 | 8/8
11 h-m-p 0.0160 8.0000 0.0000 N 867.731953 0 0.0160 128
Out..
lnL = -867.731953
129 lfun, 129 eigenQcodon, 774 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021628 0.021112 0.091479 0.059664 0.030442 0.029593 0.000100 0.805905 0.330513
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 16.201117
np = 9
lnL0 = -919.786389
Iterating by ming2
Initial: fx= 919.786389
x= 0.02163 0.02111 0.09148 0.05966 0.03044 0.02959 0.00011 0.80591 0.33051
1 h-m-p 0.0000 0.0000 491.2845 ++ 918.785542 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 363.6819 +++ 893.614309 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 258.5081 ++ 893.158195 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0003 162.5637 +++ 886.368089 m 0.0003 52 | 4/9
5 h-m-p 0.0000 0.0000 342.5649 ++ 885.880641 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0001 990.7124 ++ 874.648289 m 0.0001 76 | 6/9
7 h-m-p 0.0000 0.0001 392.2446 ++ 867.732271 m 0.0001 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 867.732271 m 8.0000 100 | 7/9
9 h-m-p 0.0013 0.3884 0.8340 ---------C 867.732271 0 0.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0002 +++++ 867.732270 m 8.0000 140 | 7/9
11 h-m-p 0.0062 2.8017 0.3129 ------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0009 +++++ 867.732262 m 8.0000 181 | 7/9
13 h-m-p 0.0445 7.2606 0.1700 ------------C 867.732262 0 0.0000 207 | 7/9
14 h-m-p 0.0160 8.0000 0.0023 +++++ 867.732247 m 8.0000 224 | 7/9
15 h-m-p 0.0839 4.0820 0.2227 --------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0011 +++++ 867.732237 m 8.0000 267 | 7/9
17 h-m-p 0.0546 7.9879 0.1595 --------------.. | 7/9
18 h-m-p 0.0160 8.0000 0.0012 +++++ 867.732226 m 8.0000 310 | 7/9
19 h-m-p 0.0592 8.0000 0.1555 -------------C 867.732226 0 0.0000 337 | 7/9
20 h-m-p 0.0160 8.0000 0.0004 +++++ 867.732225 m 8.0000 354 | 7/9
21 h-m-p 0.0020 0.0552 1.8144 +++ 867.732191 m 0.0552 369 | 8/9
22 h-m-p 0.1288 0.6439 0.2153 ++ 867.731953 m 0.6439 381 | 9/9
23 h-m-p 0.0160 8.0000 0.0000 Y 867.731953 0 0.0160 394
Out..
lnL = -867.731953
395 lfun, 1185 eigenQcodon, 4740 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.067611 0.052169 0.101271 0.093955 0.093565 0.083005 0.000100 0.892983 0.216331 0.398692 2.051247
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.967684
np = 11
lnL0 = -963.853370
Iterating by ming2
Initial: fx= 963.853370
x= 0.06761 0.05217 0.10127 0.09395 0.09357 0.08301 0.00011 0.89298 0.21633 0.39869 2.05125
1 h-m-p 0.0000 0.0000 439.9216 ++ 963.466463 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 306.8211 ++++ 902.292382 m 0.0009 32 | 2/11
3 h-m-p 0.0000 0.0000 2584.1936 ++ 887.881070 m 0.0000 46 | 3/11
4 h-m-p 0.0002 0.0010 118.8055 ++ 878.787109 m 0.0010 60 | 4/11
5 h-m-p 0.0025 0.0613 17.0514 ------------.. | 4/11
6 h-m-p 0.0000 0.0000 403.0380 ++ 874.774890 m 0.0000 98 | 5/11
7 h-m-p 0.0009 0.2956 9.1806 -----------.. | 5/11
8 h-m-p 0.0000 0.0000 355.9837 ++ 869.190476 m 0.0000 135 | 6/11
9 h-m-p 0.0160 8.0000 5.6564 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 299.1997 ++ 869.050990 m 0.0000 174 | 7/11
11 h-m-p 0.0024 1.2050 3.6686 ------------.. | 7/11
12 h-m-p 0.0000 0.0000 211.4459 ++ 867.732452 m 0.0000 212 | 8/11
13 h-m-p 0.0583 8.0000 0.0000 ++++ 867.732452 m 8.0000 228 | 8/11
14 h-m-p 0.0160 8.0000 0.0283 +++++ 867.732449 m 8.0000 248 | 8/11
15 h-m-p 0.0729 8.0000 3.1082 -----------Y 867.732449 0 0.0000 276 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 -N 867.732449 0 0.0010 291 | 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 867.732449 m 8.0000 311 | 7/11
18 h-m-p 0.0160 8.0000 0.0319 +++++ 867.732447 m 8.0000 332 | 7/11
19 h-m-p 0.2940 8.0000 0.8693 +++ 867.732431 m 8.0000 351 | 7/11
20 h-m-p 1.6000 8.0000 0.6815 ++ 867.732428 m 8.0000 369 | 7/11
21 h-m-p 0.2760 1.3799 7.4211 Y 867.732427 0 0.6238 387 | 7/11
22 h-m-p 1.6000 8.0000 0.3199 -------C 867.732427 0 0.0000 408 | 7/11
23 h-m-p 0.5990 8.0000 0.0000 ++ 867.732427 m 8.0000 426 | 7/11
24 h-m-p 0.0160 8.0000 0.0278 ----Y 867.732427 0 0.0000 448 | 7/11
25 h-m-p 0.0160 8.0000 0.0000 Y 867.732427 0 0.0040 466 | 7/11
26 h-m-p 0.0160 8.0000 0.0000 ----Y 867.732427 0 0.0000 488
Out..
lnL = -867.732427
489 lfun, 1956 eigenQcodon, 8802 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -867.739587 S = -867.729621 -0.003812
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:04
did 20 / 57 patterns 0:04
did 30 / 57 patterns 0:04
did 40 / 57 patterns 0:04
did 50 / 57 patterns 0:04
did 57 / 57 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070257 0.099127 0.036072 0.083956 0.097913 0.040001 16.767674 0.821161 1.950365
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.892041
np = 9
lnL0 = -955.462634
Iterating by ming2
Initial: fx= 955.462634
x= 0.07026 0.09913 0.03607 0.08396 0.09791 0.04000 16.76767 0.82116 1.95037
1 h-m-p 0.0000 0.0002 485.5358 +++ 912.592005 m 0.0002 15 | 1/9
2 h-m-p 0.0043 0.0481 18.2881 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 458.2265 ++ 908.564490 m 0.0000 49 | 2/9
4 h-m-p 0.0007 0.0871 10.4858 -----------.. | 2/9
5 h-m-p 0.0000 0.0001 409.2055 ++ 883.163395 m 0.0001 82 | 3/9
6 h-m-p 0.0089 0.1676 5.9614 -------------.. | 3/9
7 h-m-p 0.0000 0.0001 362.9761 ++ 874.212980 m 0.0001 117 | 4/9
8 h-m-p 0.0073 0.9910 2.7194 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 298.9392 ++ 868.006206 m 0.0001 152 | 5/9
10 h-m-p 0.0047 1.3664 3.1001 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 213.5242 ++ 867.732462 m 0.0000 186 | 6/9
12 h-m-p 0.0803 8.0000 0.0000 +C 867.732462 0 0.3212 199 | 6/9
13 h-m-p 1.0497 8.0000 0.0000 N 867.732462 0 0.2624 214
Out..
lnL = -867.732462
215 lfun, 2365 eigenQcodon, 12900 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.088350 0.057660 0.036515 0.068618 0.082900 0.108713 16.767673 0.900000 1.081967 1.611945 2.408396
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.362265
np = 11
lnL0 = -953.979436
Iterating by ming2
Initial: fx= 953.979436
x= 0.08835 0.05766 0.03651 0.06862 0.08290 0.10871 16.76767 0.90000 1.08197 1.61194 2.40840
1 h-m-p 0.0000 0.0002 444.6807 +++ 913.609811 m 0.0002 17 | 1/11
2 h-m-p 0.0000 0.0002 466.2797 ++ 892.113373 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0000 2700.2626 ++ 883.016438 m 0.0000 45 | 3/11
4 h-m-p 0.0004 0.0022 97.5519 ++ 873.985353 m 0.0022 59 | 4/11
5 h-m-p 0.0000 0.0001 2018.7004 ++ 871.922736 m 0.0001 73 | 5/11
6 h-m-p 0.0011 0.0055 84.1377 -----------.. | 5/11
7 h-m-p 0.0000 0.0001 208.0006 ++ 867.732401 m 0.0001 110 | 6/11
8 h-m-p 0.0483 8.0000 0.0000 ++++ 867.732401 m 8.0000 126 | 6/11
9 h-m-p 0.0160 8.0000 0.0532 +++++ 867.732389 m 8.0000 148 | 6/11
10 h-m-p 0.0377 0.1884 0.5216 ++ 867.732387 m 0.1884 167 | 7/11
11 h-m-p 0.0701 8.0000 0.7611 ++++ 867.732371 m 8.0000 188 | 7/11
12 h-m-p 1.6000 8.0000 0.9955 ++ 867.732366 m 8.0000 206 | 7/11
13 h-m-p 0.2575 1.2877 5.0032 +
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
+ 867.732364 m 1.2877 224
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.185922e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145917e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
| 7/11
14 h-m-p 0.0000 0.0000 15.3404
h-m-p: 1.17072976e-18 5.85364881e-18 1.53404118e+01 867.732364
..
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.185922e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145917e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
| 7/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
Y 867.732364 0 0.0640 250
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27360) = 1.145840e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27335) = 1.145996e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
| 7/11
16 h-m-p 0.0167 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
Y 867.732364 0 0.0000 280
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
Out..
lnL = -867.732364
281 lfun, 3372 eigenQcodon, 18546 P(t)
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -867.728132 S = -867.727453 -0.000297
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:12
did 20 / 57 patterns 0:12
did 30 / 57 patterns 0:12
did 40 / 57 patterns 0:12
did 50 / 57 patterns 0:13
did 57 / 57 patterns 0:13
QuantileBeta(0.15, 0.00500, 2.27348) = 1.145918e-160 2000 rounds
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=216
NC_011896_1_WP_010907713_1_418_MLBR_RS01995 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
NC_002677_1_NP_301389_1_261_ML0407 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG
**************************************************
NC_011896_1_WP_010907713_1_418_MLBR_RS01995 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NC_002677_1_NP_301389_1_261_ML0407 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245 GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT
**************************************************
NC_011896_1_WP_010907713_1_418_MLBR_RS01995 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
NC_002677_1_NP_301389_1_261_ML0407 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245 NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS
**************************************************
NC_011896_1_WP_010907713_1_418_MLBR_RS01995 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
NC_002677_1_NP_301389_1_261_ML0407 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245 AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT
**************************************************
NC_011896_1_WP_010907713_1_418_MLBR_RS01995 RYSDYCPAQDTENDQW
NC_002677_1_NP_301389_1_261_ML0407 RYSDYCPAQDTENDQW
NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830 RYSDYCPAQDTENDQW
NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620 RYSDYCPAQDTENDQW
NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155 RYSDYCPAQDTENDQW
NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245 RYSDYCPAQDTENDQW
****************
>NC_011896_1_WP_010907713_1_418_MLBR_RS01995 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG >NC_002677_1_NP_301389_1_261_ML0407 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG >NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG >NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG >NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG >NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245 ATGGGAAGTAGACGTCGGATTAACCGACGTCTACTTCCCATGTCGACTTT TCCTGCGTGGCAGGAATTCAGGAGGGATGTCGTGGTGGTGTTCCCCGGAA ACGACTTCGACCGCGATGATTGCGACACCGTGGATCCCTGGGGCGTCGGC GGTGCGGCGCACTGGACTATAGATCCGATTGTTGGCTTTGCGTCGTCGTC GGCGCCCCAGGACCGCGGAACCGACGTAGACAACACCCGCGGTCAGGCTG AGGAGGATGAAAAACAAAAGGAGCCAGAGGTCGCAATTTTCACGGTGACG AACCCCCCACGTACCGTGTCGGTATCGGTGCTGATGGACGGCCGGATCGA CCATGTTGAGCTTTCGAAGAGGGTGACATGGATGAGTGAATCACAGGTCG CCTCCGAGATCCTGGTTCTTGCTGACTTGGCGCGGCAGAAGGCGCAGTCG GCCCAGTACACTTTCATCCTAGACAAACTGAGTCAACTGGCCGATGGAGA TGAGCACCGCGTCGCACTGTTACGTGAATCCGTGGGCAATACCTGGAATT TGCCGTCGCCGGAACAAGCCGCAGAGGCAGAAGCTGAAGTATTCGCAACT CGTTACAGTGACTATTGTCCTGCACAAGATACAGAGAATGATCAATGG
>NC_011896_1_WP_010907713_1_418_MLBR_RS01995 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT RYSDYCPAQDTENDQW >NC_002677_1_NP_301389_1_261_ML0407 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT RYSDYCPAQDTENDQW >NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT RYSDYCPAQDTENDQW >NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT RYSDYCPAQDTENDQW >NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT RYSDYCPAQDTENDQW >NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245 MGSRRRINRRLLPMSTFPAWQEFRRDVVVVFPGNDFDRDDCDTVDPWGVG GAAHWTIDPIVGFASSSAPQDRGTDVDNTRGQAEEDEKQKEPEVAIFTVT NPPRTVSVSVLMDGRIDHVELSKRVTWMSESQVASEILVLADLARQKAQS AQYTFILDKLSQLADGDEHRVALLRESVGNTWNLPSPEQAAEAEAEVFAT RYSDYCPAQDTENDQW
#NEXUS
[ID: 1759650711]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907713_1_418_MLBR_RS01995
NC_002677_1_NP_301389_1_261_ML0407
NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830
NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620
NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155
NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907713_1_418_MLBR_RS01995,
2 NC_002677_1_NP_301389_1_261_ML0407,
3 NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830,
4 NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620,
5 NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155,
6 NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07048755,2:0.06921618,3:0.06837721,4:0.0677646,5:0.0716654,6:0.06824328);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07048755,2:0.06921618,3:0.06837721,4:0.0677646,5:0.0716654,6:0.06824328);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -892.55 -895.62
2 -892.57 -895.97
--------------------------------------
TOTAL -892.56 -895.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0407/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891336 0.087440 0.394933 1.505938 0.861274 1452.94 1476.97 1.000
r(A<->C){all} 0.160798 0.018944 0.000005 0.432358 0.123551 159.38 205.76 1.000
r(A<->G){all} 0.165671 0.020926 0.000171 0.469502 0.122877 116.65 173.61 1.001
r(A<->T){all} 0.171627 0.020165 0.000506 0.461164 0.137174 200.72 228.76 1.000
r(C<->G){all} 0.173495 0.022942 0.000078 0.494333 0.126775 154.04 155.76 1.004
r(C<->T){all} 0.173837 0.021256 0.000056 0.462386 0.136530 193.93 287.90 1.005
r(G<->T){all} 0.154572 0.017951 0.000182 0.430417 0.115562 88.06 115.36 1.004
pi(A){all} 0.230668 0.000267 0.198668 0.262116 0.230696 1277.21 1341.54 1.000
pi(C){all} 0.256357 0.000291 0.224832 0.290736 0.256066 956.38 1141.34 1.000
pi(G){all} 0.308229 0.000332 0.273518 0.343848 0.307769 1116.00 1214.94 1.000
pi(T){all} 0.204746 0.000245 0.176282 0.236711 0.204331 1255.90 1336.64 1.001
alpha{1,2} 0.418142 0.247079 0.000147 1.422119 0.239029 1171.20 1187.93 1.000
alpha{3} 0.460363 0.258399 0.000146 1.482566 0.288343 1077.52 1201.97 1.001
pinvar{all} 0.997559 0.000008 0.992018 0.999999 0.998521 978.83 1135.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0407/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 216
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 6 6 6 6 6 6 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 9 9 9 9 9 9 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5
CTC 0 0 0 0 0 0 | CCC 5 5 5 5 5 5 | CAC 2 2 2 2 2 2 | CGC 4 4 4 4 4 4
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 5 5 5 5 5 5 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 3 3 3 3 3 3 | CAG 7 7 7 7 7 7 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 3 3 3 3 3 3 | Ser AGT 4 4 4 4 4 4
ATC 3 3 3 3 3 3 | ACC 5 5 5 5 5 5 | AAC 4 4 4 4 4 4 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 10 10 10 10 10 10 | Gly GGT 2 2 2 2 2 2
GTC 5 5 5 5 5 5 | GCC 4 4 4 4 4 4 | GAC 11 11 11 11 11 11 | GGC 5 5 5 5 5 5
GTA 3 3 3 3 3 3 | GCA 6 6 6 6 6 6 | Glu GAA 7 7 7 7 7 7 | GGA 4 4 4 4 4 4
GTG 9 9 9 9 9 9 | GCG 7 7 7 7 7 7 | GAG 9 9 9 9 9 9 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907713_1_418_MLBR_RS01995
position 1: T:0.15741 C:0.23148 A:0.20370 G:0.40741
position 2: T:0.24074 C:0.26389 A:0.31019 G:0.18519
position 3: T:0.21759 C:0.27315 A:0.17593 G:0.33333
Average T:0.20525 C:0.25617 A:0.22994 G:0.30864
#2: NC_002677_1_NP_301389_1_261_ML0407
position 1: T:0.15741 C:0.23148 A:0.20370 G:0.40741
position 2: T:0.24074 C:0.26389 A:0.31019 G:0.18519
position 3: T:0.21759 C:0.27315 A:0.17593 G:0.33333
Average T:0.20525 C:0.25617 A:0.22994 G:0.30864
#3: NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830
position 1: T:0.15741 C:0.23148 A:0.20370 G:0.40741
position 2: T:0.24074 C:0.26389 A:0.31019 G:0.18519
position 3: T:0.21759 C:0.27315 A:0.17593 G:0.33333
Average T:0.20525 C:0.25617 A:0.22994 G:0.30864
#4: NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620
position 1: T:0.15741 C:0.23148 A:0.20370 G:0.40741
position 2: T:0.24074 C:0.26389 A:0.31019 G:0.18519
position 3: T:0.21759 C:0.27315 A:0.17593 G:0.33333
Average T:0.20525 C:0.25617 A:0.22994 G:0.30864
#5: NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155
position 1: T:0.15741 C:0.23148 A:0.20370 G:0.40741
position 2: T:0.24074 C:0.26389 A:0.31019 G:0.18519
position 3: T:0.21759 C:0.27315 A:0.17593 G:0.33333
Average T:0.20525 C:0.25617 A:0.22994 G:0.30864
#6: NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245
position 1: T:0.15741 C:0.23148 A:0.20370 G:0.40741
position 2: T:0.24074 C:0.26389 A:0.31019 G:0.18519
position 3: T:0.21759 C:0.27315 A:0.17593 G:0.33333
Average T:0.20525 C:0.25617 A:0.22994 G:0.30864
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 36 | TCC 12 | TAC 12 | TGC 6
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 54 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 30
CTC 0 | CCC 30 | CAC 12 | CGC 24
CTA 12 | CCA 12 | Gln Q CAA 30 | CGA 6
CTG 30 | CCG 18 | CAG 42 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 24 | Asn N AAT 18 | Ser S AGT 24
ATC 18 | ACC 30 | AAC 24 | AGC 0
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 24 | ACG 12 | AAG 18 | AGG 18
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 60 | Gly G GGT 12
GTC 30 | GCC 24 | GAC 66 | GGC 30
GTA 18 | GCA 36 | Glu E GAA 42 | GGA 24
GTG 54 | GCG 42 | GAG 54 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15741 C:0.23148 A:0.20370 G:0.40741
position 2: T:0.24074 C:0.26389 A:0.31019 G:0.18519
position 3: T:0.21759 C:0.27315 A:0.17593 G:0.33333
Average T:0.20525 C:0.25617 A:0.22994 G:0.30864
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -867.731953 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907713_1_418_MLBR_RS01995: 0.000004, NC_002677_1_NP_301389_1_261_ML0407: 0.000004, NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830: 0.000004, NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620: 0.000004, NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155: 0.000004, NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 514.4 133.6 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 514.4 133.6 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 514.4 133.6 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 514.4 133.6 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 514.4 133.6 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 514.4 133.6 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -867.731953 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907713_1_418_MLBR_RS01995: 0.000004, NC_002677_1_NP_301389_1_261_ML0407: 0.000004, NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830: 0.000004, NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620: 0.000004, NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155: 0.000004, NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 514.4 133.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 514.4 133.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 514.4 133.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 514.4 133.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 514.4 133.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 514.4 133.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -867.732427 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.767674 0.397995 0.014404 0.000001 1.231503
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907713_1_418_MLBR_RS01995: 0.000004, NC_002677_1_NP_301389_1_261_ML0407: 0.000004, NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830: 0.000004, NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620: 0.000004, NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155: 0.000004, NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.76767
MLEs of dN/dS (w) for site classes (K=3)
p: 0.39799 0.01440 0.58760
w: 0.00000 1.00000 1.23150
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.3 214.7 0.7380 0.0000 0.0000 0.0 0.0
7..2 0.000 433.3 214.7 0.7380 0.0000 0.0000 0.0 0.0
7..3 0.000 433.3 214.7 0.7380 0.0000 0.0000 0.0 0.0
7..4 0.000 433.3 214.7 0.7380 0.0000 0.0000 0.0 0.0
7..5 0.000 433.3 214.7 0.7380 0.0000 0.0000 0.0 0.0
7..6 0.000 433.3 214.7 0.7380 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907713_1_418_MLBR_RS01995)
Pr(w>1) post mean +- SE for w
1 M 0.588 0.738
2 G 0.588 0.738
3 S 0.588 0.738
4 R 0.588 0.738
5 R 0.588 0.738
6 R 0.588 0.738
7 I 0.588 0.738
8 N 0.588 0.738
9 R 0.588 0.738
10 R 0.588 0.738
11 L 0.588 0.738
12 L 0.588 0.738
13 P 0.588 0.738
14 M 0.588 0.738
15 S 0.588 0.738
16 T 0.588 0.738
17 F 0.588 0.738
18 P 0.588 0.738
19 A 0.588 0.738
20 W 0.588 0.738
21 Q 0.588 0.738
22 E 0.588 0.738
23 F 0.588 0.738
24 R 0.588 0.738
25 R 0.588 0.738
26 D 0.588 0.738
27 V 0.588 0.738
28 V 0.588 0.738
29 V 0.588 0.738
30 V 0.588 0.738
31 F 0.588 0.738
32 P 0.588 0.738
33 G 0.588 0.738
34 N 0.588 0.738
35 D 0.588 0.738
36 F 0.588 0.738
37 D 0.588 0.738
38 R 0.588 0.738
39 D 0.588 0.738
40 D 0.588 0.738
41 C 0.588 0.738
42 D 0.588 0.738
43 T 0.588 0.738
44 V 0.588 0.738
45 D 0.588 0.738
46 P 0.588 0.738
47 W 0.588 0.738
48 G 0.588 0.738
49 V 0.588 0.738
50 G 0.588 0.738
51 G 0.588 0.738
52 A 0.588 0.738
53 A 0.588 0.738
54 H 0.588 0.738
55 W 0.588 0.738
56 T 0.588 0.738
57 I 0.588 0.738
58 D 0.588 0.738
59 P 0.588 0.738
60 I 0.588 0.738
61 V 0.588 0.738
62 G 0.588 0.738
63 F 0.588 0.738
64 A 0.588 0.738
65 S 0.588 0.738
66 S 0.588 0.738
67 S 0.588 0.738
68 A 0.588 0.738
69 P 0.588 0.738
70 Q 0.588 0.738
71 D 0.588 0.738
72 R 0.588 0.738
73 G 0.588 0.738
74 T 0.588 0.738
75 D 0.588 0.738
76 V 0.588 0.738
77 D 0.588 0.738
78 N 0.588 0.738
79 T 0.588 0.738
80 R 0.588 0.738
81 G 0.588 0.738
82 Q 0.588 0.738
83 A 0.588 0.738
84 E 0.588 0.738
85 E 0.588 0.738
86 D 0.588 0.738
87 E 0.588 0.738
88 K 0.588 0.738
89 Q 0.588 0.738
90 K 0.588 0.738
91 E 0.588 0.738
92 P 0.588 0.738
93 E 0.588 0.738
94 V 0.588 0.738
95 A 0.588 0.738
96 I 0.588 0.738
97 F 0.588 0.738
98 T 0.588 0.738
99 V 0.588 0.738
100 T 0.588 0.738
101 N 0.588 0.738
102 P 0.588 0.738
103 P 0.588 0.738
104 R 0.588 0.738
105 T 0.588 0.738
106 V 0.588 0.738
107 S 0.588 0.738
108 V 0.588 0.738
109 S 0.588 0.738
110 V 0.588 0.738
111 L 0.588 0.738
112 M 0.588 0.738
113 D 0.588 0.738
114 G 0.588 0.738
115 R 0.588 0.738
116 I 0.588 0.738
117 D 0.588 0.738
118 H 0.588 0.738
119 V 0.588 0.738
120 E 0.588 0.738
121 L 0.588 0.738
122 S 0.588 0.738
123 K 0.588 0.738
124 R 0.588 0.738
125 V 0.588 0.738
126 T 0.588 0.738
127 W 0.588 0.738
128 M 0.588 0.738
129 S 0.588 0.738
130 E 0.588 0.738
131 S 0.588 0.738
132 Q 0.588 0.738
133 V 0.588 0.738
134 A 0.588 0.738
135 S 0.588 0.738
136 E 0.588 0.738
137 I 0.588 0.738
138 L 0.588 0.738
139 V 0.588 0.738
140 L 0.588 0.738
141 A 0.588 0.738
142 D 0.588 0.738
143 L 0.588 0.738
144 A 0.588 0.738
145 R 0.588 0.738
146 Q 0.588 0.738
147 K 0.588 0.738
148 A 0.588 0.738
149 Q 0.588 0.738
150 S 0.588 0.738
151 A 0.588 0.738
152 Q 0.588 0.738
153 Y 0.588 0.738
154 T 0.588 0.738
155 F 0.588 0.738
156 I 0.588 0.738
157 L 0.588 0.738
158 D 0.588 0.738
159 K 0.588 0.738
160 L 0.588 0.738
161 S 0.588 0.738
162 Q 0.588 0.738
163 L 0.588 0.738
164 A 0.588 0.738
165 D 0.588 0.738
166 G 0.588 0.738
167 D 0.588 0.738
168 E 0.588 0.738
169 H 0.588 0.738
170 R 0.588 0.738
171 V 0.588 0.738
172 A 0.588 0.738
173 L 0.588 0.738
174 L 0.588 0.738
175 R 0.588 0.738
176 E 0.588 0.738
177 S 0.588 0.738
178 V 0.588 0.738
179 G 0.588 0.738
180 N 0.588 0.738
181 T 0.588 0.738
182 W 0.588 0.738
183 N 0.588 0.738
184 L 0.588 0.738
185 P 0.588 0.738
186 S 0.588 0.738
187 P 0.588 0.738
188 E 0.588 0.738
189 Q 0.588 0.738
190 A 0.588 0.738
191 A 0.588 0.738
192 E 0.588 0.738
193 A 0.588 0.738
194 E 0.588 0.738
195 A 0.588 0.738
196 E 0.588 0.738
197 V 0.588 0.738
198 F 0.588 0.738
199 A 0.588 0.738
200 T 0.588 0.738
201 R 0.588 0.738
202 Y 0.588 0.738
203 S 0.588 0.738
204 D 0.588 0.738
205 Y 0.588 0.738
206 C 0.588 0.738
207 P 0.588 0.738
208 A 0.588 0.738
209 Q 0.588 0.738
210 D 0.588 0.738
211 T 0.588 0.738
212 E 0.588 0.738
213 N 0.588 0.738
214 D 0.588 0.738
215 Q 0.588 0.738
216 W 0.588 0.738
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907713_1_418_MLBR_RS01995)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -867.732462 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.767673 0.821014 1.950276
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907713_1_418_MLBR_RS01995: 0.000004, NC_002677_1_NP_301389_1_261_ML0407: 0.000004, NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830: 0.000004, NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620: 0.000004, NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155: 0.000004, NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.76767
Parameters in M7 (beta):
p = 0.82101 q = 1.95028
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.01296 0.05039 0.09623 0.14929 0.20987 0.27912 0.35932 0.45484 0.57544 0.75469
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.3 214.7 0.2942 0.0000 0.0000 0.0 0.0
7..2 0.000 433.3 214.7 0.2942 0.0000 0.0000 0.0 0.0
7..3 0.000 433.3 214.7 0.2942 0.0000 0.0000 0.0 0.0
7..4 0.000 433.3 214.7 0.2942 0.0000 0.0000 0.0 0.0
7..5 0.000 433.3 214.7 0.2942 0.0000 0.0000 0.0 0.0
7..6 0.000 433.3 214.7 0.2942 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -867.732364 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 18.286977 0.000010 0.005000 2.273476 23.191121
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907713_1_418_MLBR_RS01995: 0.000004, NC_002677_1_NP_301389_1_261_ML0407: 0.000004, NZ_LVXE01000036_1_WP_010907713_1_1602_A3216_RS09830: 0.000004, NZ_LYPH01000040_1_WP_010907713_1_1593_A8144_RS07620: 0.000004, NZ_CP029543_1_WP_010907713_1_421_DIJ64_RS02155: 0.000004, NZ_AP014567_1_WP_010907713_1_439_JK2ML_RS02245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 18.28698
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.27348
(p1 = 0.99999) w = 23.19112
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 23.19112
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 432.5 215.5 23.1909 0.0000 0.0000 0.0 0.0
7..2 0.000 432.5 215.5 23.1909 0.0000 0.0000 0.0 0.0
7..3 0.000 432.5 215.5 23.1909 0.0000 0.0000 0.0 0.0
7..4 0.000 432.5 215.5 23.1909 0.0000 0.0000 0.0 0.0
7..5 0.000 432.5 215.5 23.1909 0.0000 0.0000 0.0 0.0
7..6 0.000 432.5 215.5 23.1909 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907713_1_418_MLBR_RS01995)
Pr(w>1) post mean +- SE for w
1 M 1.000** 23.191
2 G 1.000** 23.191
3 S 1.000** 23.191
4 R 1.000** 23.191
5 R 1.000** 23.191
6 R 1.000** 23.191
7 I 1.000** 23.191
8 N 1.000** 23.191
9 R 1.000** 23.191
10 R 1.000** 23.191
11 L 1.000** 23.191
12 L 1.000** 23.191
13 P 1.000** 23.191
14 M 1.000** 23.191
15 S 1.000** 23.191
16 T 1.000** 23.191
17 F 1.000** 23.191
18 P 1.000** 23.191
19 A 1.000** 23.191
20 W 1.000** 23.191
21 Q 1.000** 23.191
22 E 1.000** 23.191
23 F 1.000** 23.191
24 R 1.000** 23.191
25 R 1.000** 23.191
26 D 1.000** 23.191
27 V 1.000** 23.191
28 V 1.000** 23.191
29 V 1.000** 23.191
30 V 1.000** 23.191
31 F 1.000** 23.191
32 P 1.000** 23.191
33 G 1.000** 23.191
34 N 1.000** 23.191
35 D 1.000** 23.191
36 F 1.000** 23.191
37 D 1.000** 23.191
38 R 1.000** 23.191
39 D 1.000** 23.191
40 D 1.000** 23.191
41 C 1.000** 23.191
42 D 1.000** 23.191
43 T 1.000** 23.191
44 V 1.000** 23.191
45 D 1.000** 23.191
46 P 1.000** 23.191
47 W 1.000** 23.191
48 G 1.000** 23.191
49 V 1.000** 23.191
50 G 1.000** 23.191
51 G 1.000** 23.191
52 A 1.000** 23.191
53 A 1.000** 23.191
54 H 1.000** 23.191
55 W 1.000** 23.191
56 T 1.000** 23.191
57 I 1.000** 23.191
58 D 1.000** 23.191
59 P 1.000** 23.191
60 I 1.000** 23.191
61 V 1.000** 23.191
62 G 1.000** 23.191
63 F 1.000** 23.191
64 A 1.000** 23.191
65 S 1.000** 23.191
66 S 1.000** 23.191
67 S 1.000** 23.191
68 A 1.000** 23.191
69 P 1.000** 23.191
70 Q 1.000** 23.191
71 D 1.000** 23.191
72 R 1.000** 23.191
73 G 1.000** 23.191
74 T 1.000** 23.191
75 D 1.000** 23.191
76 V 1.000** 23.191
77 D 1.000** 23.191
78 N 1.000** 23.191
79 T 1.000** 23.191
80 R 1.000** 23.191
81 G 1.000** 23.191
82 Q 1.000** 23.191
83 A 1.000** 23.191
84 E 1.000** 23.191
85 E 1.000** 23.191
86 D 1.000** 23.191
87 E 1.000** 23.191
88 K 1.000** 23.191
89 Q 1.000** 23.191
90 K 1.000** 23.191
91 E 1.000** 23.191
92 P 1.000** 23.191
93 E 1.000** 23.191
94 V 1.000** 23.191
95 A 1.000** 23.191
96 I 1.000** 23.191
97 F 1.000** 23.191
98 T 1.000** 23.191
99 V 1.000** 23.191
100 T 1.000** 23.191
101 N 1.000** 23.191
102 P 1.000** 23.191
103 P 1.000** 23.191
104 R 1.000** 23.191
105 T 1.000** 23.191
106 V 1.000** 23.191
107 S 1.000** 23.191
108 V 1.000** 23.191
109 S 1.000** 23.191
110 V 1.000** 23.191
111 L 1.000** 23.191
112 M 1.000** 23.191
113 D 1.000** 23.191
114 G 1.000** 23.191
115 R 1.000** 23.191
116 I 1.000** 23.191
117 D 1.000** 23.191
118 H 1.000** 23.191
119 V 1.000** 23.191
120 E 1.000** 23.191
121 L 1.000** 23.191
122 S 1.000** 23.191
123 K 1.000** 23.191
124 R 1.000** 23.191
125 V 1.000** 23.191
126 T 1.000** 23.191
127 W 1.000** 23.191
128 M 1.000** 23.191
129 S 1.000** 23.191
130 E 1.000** 23.191
131 S 1.000** 23.191
132 Q 1.000** 23.191
133 V 1.000** 23.191
134 A 1.000** 23.191
135 S 1.000** 23.191
136 E 1.000** 23.191
137 I 1.000** 23.191
138 L 1.000** 23.191
139 V 1.000** 23.191
140 L 1.000** 23.191
141 A 1.000** 23.191
142 D 1.000** 23.191
143 L 1.000** 23.191
144 A 1.000** 23.191
145 R 1.000** 23.191
146 Q 1.000** 23.191
147 K 1.000** 23.191
148 A 1.000** 23.191
149 Q 1.000** 23.191
150 S 1.000** 23.191
151 A 1.000** 23.191
152 Q 1.000** 23.191
153 Y 1.000** 23.191
154 T 1.000** 23.191
155 F 1.000** 23.191
156 I 1.000** 23.191
157 L 1.000** 23.191
158 D 1.000** 23.191
159 K 1.000** 23.191
160 L 1.000** 23.191
161 S 1.000** 23.191
162 Q 1.000** 23.191
163 L 1.000** 23.191
164 A 1.000** 23.191
165 D 1.000** 23.191
166 G 1.000** 23.191
167 D 1.000** 23.191
168 E 1.000** 23.191
169 H 1.000** 23.191
170 R 1.000** 23.191
171 V 1.000** 23.191
172 A 1.000** 23.191
173 L 1.000** 23.191
174 L 1.000** 23.191
175 R 1.000** 23.191
176 E 1.000** 23.191
177 S 1.000** 23.191
178 V 1.000** 23.191
179 G 1.000** 23.191
180 N 1.000** 23.191
181 T 1.000** 23.191
182 W 1.000** 23.191
183 N 1.000** 23.191
184 L 1.000** 23.191
185 P 1.000** 23.191
186 S 1.000** 23.191
187 P 1.000** 23.191
188 E 1.000** 23.191
189 Q 1.000** 23.191
190 A 1.000** 23.191
191 A 1.000** 23.191
192 E 1.000** 23.191
193 A 1.000** 23.191
194 E 1.000** 23.191
195 A 1.000** 23.191
196 E 1.000** 23.191
197 V 1.000** 23.191
198 F 1.000** 23.191
199 A 1.000** 23.191
200 T 1.000** 23.191
201 R 1.000** 23.191
202 Y 1.000** 23.191
203 S 1.000** 23.191
204 D 1.000** 23.191
205 Y 1.000** 23.191
206 C 1.000** 23.191
207 P 1.000** 23.191
208 A 1.000** 23.191
209 Q 1.000** 23.191
210 D 1.000** 23.191
211 T 1.000** 23.191
212 E 1.000** 23.191
213 N 1.000** 23.191
214 D 1.000** 23.191
215 Q 1.000** 23.191
216 W 1.000** 23.191
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907713_1_418_MLBR_RS01995)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -867.731953 Model 2: PositiveSelection -867.732427 Model 0: one-ratio -867.731953 Model 7: beta -867.732462 Model 8: beta&w>1 -867.732364 Model 0 vs 1 0.0 Model 2 vs 1 9.480000001076405E-4 Model 8 vs 7 1.960000001872686E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
