--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:30:01 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0410/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -427.07 -432.88
2 -427.11 -430.64
--------------------------------------
TOTAL -427.09 -432.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.857618 0.086071 0.345309 1.450751 0.825310 1478.95 1489.98 1.003
r(A<->C){all} 0.131906 0.014708 0.000033 0.378651 0.095153 194.40 213.37 1.000
r(A<->G){all} 0.158995 0.019132 0.000029 0.441055 0.121193 135.69 145.02 1.011
r(A<->T){all} 0.179164 0.024235 0.000048 0.499330 0.134549 139.40 195.47 1.002
r(C<->G){all} 0.123027 0.013727 0.000004 0.368758 0.085249 118.79 215.82 1.003
r(C<->T){all} 0.227077 0.024126 0.000212 0.524120 0.205034 161.81 167.99 1.000
r(G<->T){all} 0.179830 0.021444 0.000063 0.462343 0.141717 145.69 278.44 1.006
pi(A){all} 0.244666 0.000600 0.200105 0.294233 0.244560 1084.23 1225.57 1.000
pi(C){all} 0.219234 0.000566 0.173483 0.264406 0.218744 1212.54 1215.52 1.000
pi(G){all} 0.287859 0.000669 0.237618 0.340223 0.286969 1165.14 1248.60 1.000
pi(T){all} 0.248241 0.000627 0.202559 0.298092 0.247843 1165.19 1273.85 1.000
alpha{1,2} 0.275860 0.086622 0.001379 0.807832 0.186442 1081.92 1194.22 1.000
alpha{3} 0.387095 0.206534 0.000262 1.315246 0.228126 1431.37 1464.78 1.000
pinvar{all} 0.987066 0.000111 0.966077 0.999685 0.989904 1306.55 1327.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -408.479512
Model 2: PositiveSelection -408.049906
Model 0: one-ratio -408.049755
Model 7: beta -408.479512
Model 8: beta&w>1 -408.049906
Model 0 vs 1 0.8595139999999901
Model 2 vs 1 0.8592119999999568
Model 8 vs 7 0.8592119999999568
>C1
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C2
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LVSQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C3
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C4
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C5
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C6
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100
C1 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C2 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C3 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C4 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C5 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C6 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
**************************************************
C1 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C2 LVSQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C3 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C4 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C5 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C6 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
*.************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3000]--->[3000]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.624 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C2 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C3 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C4 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C5 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
C6 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
**************************************************
C1 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C2 LVSQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C3 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C4 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C5 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
C6 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
*.************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.00 C1 C2 99.00
TOP 1 0 99.00 C2 C1 99.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.00 C2 C3 99.00
TOP 2 1 99.00 C3 C2 99.00
BOT 1 3 99.00 C2 C4 99.00
TOP 3 1 99.00 C4 C2 99.00
BOT 1 4 99.00 C2 C5 99.00
TOP 4 1 99.00 C5 C2 99.00
BOT 1 5 99.00 C2 C6 99.00
TOP 5 1 99.00 C6 C2 99.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.80
AVG 1 C2 * 99.00
AVG 2 C3 * 99.80
AVG 3 C4 * 99.80
AVG 4 C5 * 99.80
AVG 5 C6 * 99.80
TOT TOT * 99.67
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
C2 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
C3 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
C4 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
C5 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
C6 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
**************************************************
C1 CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
C2 CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
C3 CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
C4 CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
C5 CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
C6 CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
**************************************************
C1 CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
C2 CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
C3 CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
C4 CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
C5 CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
C6 CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
**************************************************
C1 CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
C2 CTAGTATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
C3 CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
C4 CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
C5 CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
C6 CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
**** *********************************************
C1 CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
C2 CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
C3 CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
C4 CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
C5 CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
C6 CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
**************************************************
C1 CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
C2 CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
C3 CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
C4 CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
C5 CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
C6 CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
**************************************************
>C1
ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
>C2
ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
CTAGTATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
>C3
ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
>C4
ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
>C5
ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
>C6
ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG
CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA
CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG
CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC
CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG
CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
>C1
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C2
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LVSQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C3
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C4
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C5
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
>C6
MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 300 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800507
Setting output file names to "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 219722837
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1309755838
Seed = 1233936203
Swapseed = 1579800507
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -674.817205 -- -24.965149
Chain 2 -- -674.817243 -- -24.965149
Chain 3 -- -674.815694 -- -24.965149
Chain 4 -- -674.817205 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -674.817243 -- -24.965149
Chain 2 -- -674.817243 -- -24.965149
Chain 3 -- -674.817243 -- -24.965149
Chain 4 -- -674.817075 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-674.817] (-674.817) (-674.816) (-674.817) * [-674.817] (-674.817) (-674.817) (-674.817)
500 -- [-427.495] (-432.784) (-432.257) (-435.582) * [-429.515] (-429.092) (-436.663) (-432.278) -- 0:00:00
1000 -- (-431.455) (-433.814) [-432.143] (-433.757) * (-432.503) [-431.855] (-427.050) (-434.712) -- 0:00:00
1500 -- (-433.268) [-434.397] (-431.920) (-428.586) * (-433.908) (-432.308) [-431.995] (-428.474) -- 0:00:00
2000 -- (-429.909) (-431.989) [-435.473] (-434.710) * (-441.535) [-441.284] (-429.897) (-437.672) -- 0:00:00
2500 -- (-428.739) (-433.302) [-435.341] (-433.195) * (-435.278) (-445.420) [-428.957] (-431.507) -- 0:00:00
3000 -- (-438.426) (-430.796) [-428.020] (-438.958) * (-433.207) [-434.270] (-434.649) (-439.619) -- 0:00:00
3500 -- (-436.174) (-438.309) (-439.954) [-428.664] * [-433.899] (-433.780) (-434.240) (-429.631) -- 0:00:00
4000 -- (-429.566) [-431.480] (-429.856) (-432.518) * [-428.205] (-432.267) (-445.562) (-433.750) -- 0:00:00
4500 -- (-427.416) (-431.703) [-431.609] (-445.689) * (-434.539) (-435.125) (-439.633) [-431.553] -- 0:00:00
5000 -- (-433.884) [-438.991] (-439.405) (-432.600) * [-432.840] (-435.294) (-426.939) (-431.119) -- 0:00:00
Average standard deviation of split frequencies: 0.064282
5500 -- (-432.007) (-436.623) [-436.639] (-436.145) * [-427.920] (-438.708) (-426.783) (-431.267) -- 0:00:00
6000 -- [-433.222] (-440.408) (-435.725) (-429.071) * (-433.277) (-429.692) [-431.783] (-433.462) -- 0:00:00
6500 -- [-429.957] (-437.460) (-427.781) (-431.796) * (-436.753) (-436.539) (-431.534) [-430.848] -- 0:00:00
7000 -- [-432.147] (-443.193) (-442.323) (-435.309) * (-431.906) [-439.012] (-428.836) (-441.670) -- 0:00:00
7500 -- (-434.679) [-432.618] (-443.617) (-436.048) * (-431.547) (-438.976) (-430.157) [-431.065] -- 0:00:00
8000 -- [-432.310] (-437.924) (-442.651) (-443.385) * (-434.186) (-428.908) (-429.226) [-437.282] -- 0:00:00
8500 -- (-434.003) [-429.618] (-436.791) (-429.228) * (-432.496) [-431.958] (-429.570) (-431.827) -- 0:00:00
9000 -- [-431.682] (-434.595) (-428.690) (-433.138) * (-433.875) (-430.972) (-428.204) [-428.536] -- 0:01:50
9500 -- (-441.717) (-433.606) [-430.283] (-435.272) * [-430.426] (-436.984) (-429.565) (-433.370) -- 0:01:44
10000 -- [-427.574] (-430.825) (-430.234) (-429.617) * (-429.795) [-431.140] (-427.805) (-432.411) -- 0:01:39
Average standard deviation of split frequencies: 0.072920
10500 -- (-441.687) [-430.069] (-426.739) (-430.132) * (-431.255) (-444.125) (-428.569) [-427.827] -- 0:01:34
11000 -- (-435.245) (-435.488) [-429.474] (-437.507) * (-440.522) [-441.556] (-428.174) (-428.958) -- 0:01:29
11500 -- (-432.903) [-435.462] (-429.605) (-434.826) * (-433.654) [-434.391] (-428.847) (-433.902) -- 0:01:25
12000 -- (-439.655) (-436.062) (-427.970) [-435.990] * [-441.174] (-433.380) (-425.877) (-439.010) -- 0:01:22
12500 -- (-432.636) (-438.512) (-429.490) [-442.508] * [-435.171] (-429.618) (-429.295) (-437.900) -- 0:01:19
13000 -- (-439.641) (-425.693) [-427.880] (-436.759) * (-430.330) (-434.516) (-432.889) [-432.163] -- 0:01:15
13500 -- (-435.813) (-429.890) (-428.941) [-428.609] * (-435.988) [-432.558] (-431.871) (-431.918) -- 0:01:13
14000 -- (-430.060) [-428.357] (-426.994) (-432.434) * (-442.507) (-439.846) (-429.474) [-431.300] -- 0:01:10
14500 -- [-439.740] (-428.969) (-426.587) (-435.641) * (-434.137) (-428.200) (-428.308) [-435.328] -- 0:01:07
15000 -- (-431.684) (-433.006) (-431.530) [-433.471] * (-434.982) (-434.898) (-429.586) [-435.003] -- 0:01:05
Average standard deviation of split frequencies: 0.053314
15500 -- (-437.581) (-428.518) (-432.352) [-434.052] * (-450.843) (-427.910) (-427.618) [-437.194] -- 0:01:03
16000 -- (-436.268) (-429.586) [-428.162] (-441.779) * (-445.598) (-445.158) (-431.408) [-427.859] -- 0:01:01
16500 -- (-438.725) (-430.627) (-431.460) [-426.386] * (-445.472) (-429.603) [-425.311] (-438.864) -- 0:00:59
17000 -- (-436.073) (-427.847) [-428.051] (-435.556) * (-439.358) (-428.013) (-428.182) [-436.242] -- 0:00:57
17500 -- [-433.083] (-429.393) (-429.895) (-428.692) * [-425.527] (-432.171) (-426.388) (-435.682) -- 0:00:56
18000 -- (-436.220) (-427.958) (-431.297) [-429.166] * (-428.032) (-435.230) [-426.419] (-429.590) -- 0:00:54
18500 -- [-433.219] (-427.065) (-428.143) (-426.940) * (-430.025) [-431.647] (-430.227) (-436.796) -- 0:00:53
19000 -- [-426.773] (-426.399) (-436.497) (-429.498) * (-430.786) (-433.902) (-427.355) [-430.469] -- 0:00:51
19500 -- (-431.459) (-431.769) (-432.082) [-432.939] * (-430.268) (-430.049) (-428.808) [-432.107] -- 0:00:50
20000 -- (-433.079) [-431.241] (-429.243) (-438.444) * [-426.530] (-438.523) (-426.393) (-431.653) -- 0:00:49
Average standard deviation of split frequencies: 0.049897
20500 -- (-431.825) (-429.231) (-430.867) [-433.169] * (-430.028) [-431.695] (-427.106) (-429.728) -- 0:00:47
21000 -- [-432.519] (-428.455) (-427.952) (-430.100) * (-429.263) (-429.935) (-429.966) [-429.784] -- 0:00:46
21500 -- (-434.862) [-428.954] (-432.041) (-428.231) * (-429.478) [-435.003] (-427.712) (-436.691) -- 0:00:45
22000 -- (-441.373) (-426.301) [-431.779] (-433.723) * (-427.283) (-430.076) (-428.300) [-426.697] -- 0:00:44
22500 -- [-432.043] (-428.031) (-430.593) (-436.389) * (-425.743) [-431.276] (-431.737) (-437.139) -- 0:00:43
23000 -- [-434.544] (-428.124) (-430.401) (-431.500) * [-428.932] (-427.753) (-430.391) (-438.100) -- 0:00:42
23500 -- [-431.305] (-430.826) (-429.337) (-438.557) * [-426.951] (-436.691) (-427.686) (-434.732) -- 0:00:41
24000 -- (-437.447) (-426.006) (-428.906) [-433.296] * (-429.137) (-432.082) [-428.745] (-432.417) -- 0:00:40
24500 -- (-434.837) (-427.477) (-428.064) [-427.534] * (-430.440) [-432.657] (-429.403) (-436.145) -- 0:00:39
25000 -- (-431.550) (-429.817) [-426.368] (-425.015) * (-429.075) (-434.267) (-426.814) [-432.107] -- 0:00:39
Average standard deviation of split frequencies: 0.048047
25500 -- (-433.536) (-429.055) [-428.206] (-429.065) * (-429.922) [-432.428] (-427.755) (-433.558) -- 0:01:16
26000 -- [-434.926] (-429.256) (-427.439) (-431.256) * (-431.970) [-430.789] (-432.768) (-436.876) -- 0:01:14
26500 -- [-432.409] (-429.533) (-428.356) (-427.775) * (-434.029) (-437.975) [-427.808] (-435.778) -- 0:01:13
27000 -- [-433.265] (-429.567) (-426.848) (-427.077) * (-428.848) (-430.686) (-427.524) [-429.873] -- 0:01:12
27500 -- (-437.927) (-430.144) (-428.657) [-430.845] * (-430.873) [-433.589] (-426.561) (-430.664) -- 0:01:10
28000 -- [-431.601] (-430.582) (-428.630) (-430.405) * (-427.828) (-433.883) (-428.723) [-427.144] -- 0:01:09
28500 -- [-429.081] (-428.196) (-430.486) (-428.244) * (-428.777) [-430.925] (-428.567) (-434.769) -- 0:01:08
29000 -- (-434.449) [-428.572] (-427.092) (-432.307) * (-431.612) [-429.990] (-428.401) (-425.981) -- 0:01:06
29500 -- [-433.812] (-429.491) (-428.537) (-426.866) * [-427.917] (-432.835) (-429.686) (-435.966) -- 0:01:05
30000 -- (-432.240) (-428.275) [-427.200] (-426.624) * (-429.038) [-429.509] (-429.437) (-428.719) -- 0:01:04
Average standard deviation of split frequencies: 0.047734
30500 -- [-434.699] (-429.100) (-426.673) (-430.061) * [-428.582] (-438.250) (-428.902) (-430.525) -- 0:01:03
31000 -- (-433.010) (-432.189) [-428.335] (-425.397) * (-430.671) (-436.771) [-427.539] (-431.798) -- 0:01:02
31500 -- (-436.582) [-428.682] (-429.708) (-427.048) * (-429.189) [-425.733] (-427.504) (-433.222) -- 0:01:01
32000 -- (-436.160) (-427.783) [-428.739] (-426.750) * (-429.026) [-427.435] (-429.246) (-437.843) -- 0:01:00
32500 -- (-430.190) [-430.165] (-428.731) (-432.542) * (-427.905) (-436.026) [-433.625] (-430.756) -- 0:00:59
33000 -- [-426.414] (-430.523) (-428.657) (-427.500) * (-429.831) [-430.912] (-428.837) (-438.591) -- 0:00:58
33500 -- (-430.076) [-428.344] (-428.094) (-427.231) * (-430.891) (-438.271) (-428.918) [-438.301] -- 0:00:57
34000 -- (-429.951) (-426.689) [-427.628] (-428.046) * (-430.532) [-427.149] (-428.827) (-438.717) -- 0:00:56
34500 -- [-430.352] (-435.938) (-428.398) (-427.794) * (-429.756) (-433.429) (-431.329) [-431.950] -- 0:00:55
35000 -- [-426.994] (-431.447) (-432.318) (-428.207) * (-430.789) [-430.613] (-430.467) (-435.468) -- 0:00:55
Average standard deviation of split frequencies: 0.040662
35500 -- [-428.473] (-428.055) (-426.748) (-429.799) * (-428.180) (-436.951) (-429.847) [-438.856] -- 0:00:54
36000 -- (-429.328) (-425.649) [-427.633] (-430.124) * (-430.713) (-439.300) (-427.892) [-433.295] -- 0:00:53
36500 -- (-431.699) [-425.826] (-433.405) (-428.747) * (-427.692) [-435.832] (-429.377) (-432.010) -- 0:00:52
37000 -- (-427.217) [-427.844] (-435.154) (-430.718) * [-426.855] (-440.369) (-428.873) (-434.442) -- 0:00:52
37500 -- (-428.122) (-428.744) [-430.367] (-431.837) * (-429.621) [-432.586] (-427.717) (-430.217) -- 0:00:51
38000 -- (-429.715) [-429.157] (-428.621) (-428.338) * [-431.176] (-432.664) (-426.210) (-435.355) -- 0:00:50
38500 -- (-425.991) (-428.671) [-429.638] (-431.478) * (-431.980) (-432.676) [-428.131] (-441.821) -- 0:00:49
39000 -- (-426.513) [-428.371] (-427.755) (-428.968) * (-436.353) (-435.950) (-428.078) [-429.739] -- 0:00:49
39500 -- (-427.843) (-427.215) (-428.275) [-428.132] * (-428.620) (-433.456) (-427.972) [-434.330] -- 0:00:48
40000 -- (-425.984) [-426.348] (-426.742) (-427.850) * (-431.204) (-430.562) [-426.842] (-432.290) -- 0:00:48
Average standard deviation of split frequencies: 0.038185
40500 -- (-427.639) (-427.308) [-425.332] (-428.762) * (-428.531) (-433.229) (-428.464) [-438.873] -- 0:00:47
41000 -- (-432.991) [-427.201] (-426.847) (-425.024) * (-428.444) (-443.183) [-427.866] (-430.518) -- 0:01:10
41500 -- (-427.826) (-427.317) [-429.564] (-427.985) * [-426.477] (-435.483) (-428.634) (-428.781) -- 0:01:09
42000 -- (-427.197) (-426.885) [-428.867] (-429.650) * (-429.505) [-426.821] (-431.173) (-425.528) -- 0:01:08
42500 -- [-428.146] (-427.070) (-426.688) (-427.894) * [-427.912] (-438.533) (-432.396) (-428.259) -- 0:01:07
43000 -- [-429.899] (-428.132) (-426.094) (-426.446) * (-429.852) (-428.269) [-428.954] (-426.965) -- 0:01:06
43500 -- (-427.446) (-430.256) (-428.392) [-429.393] * [-427.853] (-429.517) (-429.174) (-427.579) -- 0:01:05
44000 -- (-426.369) [-430.985] (-427.157) (-432.289) * (-427.655) [-429.768] (-434.330) (-428.643) -- 0:01:05
44500 -- (-428.269) [-425.565] (-427.605) (-429.388) * (-432.200) (-430.041) (-429.502) [-426.121] -- 0:01:04
45000 -- (-426.590) [-427.066] (-427.133) (-426.389) * (-430.960) [-431.713] (-430.448) (-429.379) -- 0:01:03
Average standard deviation of split frequencies: 0.039853
45500 -- (-428.699) [-426.640] (-432.846) (-427.583) * (-432.835) [-426.981] (-427.576) (-427.926) -- 0:01:02
46000 -- (-428.801) [-425.338] (-427.250) (-427.324) * (-429.709) (-431.599) (-428.896) [-428.324] -- 0:01:02
46500 -- (-433.058) (-430.198) [-428.053] (-428.258) * (-431.300) (-429.760) [-426.569] (-427.883) -- 0:01:01
47000 -- (-427.338) [-428.419] (-429.535) (-429.215) * (-435.478) [-429.622] (-426.599) (-425.994) -- 0:01:00
47500 -- (-428.003) (-429.662) [-427.782] (-429.515) * (-436.899) [-430.276] (-426.779) (-426.722) -- 0:01:00
48000 -- (-426.280) (-429.225) [-430.608] (-429.297) * (-429.396) (-428.386) [-432.535] (-428.595) -- 0:00:59
48500 -- (-428.793) (-428.885) [-428.069] (-428.809) * [-427.841] (-425.824) (-428.023) (-427.315) -- 0:00:58
49000 -- (-427.328) (-430.135) [-427.705] (-429.676) * [-428.411] (-426.256) (-427.187) (-427.166) -- 0:00:58
49500 -- (-426.007) (-427.996) [-426.347] (-430.302) * (-429.266) (-425.621) (-425.777) [-428.927] -- 0:00:57
50000 -- (-428.811) (-426.079) (-427.799) [-428.331] * (-434.368) [-426.290] (-426.907) (-427.857) -- 0:00:57
Average standard deviation of split frequencies: 0.028891
50500 -- [-428.031] (-429.626) (-430.880) (-435.368) * (-425.645) [-429.100] (-426.735) (-427.851) -- 0:00:56
51000 -- (-427.465) [-427.466] (-426.990) (-430.814) * (-429.883) (-425.486) (-429.054) [-426.509] -- 0:00:55
51500 -- (-432.101) [-428.864] (-428.305) (-427.653) * [-427.079] (-425.347) (-426.479) (-427.812) -- 0:00:55
52000 -- [-429.773] (-426.971) (-427.624) (-428.199) * [-428.831] (-429.130) (-431.020) (-426.329) -- 0:00:54
52500 -- (-428.351) [-426.590] (-426.688) (-434.800) * (-429.051) (-428.474) (-432.507) [-428.649] -- 0:00:54
53000 -- (-428.516) (-427.733) [-428.970] (-426.607) * (-430.038) (-426.501) [-425.857] (-431.384) -- 0:00:53
53500 -- (-429.563) (-427.344) [-427.877] (-430.249) * (-430.762) (-427.888) [-427.930] (-432.878) -- 0:00:53
54000 -- [-428.571] (-433.631) (-426.835) (-427.221) * (-432.426) (-429.788) [-426.405] (-434.340) -- 0:00:52
54500 -- [-426.239] (-432.677) (-429.435) (-429.280) * (-429.971) [-429.419] (-427.881) (-430.813) -- 0:00:52
55000 -- (-425.922) (-427.349) (-429.607) [-428.478] * (-430.025) [-431.412] (-427.116) (-427.856) -- 0:00:51
Average standard deviation of split frequencies: 0.028355
55500 -- [-425.482] (-427.697) (-426.426) (-428.362) * [-431.183] (-430.860) (-433.442) (-430.150) -- 0:00:51
56000 -- (-425.441) (-430.673) (-427.618) [-425.723] * [-429.069] (-431.467) (-429.267) (-428.439) -- 0:00:50
56500 -- (-424.878) (-428.038) (-428.003) [-424.796] * [-430.054] (-430.910) (-427.747) (-426.015) -- 0:00:50
57000 -- (-427.092) [-426.724] (-432.232) (-429.822) * (-428.470) (-429.599) (-427.749) [-427.524] -- 0:01:06
57500 -- (-430.399) [-428.984] (-427.624) (-428.466) * (-431.139) (-427.534) (-426.740) [-426.271] -- 0:01:05
58000 -- (-428.241) (-429.062) (-429.951) [-426.538] * (-431.795) (-428.545) [-426.018] (-429.607) -- 0:01:04
58500 -- [-426.486] (-428.531) (-430.660) (-428.791) * (-427.274) [-427.511] (-428.315) (-427.520) -- 0:01:04
59000 -- (-426.480) [-426.364] (-431.402) (-428.118) * (-429.473) (-430.036) (-426.799) [-428.207] -- 0:01:03
59500 -- (-426.531) (-428.164) (-430.519) [-425.481] * (-430.344) (-432.677) (-425.825) [-428.162] -- 0:01:03
60000 -- (-425.846) (-429.860) (-433.960) [-426.593] * [-427.123] (-434.371) (-425.910) (-430.282) -- 0:01:02
Average standard deviation of split frequencies: 0.030673
60500 -- (-426.730) [-426.692] (-433.567) (-426.433) * (-429.001) [-430.958] (-425.599) (-430.570) -- 0:01:02
61000 -- (-426.511) (-428.863) [-427.684] (-429.960) * [-429.374] (-431.251) (-428.642) (-424.629) -- 0:01:01
61500 -- [-427.673] (-429.877) (-426.559) (-429.086) * (-427.907) [-431.328] (-428.446) (-425.109) -- 0:01:01
62000 -- (-427.837) (-429.873) (-431.835) [-427.327] * [-426.797] (-429.551) (-429.032) (-428.942) -- 0:01:00
62500 -- (-429.377) [-430.744] (-428.000) (-426.652) * (-425.600) (-429.521) [-429.108] (-427.552) -- 0:01:00
63000 -- [-428.036] (-430.842) (-429.571) (-426.295) * (-431.310) [-429.244] (-427.017) (-429.808) -- 0:00:59
63500 -- (-428.138) (-429.301) (-432.576) [-427.574] * (-429.572) [-428.558] (-428.447) (-429.410) -- 0:00:58
64000 -- [-424.915] (-429.988) (-428.954) (-428.772) * [-430.797] (-428.318) (-430.634) (-431.091) -- 0:00:58
64500 -- [-426.146] (-428.549) (-431.594) (-426.910) * (-425.912) (-425.389) [-425.877] (-429.823) -- 0:00:58
65000 -- (-427.409) [-428.917] (-425.998) (-426.910) * (-428.371) (-432.887) (-428.056) [-425.193] -- 0:00:57
Average standard deviation of split frequencies: 0.034585
65500 -- (-428.205) (-425.490) [-427.980] (-431.497) * (-426.070) (-429.668) [-426.252] (-428.187) -- 0:00:57
66000 -- (-426.442) [-426.867] (-428.951) (-429.777) * (-427.929) (-429.257) [-426.520] (-427.903) -- 0:00:56
66500 -- [-427.632] (-427.995) (-428.896) (-428.891) * (-427.303) (-430.519) (-426.581) [-429.409] -- 0:00:56
67000 -- [-429.236] (-427.741) (-429.874) (-431.253) * [-427.581] (-427.198) (-428.721) (-431.614) -- 0:00:55
67500 -- [-426.815] (-430.233) (-427.114) (-429.279) * (-429.717) [-432.786] (-427.298) (-429.182) -- 0:00:55
68000 -- (-428.598) (-429.266) [-432.988] (-429.244) * (-427.149) [-430.017] (-424.784) (-430.011) -- 0:00:54
68500 -- (-426.571) [-429.312] (-428.119) (-431.323) * (-428.383) (-430.275) (-424.588) [-425.578] -- 0:00:54
69000 -- (-427.553) (-429.632) (-428.806) [-428.543] * (-429.653) [-428.481] (-426.410) (-431.058) -- 0:00:53
69500 -- (-426.071) (-426.492) [-428.710] (-435.284) * (-429.609) (-434.259) (-425.748) [-428.583] -- 0:00:53
70000 -- [-426.538] (-429.073) (-427.011) (-430.335) * (-431.423) (-429.221) [-425.954] (-431.800) -- 0:00:53
Average standard deviation of split frequencies: 0.033354
70500 -- (-430.984) (-430.415) (-432.227) [-428.894] * (-427.376) (-430.238) (-428.089) [-430.822] -- 0:00:52
71000 -- (-429.975) [-428.056] (-428.371) (-427.876) * [-429.970] (-427.832) (-427.358) (-429.738) -- 0:00:52
71500 -- (-430.373) (-431.463) [-428.960] (-427.544) * (-428.637) (-427.902) (-426.402) [-425.750] -- 0:00:51
72000 -- [-431.394] (-428.866) (-429.304) (-427.100) * (-425.617) (-429.324) [-425.689] (-427.802) -- 0:00:51
72500 -- (-428.872) (-429.753) (-426.901) [-428.567] * (-432.493) [-427.805] (-427.662) (-430.775) -- 0:00:51
73000 -- (-428.016) (-426.424) [-427.652] (-428.946) * [-428.464] (-430.892) (-426.157) (-428.599) -- 0:01:03
73500 -- (-428.238) (-427.450) (-425.636) [-426.980] * (-427.396) (-427.117) [-426.266] (-433.905) -- 0:01:03
74000 -- (-432.763) (-425.578) [-428.138] (-427.602) * (-430.592) (-430.641) [-426.202] (-427.757) -- 0:01:02
74500 -- (-435.938) [-429.411] (-432.560) (-426.176) * (-431.739) [-429.356] (-430.078) (-431.865) -- 0:01:02
75000 -- [-430.369] (-427.510) (-433.465) (-431.094) * (-427.178) [-428.331] (-427.076) (-430.567) -- 0:01:01
Average standard deviation of split frequencies: 0.031013
75500 -- [-427.672] (-430.634) (-429.750) (-428.601) * [-426.978] (-429.643) (-429.999) (-427.795) -- 0:01:01
76000 -- [-427.229] (-429.949) (-429.973) (-426.633) * [-428.516] (-429.311) (-426.914) (-425.946) -- 0:01:00
76500 -- (-427.064) (-428.698) (-430.129) [-426.708] * [-427.226] (-429.194) (-429.357) (-426.043) -- 0:01:00
77000 -- (-426.437) [-428.722] (-425.752) (-429.007) * (-428.768) [-429.098] (-427.244) (-428.548) -- 0:00:59
77500 -- (-427.307) (-428.915) (-427.802) [-433.261] * [-428.620] (-430.707) (-425.948) (-428.456) -- 0:00:59
78000 -- (-426.775) [-429.157] (-430.012) (-429.521) * (-428.270) (-432.542) [-427.975] (-427.488) -- 0:00:59
78500 -- (-427.238) (-427.746) [-427.368] (-427.800) * (-429.184) (-425.523) [-425.576] (-429.998) -- 0:00:58
79000 -- (-429.013) (-429.738) (-425.539) [-429.770] * (-428.504) (-428.728) (-429.868) [-429.003] -- 0:00:58
79500 -- [-427.730] (-428.964) (-427.945) (-426.927) * (-426.959) (-426.162) (-426.890) [-426.888] -- 0:00:57
80000 -- (-429.916) [-427.676] (-426.976) (-426.281) * [-426.652] (-429.533) (-427.253) (-428.195) -- 0:00:57
Average standard deviation of split frequencies: 0.028106
80500 -- (-431.253) (-428.984) (-428.655) [-429.895] * (-428.199) (-426.565) (-426.100) [-427.498] -- 0:00:57
81000 -- (-429.685) (-430.242) [-428.300] (-428.088) * (-429.362) [-429.563] (-425.791) (-430.625) -- 0:00:56
81500 -- (-434.416) [-427.357] (-426.402) (-430.796) * (-426.717) (-425.750) (-427.306) [-428.798] -- 0:00:56
82000 -- (-427.003) [-426.987] (-428.535) (-430.387) * [-426.765] (-426.936) (-428.126) (-428.133) -- 0:00:55
82500 -- [-427.197] (-426.028) (-427.536) (-426.969) * (-425.952) (-427.587) (-427.859) [-428.316] -- 0:00:55
83000 -- [-432.814] (-428.688) (-426.969) (-427.526) * [-426.833] (-429.481) (-431.591) (-429.964) -- 0:00:55
83500 -- (-428.176) [-430.245] (-427.096) (-429.456) * (-425.172) (-434.249) (-426.305) [-427.246] -- 0:00:54
84000 -- [-427.066] (-429.277) (-426.058) (-434.540) * [-426.492] (-432.257) (-431.831) (-428.185) -- 0:00:54
84500 -- (-427.458) (-429.206) [-427.277] (-428.900) * [-428.033] (-426.083) (-426.716) (-427.972) -- 0:00:54
85000 -- (-431.522) (-432.675) (-429.059) [-427.934] * (-426.900) (-427.370) (-429.112) [-427.659] -- 0:00:53
Average standard deviation of split frequencies: 0.024275
85500 -- (-426.756) (-429.943) (-429.883) [-427.733] * [-426.644] (-430.013) (-427.529) (-427.840) -- 0:00:53
86000 -- (-428.368) (-428.574) [-428.971] (-427.048) * [-426.546] (-428.975) (-429.523) (-430.150) -- 0:00:53
86500 -- (-427.131) [-427.934] (-432.679) (-429.314) * [-429.101] (-432.004) (-428.333) (-428.825) -- 0:00:52
87000 -- (-428.566) [-428.197] (-431.232) (-428.841) * [-427.600] (-427.827) (-426.817) (-430.042) -- 0:00:52
87500 -- [-429.117] (-428.431) (-427.539) (-428.598) * (-426.652) (-431.943) [-425.414] (-430.083) -- 0:00:52
88000 -- (-429.289) [-427.429] (-426.542) (-428.054) * (-426.892) (-428.069) [-426.238] (-430.012) -- 0:00:51
88500 -- (-429.332) (-429.696) (-426.194) [-428.016] * (-427.623) (-434.489) [-427.556] (-428.983) -- 0:00:51
89000 -- (-434.270) (-429.137) [-428.070] (-432.772) * (-426.291) (-427.419) (-428.059) [-429.793] -- 0:01:01
89500 -- (-432.406) (-430.741) [-426.344] (-427.760) * (-428.476) (-428.739) [-427.177] (-427.108) -- 0:01:01
90000 -- (-430.260) (-428.945) [-425.309] (-430.050) * (-427.630) (-426.554) (-429.515) [-426.422] -- 0:01:00
Average standard deviation of split frequencies: 0.025997
90500 -- (-433.552) (-428.667) [-430.133] (-426.332) * (-425.664) (-426.863) [-433.087] (-426.998) -- 0:01:00
91000 -- [-428.854] (-431.543) (-425.598) (-432.198) * (-426.401) [-430.857] (-426.280) (-429.801) -- 0:00:59
91500 -- [-430.467] (-430.888) (-426.851) (-429.740) * (-429.364) [-431.721] (-431.335) (-430.218) -- 0:00:59
92000 -- (-430.834) [-428.230] (-427.799) (-428.821) * (-428.169) (-429.207) (-433.341) [-427.577] -- 0:00:59
92500 -- (-428.878) (-428.257) [-429.927] (-428.348) * [-428.415] (-426.794) (-427.685) (-431.587) -- 0:00:58
93000 -- [-428.529] (-427.487) (-430.594) (-426.549) * (-426.245) (-427.663) [-428.622] (-429.318) -- 0:00:58
93500 -- (-427.673) (-427.991) (-429.454) [-425.406] * [-426.149] (-427.285) (-430.104) (-428.026) -- 0:00:58
94000 -- (-429.954) (-427.157) [-427.016] (-427.215) * (-427.951) [-428.845] (-429.098) (-426.276) -- 0:00:57
94500 -- (-428.852) (-429.822) [-425.201] (-429.033) * (-429.738) (-428.727) (-430.073) [-428.451] -- 0:00:57
95000 -- (-428.155) [-425.815] (-428.779) (-431.653) * (-429.823) (-426.411) [-426.747] (-429.805) -- 0:00:57
Average standard deviation of split frequencies: 0.024085
95500 -- (-432.065) [-429.909] (-424.594) (-429.816) * [-430.190] (-430.019) (-430.052) (-428.695) -- 0:00:56
96000 -- (-432.494) [-427.929] (-429.117) (-429.505) * (-429.183) (-429.897) (-425.590) [-427.883] -- 0:00:56
96500 -- [-431.213] (-428.244) (-426.296) (-426.706) * (-425.795) [-431.473] (-427.539) (-427.777) -- 0:00:56
97000 -- (-430.740) (-425.190) (-428.187) [-427.888] * (-429.336) (-427.195) (-427.471) [-429.109] -- 0:00:55
97500 -- (-428.607) (-425.401) [-426.253] (-426.132) * [-433.725] (-429.330) (-429.593) (-427.955) -- 0:00:55
98000 -- (-428.436) (-426.966) (-428.467) [-427.673] * [-429.282] (-428.413) (-436.114) (-431.261) -- 0:00:55
98500 -- (-429.517) (-430.352) [-430.234] (-427.755) * (-432.159) (-427.012) [-436.809] (-428.849) -- 0:00:54
99000 -- (-427.318) (-430.852) (-427.590) [-430.836] * (-429.751) (-432.119) (-431.297) [-428.226] -- 0:00:54
99500 -- [-427.604] (-427.656) (-428.702) (-428.958) * (-429.775) (-429.684) [-428.015] (-428.342) -- 0:00:54
100000 -- (-431.048) [-428.984] (-427.634) (-426.286) * (-429.331) (-431.411) (-428.182) [-426.045] -- 0:00:54
Average standard deviation of split frequencies: 0.025053
100500 -- [-428.161] (-427.505) (-428.240) (-425.191) * (-430.232) (-433.260) (-432.225) [-426.379] -- 0:00:53
101000 -- (-429.105) [-427.423] (-427.272) (-428.012) * (-431.416) (-428.077) [-430.024] (-427.658) -- 0:00:53
101500 -- (-428.075) (-427.877) (-431.595) [-425.431] * [-427.069] (-428.370) (-427.632) (-427.750) -- 0:00:53
102000 -- (-431.261) [-427.555] (-426.700) (-427.367) * (-427.168) [-429.747] (-431.058) (-427.187) -- 0:00:52
102500 -- (-427.790) (-431.177) (-430.783) [-430.034] * (-427.263) (-427.824) [-428.729] (-428.026) -- 0:00:52
103000 -- (-428.536) [-427.212] (-427.184) (-432.393) * (-428.101) (-428.397) (-432.938) [-427.006] -- 0:00:52
103500 -- (-429.860) (-428.949) (-428.555) [-425.904] * (-430.819) [-425.759] (-427.289) (-427.700) -- 0:00:51
104000 -- (-431.332) [-427.330] (-432.087) (-429.167) * [-430.143] (-431.017) (-432.470) (-426.833) -- 0:00:51
104500 -- (-430.131) (-429.048) [-428.426] (-427.440) * (-432.360) (-429.942) [-426.343] (-428.621) -- 0:00:59
105000 -- (-429.002) [-426.113] (-429.386) (-431.262) * (-430.222) (-430.437) [-428.395] (-427.237) -- 0:00:59
Average standard deviation of split frequencies: 0.022236
105500 -- [-429.042] (-427.813) (-426.958) (-427.832) * (-426.881) [-427.763] (-427.626) (-426.705) -- 0:00:59
106000 -- [-430.172] (-427.019) (-428.149) (-428.315) * (-430.605) [-425.862] (-427.575) (-431.062) -- 0:00:59
106500 -- (-427.661) (-427.692) [-427.184] (-432.225) * (-429.261) (-431.534) [-427.366] (-428.843) -- 0:00:58
107000 -- (-429.579) [-426.836] (-427.894) (-430.944) * (-428.679) (-431.493) (-428.245) [-426.094] -- 0:00:58
107500 -- (-429.795) (-426.642) [-429.316] (-429.290) * (-428.576) (-427.080) [-426.764] (-428.185) -- 0:00:58
108000 -- (-427.587) (-426.412) [-428.564] (-427.099) * [-425.400] (-430.191) (-425.930) (-426.525) -- 0:00:57
108500 -- (-428.906) (-430.150) (-427.476) [-427.949] * (-430.704) (-428.380) [-427.584] (-426.265) -- 0:00:57
109000 -- (-432.679) (-427.457) (-427.281) [-429.386] * (-433.482) (-431.674) (-428.748) [-428.977] -- 0:00:57
109500 -- (-428.229) (-430.141) [-425.530] (-427.925) * (-431.054) (-430.613) (-428.009) [-426.972] -- 0:00:56
110000 -- [-428.866] (-426.484) (-430.028) (-430.285) * (-431.354) (-426.169) [-433.218] (-427.669) -- 0:00:56
Average standard deviation of split frequencies: 0.020524
110500 -- (-431.707) [-428.095] (-428.374) (-429.439) * [-433.119] (-427.733) (-432.945) (-427.078) -- 0:00:56
111000 -- (-429.169) [-427.336] (-425.696) (-430.588) * (-428.529) (-427.722) [-427.454] (-426.647) -- 0:00:56
111500 -- [-427.693] (-429.767) (-429.360) (-427.478) * (-432.447) (-429.100) (-425.539) [-426.812] -- 0:00:55
112000 -- [-428.169] (-427.512) (-429.173) (-425.361) * (-429.205) [-431.036] (-428.999) (-427.284) -- 0:00:55
112500 -- (-429.298) [-428.509] (-429.443) (-427.280) * [-428.558] (-428.804) (-426.497) (-426.055) -- 0:00:55
113000 -- [-433.271] (-426.150) (-427.898) (-429.575) * (-427.542) (-430.231) (-427.873) [-426.032] -- 0:00:54
113500 -- (-431.996) (-427.600) [-428.386] (-425.878) * [-429.107] (-428.734) (-427.463) (-433.453) -- 0:00:54
114000 -- (-433.709) (-425.802) (-429.773) [-426.658] * [-425.979] (-432.327) (-427.031) (-428.661) -- 0:00:54
114500 -- (-432.085) [-426.686] (-437.320) (-427.259) * (-433.767) (-428.728) (-426.083) [-427.040] -- 0:00:54
115000 -- (-430.928) [-427.020] (-428.246) (-432.141) * [-427.917] (-428.320) (-428.639) (-425.169) -- 0:00:53
Average standard deviation of split frequencies: 0.023829
115500 -- (-429.561) [-428.474] (-430.412) (-427.721) * [-427.793] (-427.926) (-427.420) (-429.270) -- 0:00:53
116000 -- [-429.507] (-428.245) (-427.126) (-428.047) * (-433.753) (-433.104) [-431.893] (-428.445) -- 0:00:53
116500 -- (-428.391) [-432.535] (-428.438) (-431.274) * (-430.523) [-430.268] (-430.700) (-429.710) -- 0:00:53
117000 -- (-430.591) (-426.616) (-433.136) [-431.816] * (-430.004) (-430.713) [-425.674] (-426.748) -- 0:00:52
117500 -- [-430.855] (-429.087) (-431.821) (-431.043) * (-430.617) (-431.412) [-426.152] (-428.697) -- 0:00:52
118000 -- (-427.945) (-428.305) [-427.214] (-433.003) * [-425.662] (-431.020) (-426.964) (-428.565) -- 0:00:52
118500 -- (-431.522) (-428.588) [-427.819] (-433.505) * [-431.205] (-428.527) (-426.799) (-429.452) -- 0:00:52
119000 -- (-433.412) (-430.060) [-429.464] (-429.393) * (-430.482) [-428.913] (-426.588) (-427.457) -- 0:00:51
119500 -- (-431.793) (-427.563) [-430.866] (-429.824) * [-429.733] (-428.788) (-425.324) (-426.403) -- 0:00:51
120000 -- (-427.534) [-427.407] (-427.279) (-429.578) * (-433.993) [-431.426] (-427.332) (-428.811) -- 0:00:51
Average standard deviation of split frequencies: 0.024184
120500 -- [-427.990] (-425.699) (-428.321) (-432.495) * (-431.844) (-434.601) (-426.222) [-428.331] -- 0:00:58
121000 -- [-431.679] (-427.455) (-425.534) (-429.608) * (-428.783) (-430.985) (-427.303) [-430.197] -- 0:00:58
121500 -- (-431.886) (-431.187) [-429.784] (-428.978) * (-427.277) (-430.360) (-427.741) [-424.983] -- 0:00:57
122000 -- (-430.912) (-428.095) (-430.198) [-432.442] * (-429.687) [-430.044] (-427.658) (-430.961) -- 0:00:57
122500 -- (-427.539) (-427.873) (-428.711) [-429.241] * (-430.956) [-428.609] (-429.732) (-426.990) -- 0:00:57
123000 -- (-427.289) (-426.847) (-433.913) [-432.462] * (-427.492) (-428.737) [-429.386] (-430.564) -- 0:00:57
123500 -- [-426.324] (-430.747) (-431.670) (-430.809) * [-426.968] (-431.224) (-430.115) (-426.736) -- 0:00:56
124000 -- [-430.835] (-434.361) (-428.373) (-431.787) * (-428.603) (-430.598) (-427.725) [-425.330] -- 0:00:56
124500 -- (-431.058) [-426.990] (-429.951) (-431.141) * (-426.339) (-429.842) (-429.099) [-430.263] -- 0:00:56
125000 -- (-429.886) [-426.596] (-429.232) (-427.760) * [-428.583] (-428.554) (-429.523) (-431.091) -- 0:00:56
Average standard deviation of split frequencies: 0.021379
125500 -- (-428.449) (-428.614) (-431.457) [-429.881] * (-427.600) [-430.511] (-425.581) (-429.731) -- 0:00:55
126000 -- (-428.075) [-430.489] (-429.512) (-429.446) * (-428.498) [-426.994] (-428.087) (-428.904) -- 0:00:55
126500 -- (-428.493) (-425.864) [-429.882] (-427.291) * [-427.495] (-433.957) (-425.901) (-433.337) -- 0:00:55
127000 -- (-427.803) (-426.126) [-429.860] (-428.678) * (-426.593) (-427.320) [-427.786] (-431.500) -- 0:00:54
127500 -- (-427.102) [-426.486] (-428.583) (-426.952) * (-428.834) (-428.994) [-429.234] (-428.194) -- 0:00:54
128000 -- (-427.289) (-428.445) [-428.016] (-427.622) * (-429.259) [-430.665] (-428.520) (-426.129) -- 0:00:54
128500 -- [-426.717] (-432.220) (-431.313) (-426.631) * (-432.364) (-429.217) [-427.518] (-427.581) -- 0:00:54
129000 -- (-428.052) [-427.468] (-430.319) (-427.346) * (-430.386) (-431.561) (-427.477) [-426.250] -- 0:00:54
129500 -- (-428.811) [-426.103] (-427.956) (-429.090) * (-427.944) (-433.861) (-430.554) [-427.307] -- 0:00:53
130000 -- (-429.274) [-427.329] (-437.160) (-428.203) * (-427.236) (-430.108) [-427.508] (-428.470) -- 0:00:53
Average standard deviation of split frequencies: 0.023879
130500 -- (-428.370) (-425.950) (-429.217) [-428.204] * (-427.832) (-430.982) (-427.474) [-427.221] -- 0:00:53
131000 -- (-426.776) [-427.159] (-429.093) (-426.391) * (-428.236) (-432.772) (-426.512) [-425.816] -- 0:00:53
131500 -- [-430.628] (-430.376) (-427.480) (-425.765) * (-426.849) (-429.279) (-428.652) [-426.544] -- 0:00:52
132000 -- (-429.890) (-428.054) [-428.762] (-427.710) * (-425.097) (-429.226) [-427.062] (-427.651) -- 0:00:52
132500 -- (-428.758) [-425.017] (-429.262) (-428.144) * [-425.767] (-431.485) (-429.646) (-426.506) -- 0:00:52
133000 -- (-425.675) [-426.315] (-428.285) (-426.276) * [-426.656] (-429.097) (-428.900) (-429.057) -- 0:00:52
133500 -- [-427.277] (-428.199) (-429.260) (-428.204) * (-426.274) (-427.037) (-426.392) [-430.361] -- 0:00:51
134000 -- (-425.561) [-428.009] (-428.222) (-426.249) * (-429.404) (-428.419) [-426.983] (-428.967) -- 0:00:51
134500 -- (-429.431) (-427.773) (-431.369) [-427.219] * (-427.154) (-426.642) [-427.043] (-426.557) -- 0:00:51
135000 -- (-426.171) (-428.625) [-428.753] (-427.619) * (-429.284) (-425.426) [-427.637] (-428.802) -- 0:00:51
Average standard deviation of split frequencies: 0.024993
135500 -- (-431.570) [-433.186] (-432.861) (-426.716) * (-428.906) (-428.333) [-427.879] (-431.771) -- 0:00:51
136000 -- (-432.098) (-429.765) (-435.003) [-431.307] * (-430.546) [-428.762] (-425.675) (-433.972) -- 0:00:50
136500 -- [-429.066] (-428.992) (-430.144) (-426.419) * [-428.347] (-429.072) (-428.676) (-429.455) -- 0:00:56
137000 -- (-430.513) (-430.412) [-425.583] (-426.949) * (-430.202) [-433.062] (-430.755) (-432.651) -- 0:00:56
137500 -- (-425.574) (-429.119) (-428.316) [-429.637] * [-427.328] (-431.193) (-426.827) (-427.590) -- 0:00:56
138000 -- (-428.381) [-425.908] (-428.532) (-430.842) * [-427.139] (-427.643) (-429.314) (-427.601) -- 0:00:56
138500 -- (-428.977) (-428.503) [-427.991] (-432.331) * (-427.872) [-429.589] (-426.732) (-428.474) -- 0:00:55
139000 -- (-430.450) [-426.815] (-429.064) (-429.422) * [-426.827] (-426.376) (-432.381) (-427.434) -- 0:00:55
139500 -- [-430.207] (-428.744) (-427.417) (-432.997) * (-429.367) (-426.104) (-428.312) [-426.058] -- 0:00:55
140000 -- (-428.660) [-427.766] (-431.071) (-429.820) * [-427.696] (-429.209) (-433.095) (-425.742) -- 0:00:55
Average standard deviation of split frequencies: 0.025506
140500 -- (-427.341) [-426.534] (-429.323) (-427.516) * [-426.328] (-427.908) (-426.806) (-425.212) -- 0:00:55
141000 -- [-429.091] (-426.252) (-431.046) (-427.123) * (-428.149) (-426.996) [-429.310] (-426.422) -- 0:00:54
141500 -- (-427.753) [-425.570] (-430.009) (-428.559) * [-428.069] (-426.861) (-429.086) (-426.622) -- 0:00:54
142000 -- (-428.423) (-426.019) (-434.947) [-425.919] * (-429.314) (-425.769) (-426.649) [-429.821] -- 0:00:54
142500 -- [-427.056] (-427.885) (-427.697) (-433.615) * (-426.760) (-432.690) (-429.029) [-426.514] -- 0:00:54
143000 -- (-426.514) [-426.584] (-429.744) (-425.943) * (-429.473) [-427.924] (-430.646) (-428.291) -- 0:00:53
143500 -- (-430.356) (-428.036) (-430.333) [-428.713] * [-426.664] (-426.377) (-425.509) (-428.569) -- 0:00:53
144000 -- (-429.077) (-427.052) [-430.801] (-427.907) * (-428.944) (-427.281) (-427.237) [-429.361] -- 0:00:53
144500 -- (-429.257) (-426.458) [-430.029] (-429.157) * (-428.464) (-427.524) [-426.593] (-427.669) -- 0:00:53
145000 -- (-428.987) (-427.954) (-429.096) [-429.560] * (-427.563) (-430.294) [-428.798] (-431.565) -- 0:00:53
Average standard deviation of split frequencies: 0.027190
145500 -- (-429.029) (-432.269) (-429.413) [-428.149] * (-429.568) (-430.682) [-427.345] (-431.311) -- 0:00:52
146000 -- (-426.807) (-427.336) [-428.576] (-430.663) * (-427.974) (-426.698) (-427.406) [-426.318] -- 0:00:52
146500 -- (-426.705) (-430.823) (-428.211) [-428.352] * (-429.645) (-427.715) [-428.890] (-425.575) -- 0:00:52
147000 -- (-425.871) (-431.219) (-428.115) [-429.120] * (-428.970) (-426.014) [-426.724] (-426.735) -- 0:00:52
147500 -- (-430.256) [-431.285] (-427.997) (-430.151) * [-427.181] (-428.789) (-427.227) (-426.446) -- 0:00:52
148000 -- [-429.129] (-431.919) (-430.197) (-433.037) * (-429.209) [-427.601] (-430.100) (-428.099) -- 0:00:51
148500 -- (-427.964) (-429.641) (-427.845) [-430.303] * (-434.237) [-429.199] (-428.501) (-426.165) -- 0:00:51
149000 -- (-430.173) (-429.044) [-427.433] (-428.045) * [-431.890] (-429.979) (-430.020) (-430.062) -- 0:00:51
149500 -- (-432.025) [-428.477] (-427.919) (-427.173) * [-426.885] (-429.057) (-426.803) (-429.507) -- 0:00:51
150000 -- [-430.247] (-425.975) (-432.189) (-429.266) * (-431.035) [-428.245] (-431.148) (-427.218) -- 0:00:51
Average standard deviation of split frequencies: 0.026282
150500 -- (-427.389) [-427.660] (-432.195) (-430.307) * (-430.361) (-429.954) (-425.995) [-426.462] -- 0:00:50
151000 -- [-426.996] (-426.624) (-429.708) (-428.695) * (-427.682) (-431.115) (-427.937) [-426.204] -- 0:00:50
151500 -- (-431.450) (-428.045) (-428.788) [-428.314] * (-427.607) (-428.181) (-427.253) [-426.421] -- 0:00:50
152000 -- (-429.653) (-427.430) (-426.660) [-431.085] * (-428.162) (-429.854) [-427.875] (-429.406) -- 0:00:50
152500 -- (-430.306) (-428.570) [-430.717] (-429.170) * (-434.844) (-428.864) [-427.058] (-429.214) -- 0:00:55
153000 -- (-430.050) (-427.353) [-431.040] (-428.622) * (-433.410) (-432.610) (-427.447) [-429.665] -- 0:00:55
153500 -- (-429.640) (-429.498) (-431.285) [-428.485] * (-430.062) (-431.037) [-429.228] (-430.613) -- 0:00:55
154000 -- (-430.866) [-430.031] (-426.469) (-429.776) * (-427.878) (-432.660) (-429.555) [-429.857] -- 0:00:54
154500 -- (-432.357) (-431.822) (-427.487) [-428.173] * (-426.627) (-430.712) [-427.345] (-430.802) -- 0:00:54
155000 -- [-430.711] (-432.208) (-426.391) (-428.140) * (-428.896) (-434.958) (-430.038) [-428.471] -- 0:00:54
Average standard deviation of split frequencies: 0.025686
155500 -- [-431.070] (-430.638) (-430.679) (-428.492) * (-429.025) [-429.641] (-428.684) (-428.905) -- 0:00:54
156000 -- (-429.068) (-427.100) [-428.457] (-430.537) * (-428.979) (-430.581) [-427.821] (-428.770) -- 0:00:54
156500 -- [-428.331] (-428.743) (-428.125) (-429.777) * (-427.854) (-433.651) (-431.796) [-428.392] -- 0:00:53
157000 -- (-427.632) (-428.374) [-433.032] (-428.309) * (-428.959) (-432.102) (-425.803) [-430.014] -- 0:00:53
157500 -- (-427.673) (-427.301) (-427.595) [-427.327] * (-427.703) (-428.546) [-424.755] (-428.824) -- 0:00:53
158000 -- (-429.821) (-429.196) [-427.269] (-429.896) * (-431.747) [-428.311] (-425.295) (-434.140) -- 0:00:53
158500 -- (-426.270) [-427.729] (-428.849) (-427.249) * [-431.121] (-427.939) (-429.103) (-428.473) -- 0:00:53
159000 -- (-426.037) [-427.608] (-431.131) (-432.718) * (-430.146) (-428.189) [-427.205] (-431.562) -- 0:00:52
159500 -- [-428.704] (-431.143) (-429.572) (-432.074) * (-427.268) [-431.410] (-426.633) (-431.573) -- 0:00:52
160000 -- (-433.328) (-427.498) (-428.454) [-431.274] * [-427.405] (-428.128) (-427.737) (-428.844) -- 0:00:52
Average standard deviation of split frequencies: 0.026715
160500 -- [-429.631] (-431.470) (-428.354) (-432.362) * (-429.978) (-436.216) (-427.755) [-429.223] -- 0:00:52
161000 -- (-429.085) [-427.925] (-430.165) (-429.842) * [-430.791] (-425.895) (-429.223) (-430.633) -- 0:00:52
161500 -- (-430.132) [-428.476] (-429.441) (-427.963) * [-431.019] (-426.240) (-430.963) (-428.643) -- 0:00:51
162000 -- (-429.942) (-427.576) [-426.211] (-429.685) * (-427.291) (-429.270) [-426.243] (-428.631) -- 0:00:51
162500 -- (-430.034) (-428.204) (-426.246) [-429.067] * (-429.859) (-429.072) [-427.667] (-429.353) -- 0:00:51
163000 -- (-430.687) [-427.906] (-428.684) (-427.053) * (-428.510) [-426.832] (-427.045) (-428.493) -- 0:00:51
163500 -- (-427.855) (-426.640) [-426.763] (-426.760) * [-425.611] (-429.880) (-426.097) (-430.128) -- 0:00:51
164000 -- (-425.950) (-430.464) [-427.672] (-432.871) * (-428.908) (-426.848) [-427.363] (-429.386) -- 0:00:50
164500 -- (-432.700) (-429.100) (-428.599) [-437.348] * (-427.625) (-428.027) [-427.288] (-431.114) -- 0:00:50
165000 -- (-431.338) (-428.164) [-428.758] (-430.259) * (-428.859) (-426.608) (-425.992) [-434.562] -- 0:00:50
Average standard deviation of split frequencies: 0.024661
165500 -- (-424.219) [-433.541] (-430.343) (-429.161) * (-431.399) (-430.847) [-427.587] (-432.573) -- 0:00:50
166000 -- [-426.863] (-427.402) (-428.457) (-431.349) * (-432.255) [-428.313] (-425.535) (-430.450) -- 0:00:50
166500 -- (-430.851) [-428.117] (-429.389) (-428.699) * [-426.357] (-431.110) (-426.086) (-430.848) -- 0:00:50
167000 -- (-429.376) (-427.542) [-428.303] (-431.400) * [-428.465] (-429.943) (-426.536) (-429.582) -- 0:00:49
167500 -- [-427.773] (-429.689) (-426.002) (-427.351) * (-426.592) (-430.322) (-428.373) [-428.521] -- 0:00:49
168000 -- [-427.329] (-428.451) (-426.294) (-427.952) * (-430.061) (-427.313) [-425.731] (-429.539) -- 0:00:54
168500 -- [-427.015] (-432.042) (-427.248) (-427.156) * [-431.226] (-429.021) (-425.524) (-431.102) -- 0:00:54
169000 -- (-431.938) (-433.200) (-426.912) [-430.316] * (-426.745) (-427.133) (-430.489) [-430.485] -- 0:00:54
169500 -- (-429.453) (-428.241) [-424.983] (-427.187) * [-426.904] (-430.509) (-428.329) (-429.923) -- 0:00:53
170000 -- (-428.843) [-425.925] (-428.655) (-428.155) * (-431.933) [-429.002] (-429.503) (-431.960) -- 0:00:53
Average standard deviation of split frequencies: 0.021952
170500 -- (-426.231) [-428.192] (-428.996) (-425.364) * (-430.912) (-429.583) [-428.070] (-431.450) -- 0:00:53
171000 -- (-426.954) [-428.799] (-429.804) (-426.676) * [-427.822] (-429.216) (-430.182) (-426.199) -- 0:00:53
171500 -- (-430.057) (-427.379) (-427.726) [-426.262] * (-428.752) (-430.445) (-429.813) [-428.328] -- 0:00:53
172000 -- (-431.431) (-428.078) (-428.235) [-426.144] * (-434.705) (-430.654) (-429.078) [-428.924] -- 0:00:52
172500 -- (-429.367) (-426.221) (-429.397) [-429.814] * (-436.410) (-428.047) [-427.493] (-429.708) -- 0:00:52
173000 -- (-430.516) [-427.338] (-428.254) (-427.474) * (-432.467) [-427.255] (-428.469) (-428.553) -- 0:00:52
173500 -- (-426.148) [-430.377] (-427.013) (-431.097) * [-426.856] (-427.638) (-429.695) (-427.622) -- 0:00:52
174000 -- (-429.433) (-427.748) [-426.958] (-432.129) * [-425.562] (-430.968) (-430.546) (-430.188) -- 0:00:52
174500 -- (-428.757) [-428.636] (-431.302) (-427.005) * (-432.198) (-429.224) (-428.860) [-426.930] -- 0:00:52
175000 -- (-430.662) (-431.800) [-427.167] (-426.568) * [-428.929] (-431.080) (-429.123) (-427.240) -- 0:00:51
Average standard deviation of split frequencies: 0.020300
175500 -- [-427.471] (-428.762) (-428.896) (-428.154) * (-427.114) (-428.488) [-427.107] (-428.255) -- 0:00:51
176000 -- (-429.539) [-430.089] (-428.063) (-428.090) * (-426.677) (-430.252) [-429.849] (-427.837) -- 0:00:51
176500 -- (-430.417) [-426.861] (-426.633) (-429.154) * (-426.211) (-432.717) (-429.102) [-427.840] -- 0:00:51
177000 -- (-429.336) (-429.041) [-430.643] (-429.046) * (-427.992) (-428.085) [-426.705] (-429.711) -- 0:00:51
177500 -- [-429.530] (-427.369) (-427.882) (-431.688) * (-436.023) (-428.330) [-430.357] (-431.471) -- 0:00:50
178000 -- (-427.779) (-432.340) (-429.119) [-428.928] * (-430.994) (-431.369) [-429.947] (-437.182) -- 0:00:50
178500 -- (-433.488) [-431.166] (-426.927) (-426.346) * (-429.067) (-432.269) [-426.422] (-427.469) -- 0:00:50
179000 -- (-429.055) (-427.101) (-427.940) [-429.714] * [-427.813] (-432.949) (-430.715) (-428.566) -- 0:00:50
179500 -- (-429.149) [-426.964] (-427.628) (-431.016) * (-428.985) (-429.546) [-426.757] (-427.477) -- 0:00:50
180000 -- [-427.401] (-429.600) (-429.650) (-429.028) * (-429.783) [-425.847] (-427.753) (-427.976) -- 0:00:50
Average standard deviation of split frequencies: 0.019859
180500 -- (-431.125) (-427.474) [-430.216] (-427.424) * (-428.788) [-428.874] (-429.509) (-427.647) -- 0:00:49
181000 -- [-426.567] (-429.920) (-427.786) (-429.301) * (-429.640) [-428.651] (-431.797) (-427.361) -- 0:00:49
181500 -- [-429.041] (-429.664) (-429.000) (-429.361) * (-430.807) (-429.381) (-429.334) [-427.507] -- 0:00:49
182000 -- (-428.571) [-428.696] (-429.015) (-425.751) * (-428.006) (-427.958) (-427.599) [-429.237] -- 0:00:49
182500 -- (-429.393) (-431.004) [-427.300] (-427.607) * (-428.595) [-426.327] (-427.804) (-432.392) -- 0:00:49
183000 -- [-429.088] (-430.033) (-429.494) (-427.160) * [-428.287] (-429.805) (-427.733) (-431.609) -- 0:00:49
183500 -- [-427.012] (-429.889) (-429.448) (-427.080) * (-432.747) [-429.831] (-429.875) (-430.203) -- 0:00:48
184000 -- (-432.827) (-429.074) (-425.435) [-431.175] * [-432.003] (-427.771) (-430.368) (-427.883) -- 0:00:53
184500 -- [-431.605] (-429.510) (-425.252) (-428.374) * (-428.847) (-426.814) [-427.485] (-428.635) -- 0:00:53
185000 -- [-428.042] (-429.538) (-427.274) (-427.671) * (-431.329) (-429.022) [-428.613] (-426.262) -- 0:00:52
Average standard deviation of split frequencies: 0.019208
185500 -- (-428.768) (-425.985) (-428.048) [-429.343] * [-424.869] (-428.670) (-430.824) (-430.130) -- 0:00:52
186000 -- (-430.127) (-429.187) (-429.813) [-427.127] * (-431.529) (-426.515) [-426.577] (-429.462) -- 0:00:52
186500 -- [-428.704] (-428.205) (-428.232) (-429.614) * [-429.977] (-431.869) (-430.250) (-435.556) -- 0:00:52
187000 -- (-427.097) (-427.777) [-427.907] (-432.606) * (-426.327) [-434.631] (-427.542) (-430.959) -- 0:00:52
187500 -- [-430.205] (-427.860) (-427.880) (-429.567) * (-430.377) (-432.872) [-427.061] (-428.753) -- 0:00:52
188000 -- [-429.197] (-429.433) (-429.183) (-426.168) * (-428.896) (-435.756) (-428.661) [-427.969] -- 0:00:51
188500 -- [-427.758] (-428.904) (-433.155) (-428.816) * [-426.424] (-427.146) (-428.839) (-428.457) -- 0:00:51
189000 -- [-429.203] (-430.821) (-431.397) (-428.663) * (-428.048) (-429.009) [-427.795] (-431.943) -- 0:00:51
189500 -- [-426.121] (-428.653) (-427.476) (-426.798) * (-432.457) [-425.939] (-426.291) (-429.530) -- 0:00:51
190000 -- [-427.827] (-429.898) (-427.181) (-425.929) * [-428.486] (-429.355) (-426.275) (-428.550) -- 0:00:51
Average standard deviation of split frequencies: 0.017444
190500 -- (-428.068) (-432.285) (-428.846) [-429.148] * (-427.395) [-426.159] (-427.764) (-430.040) -- 0:00:50
191000 -- [-426.784] (-429.025) (-428.041) (-429.495) * [-426.154] (-425.529) (-428.979) (-428.203) -- 0:00:50
191500 -- (-428.890) [-429.320] (-426.562) (-428.671) * [-426.870] (-432.137) (-427.825) (-426.156) -- 0:00:50
192000 -- (-427.203) (-430.289) [-426.807] (-426.441) * (-426.446) (-430.156) [-428.042] (-429.655) -- 0:00:50
192500 -- (-426.973) (-426.119) (-428.822) [-427.648] * (-427.147) (-427.005) [-426.379] (-430.687) -- 0:00:50
193000 -- (-429.707) (-426.008) [-427.241] (-429.348) * [-433.367] (-426.866) (-430.045) (-431.933) -- 0:00:50
193500 -- (-430.819) [-428.047] (-429.980) (-429.384) * (-432.226) (-425.399) (-429.131) [-430.388] -- 0:00:50
194000 -- [-428.309] (-428.417) (-428.559) (-426.212) * [-429.810] (-427.433) (-429.964) (-427.424) -- 0:00:49
194500 -- (-427.273) (-428.046) [-425.554] (-425.994) * (-427.424) [-428.345] (-430.011) (-427.904) -- 0:00:49
195000 -- (-428.655) (-425.726) [-425.724] (-428.374) * (-429.642) (-429.434) (-431.812) [-430.984] -- 0:00:49
Average standard deviation of split frequencies: 0.016977
195500 -- (-426.658) (-428.736) (-428.241) [-427.748] * [-427.468] (-428.789) (-431.366) (-429.262) -- 0:00:49
196000 -- [-427.268] (-427.304) (-427.248) (-428.698) * (-427.805) (-428.997) [-425.298] (-429.713) -- 0:00:49
196500 -- (-429.944) (-427.333) [-427.432] (-427.991) * (-426.602) (-428.500) [-427.726] (-427.439) -- 0:00:49
197000 -- [-430.028] (-431.663) (-427.650) (-426.693) * (-432.048) (-428.698) (-427.042) [-426.430] -- 0:00:48
197500 -- (-432.762) [-426.908] (-428.432) (-429.763) * (-426.779) [-427.394] (-427.803) (-430.004) -- 0:00:48
198000 -- (-426.876) [-432.144] (-429.486) (-427.358) * (-425.551) (-429.675) [-428.639] (-430.785) -- 0:00:48
198500 -- (-425.744) [-426.464] (-430.954) (-431.140) * (-428.445) (-428.638) [-427.814] (-426.610) -- 0:00:48
199000 -- (-430.484) (-425.605) [-428.624] (-428.876) * (-429.028) [-427.747] (-428.012) (-427.712) -- 0:00:48
199500 -- (-429.419) (-426.858) [-426.045] (-431.176) * [-432.980] (-430.092) (-426.880) (-428.981) -- 0:00:48
200000 -- (-431.210) (-426.131) [-427.502] (-428.067) * (-433.524) (-427.603) (-427.028) [-428.201] -- 0:00:51
Average standard deviation of split frequencies: 0.018379
200500 -- [-427.379] (-426.999) (-430.259) (-427.774) * (-430.509) [-428.486] (-429.217) (-429.471) -- 0:00:51
201000 -- (-429.999) [-428.238] (-426.945) (-428.563) * (-428.277) [-429.137] (-428.959) (-432.101) -- 0:00:51
201500 -- [-429.883] (-429.652) (-428.005) (-430.452) * (-431.456) (-429.440) (-429.999) [-427.480] -- 0:00:51
202000 -- (-427.286) (-427.822) [-425.865] (-428.034) * (-428.337) (-429.100) (-429.342) [-431.238] -- 0:00:51
202500 -- (-426.900) (-425.074) [-428.775] (-427.273) * [-428.569] (-430.847) (-427.887) (-432.693) -- 0:00:51
203000 -- (-428.333) [-427.963] (-430.050) (-425.966) * [-429.337] (-429.507) (-428.193) (-428.733) -- 0:00:51
203500 -- (-430.291) (-426.659) [-427.478] (-425.838) * (-429.155) (-428.021) (-426.391) [-428.616] -- 0:00:50
204000 -- (-427.136) (-429.706) [-428.093] (-425.715) * (-428.534) [-427.616] (-426.928) (-426.663) -- 0:00:50
204500 -- [-430.806] (-429.490) (-427.494) (-428.706) * [-427.440] (-429.826) (-430.686) (-425.318) -- 0:00:50
205000 -- (-428.911) [-429.116] (-430.605) (-426.737) * (-428.926) (-429.202) (-427.680) [-425.262] -- 0:00:50
Average standard deviation of split frequencies: 0.018307
205500 -- (-427.247) (-426.612) [-430.700] (-429.329) * (-428.702) [-429.171] (-427.913) (-429.298) -- 0:00:50
206000 -- (-427.447) (-428.848) [-427.645] (-427.001) * (-428.571) (-429.309) [-428.664] (-429.066) -- 0:00:50
206500 -- (-429.488) (-428.428) (-426.310) [-427.914] * (-429.455) [-430.476] (-426.760) (-427.374) -- 0:00:49
207000 -- (-430.305) (-431.965) [-428.644] (-428.358) * (-430.937) (-429.435) [-427.918] (-425.787) -- 0:00:49
207500 -- [-430.398] (-429.139) (-429.577) (-426.008) * (-431.547) [-430.422] (-431.065) (-425.043) -- 0:00:49
208000 -- (-433.561) (-427.368) (-427.721) [-426.036] * (-431.336) (-427.945) [-429.581] (-429.532) -- 0:00:49
208500 -- (-427.349) (-430.339) (-428.800) [-425.872] * (-428.477) [-429.604] (-427.636) (-427.916) -- 0:00:49
209000 -- [-428.431] (-428.598) (-430.858) (-426.109) * [-428.654] (-430.396) (-433.335) (-428.675) -- 0:00:49
209500 -- (-428.352) (-430.001) (-430.143) [-424.627] * (-427.039) [-427.934] (-427.728) (-429.680) -- 0:00:49
210000 -- (-433.096) (-428.959) [-431.244] (-426.629) * [-427.505] (-430.108) (-428.400) (-429.973) -- 0:00:48
Average standard deviation of split frequencies: 0.018691
210500 -- (-432.847) (-427.089) (-429.193) [-426.025] * (-429.038) [-428.277] (-429.420) (-430.265) -- 0:00:48
211000 -- (-433.380) (-430.864) [-430.614] (-427.161) * [-427.860] (-428.482) (-429.182) (-428.002) -- 0:00:48
211500 -- [-429.953] (-428.466) (-430.977) (-427.815) * (-427.293) (-429.316) (-429.133) [-426.969] -- 0:00:48
212000 -- (-428.366) (-427.641) [-427.290] (-431.860) * (-430.518) (-427.877) [-428.281] (-427.357) -- 0:00:48
212500 -- (-429.299) [-431.416] (-427.447) (-429.096) * (-427.951) [-426.346] (-429.012) (-426.092) -- 0:00:48
213000 -- (-429.748) (-427.751) [-428.011] (-430.365) * (-425.551) [-424.605] (-425.703) (-431.490) -- 0:00:48
213500 -- [-429.186] (-427.454) (-425.680) (-426.200) * [-427.791] (-427.673) (-428.217) (-432.667) -- 0:00:47
214000 -- (-430.600) (-429.421) (-428.455) [-426.289] * (-429.377) [-424.924] (-429.626) (-427.588) -- 0:00:47
214500 -- (-426.223) (-427.206) [-425.989] (-430.726) * (-427.564) (-429.278) (-426.740) [-428.095] -- 0:00:47
215000 -- (-427.685) (-425.686) [-425.777] (-431.489) * (-427.066) [-425.660] (-428.313) (-430.560) -- 0:00:47
Average standard deviation of split frequencies: 0.016176
215500 -- (-429.950) [-427.962] (-427.793) (-434.290) * (-431.614) [-427.201] (-430.242) (-430.017) -- 0:00:50
216000 -- (-426.032) (-431.005) [-427.294] (-428.526) * [-428.318] (-430.442) (-433.913) (-433.223) -- 0:00:50
216500 -- [-428.347] (-429.618) (-430.669) (-428.776) * (-427.612) [-426.274] (-430.966) (-428.978) -- 0:00:50
217000 -- (-425.582) (-429.159) (-426.942) [-426.642] * (-426.754) [-425.980] (-428.245) (-429.175) -- 0:00:50
217500 -- [-428.559] (-427.187) (-428.198) (-431.342) * (-429.186) (-426.709) (-427.365) [-429.923] -- 0:00:50
218000 -- (-430.099) [-431.675] (-428.111) (-430.883) * (-431.246) (-430.665) [-427.899] (-433.951) -- 0:00:50
218500 -- (-429.906) (-427.659) (-431.330) [-428.990] * [-425.052] (-427.052) (-426.186) (-433.240) -- 0:00:50
219000 -- (-430.442) (-429.421) (-426.181) [-429.452] * (-424.922) (-427.535) (-429.713) [-431.195] -- 0:00:49
219500 -- [-426.446] (-430.597) (-429.872) (-426.952) * [-427.404] (-427.777) (-429.255) (-431.873) -- 0:00:49
220000 -- (-427.092) [-426.654] (-427.270) (-431.726) * [-427.824] (-428.850) (-431.886) (-430.074) -- 0:00:49
Average standard deviation of split frequencies: 0.015457
220500 -- [-429.129] (-427.656) (-426.700) (-428.262) * (-433.812) (-433.615) [-430.129] (-430.760) -- 0:00:49
221000 -- (-426.796) [-427.431] (-428.510) (-425.730) * [-426.550] (-431.530) (-428.883) (-429.267) -- 0:00:49
221500 -- (-426.834) [-427.611] (-430.987) (-429.595) * (-426.740) (-429.298) [-429.528] (-430.661) -- 0:00:49
222000 -- (-427.117) (-426.576) [-430.517] (-426.540) * (-427.077) [-431.206] (-427.764) (-430.866) -- 0:00:49
222500 -- (-428.056) (-431.118) [-429.231] (-429.577) * (-430.616) [-429.721] (-427.147) (-429.020) -- 0:00:48
223000 -- (-432.380) (-426.805) [-425.711] (-428.638) * [-429.447] (-427.582) (-426.561) (-431.384) -- 0:00:48
223500 -- (-425.880) (-427.435) [-426.992] (-429.788) * [-428.475] (-426.379) (-426.151) (-428.147) -- 0:00:48
224000 -- [-425.702] (-428.852) (-428.024) (-427.759) * (-425.666) [-427.139] (-425.600) (-431.814) -- 0:00:48
224500 -- [-427.304] (-428.784) (-426.266) (-427.552) * (-428.319) (-428.019) (-430.052) [-427.788] -- 0:00:48
225000 -- (-427.231) [-428.029] (-432.789) (-427.128) * (-428.196) [-428.946] (-431.626) (-431.322) -- 0:00:48
Average standard deviation of split frequencies: 0.015215
225500 -- (-426.389) (-427.541) (-426.742) [-428.027] * (-427.435) [-429.870] (-429.055) (-431.384) -- 0:00:48
226000 -- [-431.506] (-429.727) (-427.843) (-426.301) * [-427.735] (-435.009) (-430.661) (-428.306) -- 0:00:47
226500 -- (-426.838) (-426.473) (-425.379) [-427.241] * (-429.389) (-427.456) [-428.165] (-431.196) -- 0:00:47
227000 -- (-427.496) (-429.295) [-427.048] (-428.732) * [-427.239] (-429.742) (-428.124) (-430.538) -- 0:00:47
227500 -- (-427.314) (-427.006) (-427.558) [-425.372] * (-428.853) (-427.339) [-428.338] (-430.285) -- 0:00:47
228000 -- (-427.553) [-426.335] (-427.467) (-424.746) * (-427.953) (-425.451) (-428.586) [-427.881] -- 0:00:47
228500 -- (-428.394) [-427.403] (-428.793) (-428.410) * (-428.645) (-432.058) (-425.873) [-428.014] -- 0:00:47
229000 -- (-429.293) (-427.561) [-426.984] (-430.243) * (-429.109) (-430.132) (-428.967) [-428.368] -- 0:00:47
229500 -- [-427.386] (-430.412) (-426.407) (-426.667) * (-428.648) (-427.262) [-428.827] (-428.852) -- 0:00:47
230000 -- (-428.901) (-429.735) (-427.643) [-428.347] * (-427.586) (-425.686) (-428.955) [-427.258] -- 0:00:46
Average standard deviation of split frequencies: 0.015267
230500 -- (-430.390) (-427.477) [-429.783] (-428.263) * [-425.847] (-431.363) (-428.963) (-430.626) -- 0:00:46
231000 -- (-427.331) (-426.500) [-427.888] (-427.346) * (-431.406) (-429.079) (-430.354) [-428.695] -- 0:00:49
231500 -- (-425.923) [-430.333] (-429.961) (-431.571) * (-429.003) (-428.007) [-427.133] (-430.594) -- 0:00:49
232000 -- (-427.036) [-428.867] (-431.204) (-428.856) * (-426.125) (-430.847) (-427.488) [-427.744] -- 0:00:49
232500 -- [-427.956] (-427.526) (-430.844) (-429.040) * (-427.192) [-428.380] (-429.710) (-428.650) -- 0:00:49
233000 -- [-425.854] (-426.565) (-427.856) (-427.464) * (-426.769) (-434.653) (-428.611) [-431.589] -- 0:00:49
233500 -- (-426.920) [-425.337] (-427.725) (-428.744) * (-430.167) (-425.796) [-430.615] (-430.739) -- 0:00:49
234000 -- (-428.903) (-429.494) [-428.720] (-429.493) * (-428.273) (-427.787) (-428.772) [-426.916] -- 0:00:49
234500 -- [-431.119] (-427.277) (-428.898) (-429.885) * (-426.420) (-425.874) [-428.485] (-431.816) -- 0:00:48
235000 -- (-428.836) [-426.797] (-428.662) (-434.525) * (-425.924) (-428.977) [-430.038] (-430.600) -- 0:00:48
Average standard deviation of split frequencies: 0.015745
235500 -- (-431.452) (-426.624) (-428.105) [-431.427] * (-427.571) [-428.383] (-431.504) (-427.897) -- 0:00:48
236000 -- [-428.540] (-426.437) (-430.303) (-428.813) * (-429.057) (-431.529) (-428.046) [-428.636] -- 0:00:48
236500 -- (-431.633) (-427.115) [-431.044] (-435.046) * (-429.108) (-431.549) [-427.447] (-428.459) -- 0:00:48
237000 -- (-428.019) (-428.001) [-429.666] (-432.741) * (-427.727) [-429.150] (-428.982) (-427.679) -- 0:00:48
237500 -- (-429.581) (-429.998) (-430.746) [-427.174] * [-428.324] (-428.406) (-435.474) (-426.873) -- 0:00:48
238000 -- [-429.428] (-425.631) (-427.962) (-429.578) * [-429.073] (-427.622) (-424.691) (-428.466) -- 0:00:48
238500 -- (-429.455) (-428.306) [-428.403] (-432.639) * (-426.502) (-427.999) [-426.761] (-430.884) -- 0:00:47
239000 -- (-429.606) (-427.996) [-429.152] (-425.717) * (-426.885) (-427.041) (-425.932) [-429.349] -- 0:00:47
239500 -- (-426.338) [-427.947] (-434.266) (-426.718) * (-430.829) [-427.747] (-427.203) (-430.036) -- 0:00:47
240000 -- (-426.976) (-430.587) [-428.114] (-427.836) * (-429.083) (-427.854) [-426.699] (-426.638) -- 0:00:47
Average standard deviation of split frequencies: 0.015425
240500 -- (-429.555) (-431.142) (-430.741) [-431.576] * (-427.769) [-429.034] (-431.815) (-427.769) -- 0:00:47
241000 -- (-429.096) (-427.092) (-430.125) [-426.573] * (-428.043) [-429.624] (-428.833) (-426.934) -- 0:00:47
241500 -- (-429.767) (-428.693) (-430.994) [-427.518] * [-429.105] (-428.740) (-425.322) (-427.210) -- 0:00:47
242000 -- (-429.953) (-430.321) [-428.556] (-428.194) * (-427.918) (-431.610) [-424.463] (-429.515) -- 0:00:46
242500 -- [-430.189] (-428.465) (-428.938) (-431.035) * (-434.915) (-427.658) (-428.282) [-428.600] -- 0:00:46
243000 -- [-430.846] (-432.468) (-429.161) (-426.918) * [-433.614] (-428.758) (-428.086) (-426.098) -- 0:00:46
243500 -- (-431.663) (-431.347) (-429.291) [-428.720] * (-426.691) (-430.544) [-425.747] (-426.710) -- 0:00:46
244000 -- (-427.008) (-432.955) (-429.766) [-425.857] * (-427.742) (-427.735) [-429.650] (-429.714) -- 0:00:46
244500 -- [-428.086] (-433.025) (-428.752) (-426.853) * (-428.287) (-431.043) (-425.993) [-427.347] -- 0:00:46
245000 -- [-428.345] (-433.629) (-431.822) (-430.364) * [-427.414] (-429.490) (-425.629) (-427.651) -- 0:00:46
Average standard deviation of split frequencies: 0.016169
245500 -- (-429.601) (-429.784) [-428.242] (-431.960) * [-426.745] (-428.502) (-424.529) (-428.881) -- 0:00:46
246000 -- (-428.066) (-429.208) [-429.834] (-430.165) * (-426.225) (-428.785) [-429.630] (-426.956) -- 0:00:45
246500 -- (-426.679) [-428.154] (-429.550) (-427.251) * (-428.950) [-427.557] (-428.765) (-426.375) -- 0:00:45
247000 -- (-428.518) [-427.862] (-428.048) (-428.765) * (-425.120) [-428.221] (-431.354) (-428.513) -- 0:00:48
247500 -- [-427.334] (-427.693) (-428.746) (-428.488) * (-424.545) [-426.995] (-426.148) (-431.907) -- 0:00:48
248000 -- [-427.591] (-427.576) (-429.064) (-429.180) * (-427.415) [-428.221] (-430.483) (-427.882) -- 0:00:48
248500 -- [-427.885] (-427.753) (-429.361) (-429.360) * (-426.193) (-425.894) (-432.856) [-426.304] -- 0:00:48
249000 -- (-427.776) [-428.474] (-431.201) (-428.006) * (-430.778) (-428.057) [-426.001] (-426.321) -- 0:00:48
249500 -- (-427.609) (-432.332) (-431.108) [-426.286] * (-428.958) (-432.069) (-430.074) [-428.569] -- 0:00:48
250000 -- (-428.767) (-430.902) [-430.352] (-427.581) * [-428.869] (-429.095) (-432.637) (-426.138) -- 0:00:48
Average standard deviation of split frequencies: 0.014692
250500 -- (-427.855) (-428.323) (-430.182) [-426.719] * (-430.544) (-430.727) [-430.587] (-426.726) -- 0:00:47
251000 -- [-426.872] (-427.560) (-429.684) (-429.896) * (-429.833) (-429.412) [-427.644] (-429.320) -- 0:00:47
251500 -- [-426.390] (-427.333) (-430.484) (-430.568) * (-428.767) (-428.391) [-427.489] (-425.978) -- 0:00:47
252000 -- (-427.636) [-426.154] (-429.594) (-429.641) * (-430.886) (-429.655) [-426.773] (-426.267) -- 0:00:47
252500 -- (-429.260) (-428.521) [-429.703] (-427.641) * (-426.088) (-430.406) (-428.072) [-428.928] -- 0:00:47
253000 -- (-431.442) [-426.989] (-428.516) (-428.829) * (-427.670) [-428.253] (-428.014) (-434.982) -- 0:00:47
253500 -- [-430.451] (-432.575) (-429.577) (-428.466) * (-428.409) (-428.725) [-428.298] (-427.202) -- 0:00:47
254000 -- (-428.812) (-429.485) [-430.420] (-427.440) * (-430.169) (-432.033) [-427.950] (-427.049) -- 0:00:46
254500 -- (-429.958) (-429.139) [-430.743] (-428.221) * [-430.588] (-429.999) (-428.198) (-429.342) -- 0:00:46
255000 -- (-431.549) [-430.093] (-429.488) (-428.291) * (-430.226) (-429.010) (-428.215) [-429.390] -- 0:00:46
Average standard deviation of split frequencies: 0.014156
255500 -- (-427.721) (-428.520) [-430.585] (-429.808) * (-429.997) [-431.235] (-429.184) (-427.992) -- 0:00:46
256000 -- (-428.848) [-426.483] (-428.537) (-431.116) * [-428.899] (-430.732) (-428.625) (-431.775) -- 0:00:46
256500 -- [-427.033] (-428.380) (-428.640) (-426.999) * (-430.738) [-430.550] (-430.366) (-429.900) -- 0:00:46
257000 -- (-427.908) (-427.314) (-430.756) [-428.009] * (-432.507) [-429.053] (-428.663) (-428.176) -- 0:00:46
257500 -- (-429.364) (-430.157) [-430.333] (-427.902) * (-428.710) (-428.402) (-426.105) [-431.712] -- 0:00:46
258000 -- [-430.485] (-430.493) (-429.758) (-427.537) * [-429.840] (-428.983) (-426.511) (-428.669) -- 0:00:46
258500 -- (-429.012) [-429.754] (-426.865) (-428.704) * [-429.176] (-430.393) (-429.268) (-427.258) -- 0:00:45
259000 -- [-428.589] (-429.917) (-428.000) (-429.385) * (-429.806) (-430.213) (-426.238) [-428.974] -- 0:00:45
259500 -- [-429.657] (-426.053) (-430.662) (-432.739) * (-427.037) (-428.069) (-426.113) [-426.020] -- 0:00:45
260000 -- (-431.350) [-428.025] (-431.791) (-426.668) * (-427.464) (-427.030) [-426.134] (-427.815) -- 0:00:45
Average standard deviation of split frequencies: 0.014129
260500 -- (-430.964) (-427.612) [-431.797] (-431.708) * (-429.158) (-427.320) (-428.450) [-435.314] -- 0:00:45
261000 -- [-429.294] (-429.924) (-430.394) (-429.560) * [-427.490] (-430.863) (-427.294) (-431.017) -- 0:00:45
261500 -- [-429.236] (-427.580) (-426.302) (-426.203) * (-429.101) (-430.787) (-429.921) [-427.384] -- 0:00:45
262000 -- (-429.676) (-428.239) [-431.346] (-428.569) * [-429.025] (-431.945) (-427.458) (-428.408) -- 0:00:45
262500 -- [-429.799] (-428.073) (-429.227) (-433.704) * (-426.859) [-427.344] (-428.819) (-428.051) -- 0:00:47
263000 -- [-430.011] (-428.337) (-428.351) (-429.271) * [-429.843] (-425.609) (-428.174) (-427.315) -- 0:00:47
263500 -- [-429.505] (-430.156) (-428.452) (-426.871) * (-429.709) (-427.696) (-433.942) [-428.770] -- 0:00:47
264000 -- (-429.021) (-428.426) [-428.242] (-426.009) * (-428.060) (-429.850) [-429.084] (-427.864) -- 0:00:47
264500 -- [-431.226] (-430.962) (-428.744) (-427.601) * (-429.314) [-428.482] (-427.797) (-427.544) -- 0:00:47
265000 -- (-431.509) (-426.614) [-425.703] (-427.989) * (-431.524) (-426.576) [-428.480] (-431.866) -- 0:00:47
Average standard deviation of split frequencies: 0.014510
265500 -- (-428.776) [-426.034] (-427.460) (-426.389) * [-427.761] (-427.133) (-427.520) (-431.991) -- 0:00:47
266000 -- (-431.664) (-426.326) [-427.105] (-426.887) * (-427.692) [-426.774] (-427.367) (-435.903) -- 0:00:46
266500 -- (-430.709) (-425.577) [-427.361] (-427.450) * [-427.159] (-428.108) (-428.828) (-432.124) -- 0:00:46
267000 -- [-430.263] (-428.091) (-426.705) (-427.037) * [-429.592] (-430.218) (-428.312) (-430.148) -- 0:00:46
267500 -- (-430.298) (-428.268) [-429.602] (-428.106) * [-426.351] (-428.015) (-429.684) (-429.433) -- 0:00:46
268000 -- (-431.131) [-431.243] (-425.581) (-428.540) * [-427.048] (-428.020) (-428.069) (-428.526) -- 0:00:46
268500 -- (-430.024) (-432.440) (-428.401) [-429.034] * [-428.748] (-428.828) (-427.091) (-429.714) -- 0:00:46
269000 -- [-428.160] (-431.063) (-431.425) (-428.622) * (-430.157) (-426.828) (-427.333) [-427.141] -- 0:00:46
269500 -- (-430.525) (-428.901) (-427.973) [-426.566] * (-428.732) [-427.028] (-426.945) (-427.617) -- 0:00:46
270000 -- (-428.788) (-426.296) (-429.241) [-427.190] * (-430.194) [-427.096] (-429.106) (-427.515) -- 0:00:45
Average standard deviation of split frequencies: 0.014369
270500 -- (-429.621) (-427.209) (-428.015) [-425.897] * (-428.475) [-428.073] (-428.517) (-427.863) -- 0:00:45
271000 -- (-430.026) [-426.862] (-426.445) (-426.095) * (-431.835) [-428.193] (-427.977) (-429.906) -- 0:00:45
271500 -- (-430.940) (-429.769) [-427.455] (-427.490) * (-429.716) (-430.169) [-426.405] (-431.660) -- 0:00:45
272000 -- [-430.936] (-429.818) (-429.263) (-429.041) * [-428.601] (-428.755) (-429.599) (-425.609) -- 0:00:45
272500 -- [-429.412] (-429.636) (-427.693) (-429.895) * [-430.009] (-427.874) (-429.024) (-430.682) -- 0:00:45
273000 -- [-428.126] (-427.666) (-433.519) (-429.307) * [-431.303] (-427.865) (-427.132) (-430.135) -- 0:00:45
273500 -- (-428.913) [-428.302] (-433.289) (-429.108) * (-434.280) (-431.023) [-429.446] (-428.152) -- 0:00:45
274000 -- (-429.216) (-429.806) [-425.952] (-429.613) * (-440.729) [-426.871] (-426.957) (-428.818) -- 0:00:45
274500 -- (-428.739) (-431.518) [-429.263] (-427.700) * (-432.300) [-427.124] (-426.671) (-434.145) -- 0:00:44
275000 -- (-428.947) (-429.443) (-428.301) [-431.659] * (-429.891) (-431.621) [-426.096] (-429.062) -- 0:00:44
Average standard deviation of split frequencies: 0.014625
275500 -- [-430.206] (-430.598) (-427.838) (-433.585) * (-429.423) (-430.747) [-426.616] (-433.369) -- 0:00:44
276000 -- [-430.890] (-430.950) (-428.509) (-430.864) * (-430.615) (-429.705) [-426.311] (-430.102) -- 0:00:44
276500 -- (-429.572) (-432.601) [-427.474] (-431.639) * (-428.274) [-430.102] (-427.442) (-429.536) -- 0:00:44
277000 -- (-429.191) (-429.171) (-434.286) [-431.297] * [-430.252] (-430.054) (-430.914) (-427.229) -- 0:00:44
277500 -- [-426.822] (-427.823) (-428.443) (-429.691) * (-431.871) (-428.614) (-427.809) [-427.685] -- 0:00:44
278000 -- (-427.385) (-429.420) [-428.829] (-428.592) * (-426.791) (-427.857) (-426.016) [-426.262] -- 0:00:44
278500 -- (-428.770) (-429.200) [-428.555] (-428.608) * (-428.915) (-430.363) [-431.083] (-427.606) -- 0:00:46
279000 -- (-426.690) (-428.656) [-430.373] (-428.668) * (-426.775) [-429.210] (-429.219) (-428.926) -- 0:00:46
279500 -- (-431.108) (-430.037) [-425.873] (-429.379) * (-425.306) [-429.685] (-426.019) (-430.710) -- 0:00:46
280000 -- (-430.555) (-431.128) (-432.437) [-426.899] * (-437.000) [-426.073] (-426.503) (-426.160) -- 0:00:46
Average standard deviation of split frequencies: 0.013542
280500 -- [-426.938] (-429.489) (-428.444) (-429.513) * (-427.436) (-429.863) [-429.035] (-429.025) -- 0:00:46
281000 -- (-429.422) (-428.928) [-430.093] (-426.208) * (-428.672) [-433.829] (-428.372) (-428.944) -- 0:00:46
281500 -- (-425.528) (-430.139) (-426.251) [-425.820] * [-427.325] (-431.807) (-427.423) (-428.910) -- 0:00:45
282000 -- (-427.831) [-429.375] (-429.251) (-425.810) * (-425.520) (-429.704) (-428.932) [-427.767] -- 0:00:45
282500 -- (-426.601) (-426.804) (-432.306) [-425.811] * (-426.987) (-426.329) [-427.974] (-428.328) -- 0:00:45
283000 -- [-428.689] (-430.666) (-427.853) (-427.033) * (-427.106) (-425.746) (-427.552) [-432.283] -- 0:00:45
283500 -- [-427.929] (-429.968) (-429.501) (-427.354) * (-425.579) (-427.105) (-425.644) [-429.959] -- 0:00:45
284000 -- (-427.113) [-429.288] (-426.307) (-427.622) * (-429.556) (-431.716) [-425.829] (-430.243) -- 0:00:45
284500 -- (-427.323) (-432.286) (-428.209) [-428.475] * (-427.913) (-429.125) [-425.290] (-429.525) -- 0:00:45
285000 -- (-427.556) (-430.181) (-431.013) [-429.025] * (-428.916) [-428.651] (-426.572) (-429.620) -- 0:00:45
Average standard deviation of split frequencies: 0.012023
285500 -- [-427.434] (-429.507) (-427.671) (-429.505) * (-427.529) [-427.996] (-428.923) (-429.750) -- 0:00:45
286000 -- (-427.659) [-429.250] (-429.073) (-425.377) * (-431.193) (-430.548) [-432.061] (-429.302) -- 0:00:44
286500 -- (-429.214) [-427.911] (-429.577) (-426.434) * [-426.663] (-428.012) (-427.126) (-428.983) -- 0:00:44
287000 -- (-428.199) [-433.506] (-427.312) (-425.478) * (-429.135) (-427.381) [-429.341] (-428.419) -- 0:00:44
287500 -- (-428.818) [-429.178] (-428.260) (-428.071) * [-426.897] (-427.779) (-427.576) (-428.305) -- 0:00:44
288000 -- (-429.264) (-429.458) (-429.129) [-426.563] * (-430.635) (-432.649) [-426.779] (-426.811) -- 0:00:44
288500 -- (-426.553) (-430.296) (-426.304) [-426.863] * (-429.111) (-430.068) (-427.077) [-426.819] -- 0:00:44
289000 -- [-430.135] (-431.744) (-430.498) (-431.154) * [-427.488] (-430.779) (-436.910) (-429.260) -- 0:00:44
289500 -- (-428.135) (-428.170) [-427.654] (-434.105) * (-425.592) (-430.635) (-433.094) [-431.101] -- 0:00:44
290000 -- (-430.782) [-429.476] (-428.226) (-431.446) * (-428.898) (-429.337) (-430.693) [-428.067] -- 0:00:44
Average standard deviation of split frequencies: 0.011657
290500 -- (-426.060) [-431.623] (-428.900) (-431.508) * (-427.468) [-428.762] (-428.647) (-427.676) -- 0:00:43
291000 -- (-427.658) (-428.167) [-434.679] (-428.585) * [-429.237] (-428.474) (-428.778) (-430.291) -- 0:00:43
291500 -- [-429.036] (-427.658) (-431.613) (-427.976) * (-430.279) (-427.734) [-426.507] (-428.240) -- 0:00:43
292000 -- (-427.069) [-425.807] (-431.171) (-431.835) * [-429.882] (-427.563) (-425.843) (-429.575) -- 0:00:43
292500 -- (-426.714) (-429.135) (-430.645) [-429.216] * (-426.724) [-429.107] (-427.160) (-428.280) -- 0:00:43
293000 -- (-426.115) (-430.670) [-426.074] (-427.713) * [-426.227] (-428.799) (-431.330) (-428.716) -- 0:00:43
293500 -- (-427.701) (-427.528) (-426.495) [-427.418] * [-426.809] (-427.978) (-427.649) (-431.517) -- 0:00:43
294000 -- (-428.047) (-437.033) [-427.261] (-427.067) * (-426.620) (-429.452) [-427.915] (-427.412) -- 0:00:45
294500 -- (-427.560) [-427.495] (-430.677) (-426.516) * (-426.522) (-428.243) [-426.655] (-426.947) -- 0:00:45
295000 -- [-427.903] (-427.363) (-430.008) (-428.302) * (-427.857) (-431.261) [-427.855] (-430.409) -- 0:00:45
Average standard deviation of split frequencies: 0.011467
295500 -- (-430.205) (-428.379) (-433.632) [-428.354] * (-430.057) (-428.030) (-426.054) [-427.463] -- 0:00:45
296000 -- (-435.716) (-428.276) (-427.514) [-427.621] * (-427.081) (-430.300) [-425.686] (-428.831) -- 0:00:45
296500 -- (-429.399) (-426.500) [-427.356] (-429.390) * (-429.381) [-426.425] (-425.715) (-428.780) -- 0:00:45
297000 -- (-429.716) (-426.543) [-427.959] (-427.722) * (-436.777) (-426.940) [-425.173] (-427.359) -- 0:00:44
297500 -- (-426.509) (-429.263) [-427.084] (-426.574) * (-430.048) (-429.731) (-425.215) [-425.807] -- 0:00:44
298000 -- [-426.714] (-425.723) (-430.413) (-426.963) * (-428.652) (-428.819) [-428.295] (-428.726) -- 0:00:44
298500 -- (-427.477) (-429.050) [-429.242] (-430.275) * (-430.472) (-429.030) (-428.079) [-425.822] -- 0:00:44
299000 -- (-428.191) (-427.074) [-427.781] (-430.364) * (-429.287) (-428.322) [-428.725] (-431.273) -- 0:00:44
299500 -- [-427.794] (-430.627) (-429.840) (-431.876) * (-433.449) (-429.359) [-425.396] (-430.406) -- 0:00:44
300000 -- [-427.659] (-427.143) (-427.800) (-429.406) * (-428.099) [-430.060] (-433.134) (-429.602) -- 0:00:44
Average standard deviation of split frequencies: 0.011073
300500 -- (-428.386) (-433.566) [-427.117] (-427.031) * (-426.044) (-427.829) (-427.471) [-427.824] -- 0:00:44
301000 -- (-427.379) (-434.224) [-429.959] (-434.658) * (-428.346) [-426.241] (-430.924) (-429.384) -- 0:00:44
301500 -- (-429.212) (-430.391) [-426.319] (-427.228) * (-425.527) (-425.652) (-429.855) [-428.209] -- 0:00:44
302000 -- (-431.005) (-429.265) [-429.466] (-429.097) * [-427.881] (-427.953) (-427.085) (-430.548) -- 0:00:43
302500 -- (-428.428) (-430.750) (-427.517) [-427.398] * (-429.841) (-429.710) (-433.374) [-427.952] -- 0:00:43
303000 -- (-427.753) (-427.136) [-427.000] (-426.140) * [-428.647] (-428.927) (-427.841) (-429.939) -- 0:00:43
303500 -- (-430.820) (-431.212) [-428.182] (-429.371) * (-431.278) [-429.820] (-426.220) (-428.995) -- 0:00:43
304000 -- (-430.410) [-429.114] (-427.487) (-426.832) * (-428.078) [-429.674] (-425.873) (-430.806) -- 0:00:43
304500 -- (-427.163) (-433.733) (-425.377) [-427.056] * (-427.173) (-430.611) (-426.798) [-429.767] -- 0:00:43
305000 -- (-425.358) [-426.155] (-432.242) (-430.454) * [-425.481] (-427.571) (-429.020) (-429.618) -- 0:00:43
Average standard deviation of split frequencies: 0.011073
305500 -- (-427.839) [-428.461] (-427.907) (-432.688) * [-426.212] (-428.032) (-430.194) (-430.787) -- 0:00:43
306000 -- (-425.940) [-427.457] (-426.802) (-425.468) * (-430.022) [-426.555] (-426.629) (-431.076) -- 0:00:43
306500 -- (-429.205) (-429.370) (-431.908) [-430.487] * (-428.416) (-428.474) (-425.649) [-431.198] -- 0:00:42
307000 -- (-425.652) (-431.745) (-429.100) [-427.318] * [-430.641] (-429.907) (-426.788) (-431.505) -- 0:00:42
307500 -- (-428.530) (-433.209) [-427.508] (-426.620) * (-431.631) (-431.968) [-427.544] (-430.185) -- 0:00:42
308000 -- (-426.137) (-428.648) [-428.739] (-431.351) * (-432.980) (-428.349) [-427.356] (-428.565) -- 0:00:42
308500 -- [-428.394] (-427.215) (-427.352) (-426.180) * (-431.136) (-428.903) (-428.060) [-427.034] -- 0:00:42
309000 -- (-427.810) (-430.133) (-427.798) [-427.852] * (-428.733) (-428.075) [-426.914] (-427.867) -- 0:00:42
309500 -- (-430.115) [-432.146] (-429.148) (-428.605) * (-428.476) (-433.067) [-428.261] (-429.833) -- 0:00:42
310000 -- (-427.223) (-431.531) (-427.236) [-428.640] * [-426.776] (-428.381) (-428.772) (-428.885) -- 0:00:44
Average standard deviation of split frequencies: 0.011068
310500 -- (-427.930) (-428.500) [-427.914] (-433.223) * (-427.034) [-429.541] (-426.885) (-429.449) -- 0:00:44
311000 -- (-427.736) (-430.565) [-427.208] (-427.850) * (-430.080) (-427.361) [-425.120] (-427.705) -- 0:00:44
311500 -- [-426.934] (-429.429) (-427.238) (-428.238) * (-430.644) (-428.889) (-427.207) [-429.967] -- 0:00:44
312000 -- (-430.109) (-429.423) [-428.438] (-427.797) * (-429.661) [-426.963] (-428.706) (-425.595) -- 0:00:44
312500 -- (-426.043) (-430.136) (-429.648) [-428.400] * [-427.522] (-428.983) (-427.707) (-434.151) -- 0:00:44
313000 -- (-426.637) (-429.464) [-426.681] (-426.291) * (-429.383) (-427.669) [-425.872] (-431.903) -- 0:00:43
313500 -- [-429.970] (-430.178) (-433.289) (-426.327) * [-425.236] (-427.566) (-426.565) (-426.304) -- 0:00:43
314000 -- [-427.105] (-431.389) (-429.701) (-427.322) * [-429.614] (-429.110) (-428.113) (-432.495) -- 0:00:43
314500 -- (-428.594) (-429.907) [-426.055] (-431.953) * (-425.936) (-430.261) (-427.463) [-426.871] -- 0:00:43
315000 -- (-429.052) [-432.164] (-427.867) (-428.913) * [-430.671] (-428.531) (-426.471) (-428.794) -- 0:00:43
Average standard deviation of split frequencies: 0.010256
315500 -- (-427.548) (-432.742) (-432.298) [-429.298] * (-432.849) (-429.357) [-425.884] (-426.897) -- 0:00:43
316000 -- (-426.362) (-429.227) (-428.854) [-434.567] * [-427.631] (-429.158) (-425.870) (-425.573) -- 0:00:43
316500 -- [-426.817] (-430.604) (-428.894) (-429.042) * (-426.722) [-428.562] (-427.242) (-426.986) -- 0:00:43
317000 -- (-428.143) (-430.553) [-427.976] (-430.103) * (-430.950) (-428.642) (-427.446) [-425.949] -- 0:00:43
317500 -- (-427.334) (-428.639) [-427.673] (-429.920) * (-429.807) [-429.964] (-429.001) (-426.379) -- 0:00:42
318000 -- [-428.573] (-429.038) (-425.976) (-430.141) * (-430.652) (-431.232) (-428.214) [-430.230] -- 0:00:42
318500 -- (-429.063) (-430.460) [-427.247] (-439.765) * (-429.416) (-432.138) [-428.306] (-430.818) -- 0:00:42
319000 -- (-427.847) (-428.551) [-429.135] (-430.731) * (-426.012) [-432.566] (-428.844) (-431.266) -- 0:00:42
319500 -- [-427.370] (-428.501) (-430.811) (-427.238) * (-425.824) [-427.688] (-427.794) (-427.411) -- 0:00:42
320000 -- (-432.175) (-428.190) (-426.475) [-427.214] * [-430.441] (-430.633) (-427.608) (-429.631) -- 0:00:42
Average standard deviation of split frequencies: 0.009004
320500 -- (-431.062) [-427.836] (-430.263) (-431.651) * (-428.139) (-427.154) (-436.046) [-424.901] -- 0:00:42
321000 -- (-426.635) [-432.848] (-433.798) (-427.937) * (-426.818) (-425.973) [-426.014] (-425.841) -- 0:00:42
321500 -- (-428.607) (-428.582) [-426.256] (-431.454) * (-426.523) (-427.766) (-428.372) [-425.602] -- 0:00:42
322000 -- [-427.594] (-426.160) (-429.892) (-427.014) * (-428.299) [-427.459] (-429.947) (-431.506) -- 0:00:42
322500 -- (-431.444) [-428.844] (-425.940) (-426.612) * [-426.340] (-426.857) (-426.312) (-429.088) -- 0:00:42
323000 -- [-427.185] (-426.330) (-429.129) (-427.366) * [-427.675] (-426.869) (-430.338) (-427.580) -- 0:00:41
323500 -- [-427.785] (-432.091) (-426.434) (-430.349) * [-432.928] (-426.668) (-433.097) (-431.686) -- 0:00:41
324000 -- [-426.535] (-433.220) (-429.022) (-432.040) * (-430.806) (-430.094) (-428.782) [-428.740] -- 0:00:41
324500 -- (-428.082) [-428.065] (-424.997) (-428.484) * (-428.375) [-427.664] (-427.680) (-424.962) -- 0:00:41
325000 -- (-427.784) [-432.112] (-425.623) (-428.263) * (-431.036) (-430.135) [-428.174] (-425.683) -- 0:00:41
Average standard deviation of split frequencies: 0.009038
325500 -- (-427.329) (-427.924) (-434.263) [-426.917] * (-427.649) (-429.540) [-425.272] (-427.133) -- 0:00:43
326000 -- (-428.083) (-427.907) [-431.855] (-429.220) * (-431.718) [-427.424] (-428.261) (-429.296) -- 0:00:43
326500 -- [-426.353] (-429.914) (-430.120) (-429.541) * (-432.346) [-425.987] (-427.105) (-430.034) -- 0:00:43
327000 -- (-428.528) (-428.303) (-426.876) [-427.096] * (-428.953) [-429.663] (-429.850) (-428.308) -- 0:00:43
327500 -- (-429.639) [-425.234] (-428.286) (-429.968) * (-429.344) (-425.364) [-426.323] (-429.065) -- 0:00:43
328000 -- (-429.575) (-427.938) [-425.350] (-427.459) * (-428.227) (-426.551) [-429.797] (-426.605) -- 0:00:43
328500 -- (-429.289) (-426.578) (-430.450) [-427.402] * (-429.156) (-429.136) [-425.693] (-427.043) -- 0:00:42
329000 -- (-428.803) (-429.028) (-425.671) [-428.968] * (-428.136) (-435.865) (-426.783) [-426.908] -- 0:00:42
329500 -- [-424.673] (-431.883) (-426.678) (-430.205) * (-429.762) (-433.697) (-429.105) [-429.215] -- 0:00:42
330000 -- (-426.380) (-425.613) (-429.646) [-427.873] * (-430.978) (-427.943) [-427.768] (-431.208) -- 0:00:42
Average standard deviation of split frequencies: 0.010692
330500 -- (-427.915) (-427.491) [-428.431] (-428.216) * (-428.915) (-427.469) [-428.972] (-428.576) -- 0:00:42
331000 -- [-431.088] (-428.804) (-433.614) (-429.952) * (-428.989) (-428.915) (-430.775) [-426.023] -- 0:00:42
331500 -- (-427.234) (-430.831) (-428.263) [-427.968] * (-426.047) (-426.797) (-429.727) [-427.528] -- 0:00:42
332000 -- (-429.217) (-433.629) [-426.813] (-428.319) * [-429.561] (-428.725) (-431.169) (-428.041) -- 0:00:42
332500 -- (-425.810) (-428.052) (-429.241) [-428.132] * [-429.619] (-426.995) (-428.705) (-427.840) -- 0:00:42
333000 -- [-427.146] (-425.716) (-428.911) (-428.834) * (-428.292) (-428.664) [-429.242] (-428.196) -- 0:00:42
333500 -- (-434.083) (-427.309) (-426.953) [-426.215] * (-429.141) [-427.476] (-430.077) (-426.573) -- 0:00:41
334000 -- (-427.736) (-425.966) [-425.695] (-424.738) * (-429.190) (-428.622) [-429.323] (-425.635) -- 0:00:41
334500 -- (-430.000) (-425.995) (-430.121) [-426.701] * (-431.062) [-430.196] (-429.140) (-426.894) -- 0:00:41
335000 -- (-427.419) [-427.496] (-426.331) (-425.098) * (-430.561) (-431.250) [-428.887] (-427.514) -- 0:00:41
Average standard deviation of split frequencies: 0.010785
335500 -- (-429.228) (-427.464) (-428.864) [-426.674] * (-430.578) (-430.715) (-429.543) [-426.958] -- 0:00:41
336000 -- [-430.451] (-429.850) (-426.849) (-426.447) * (-427.984) (-429.103) (-428.459) [-429.873] -- 0:00:41
336500 -- [-428.729] (-428.780) (-427.889) (-427.799) * (-428.457) [-427.450] (-427.964) (-428.311) -- 0:00:41
337000 -- (-426.352) (-426.773) (-427.288) [-428.797] * (-428.060) (-427.430) [-429.803] (-428.649) -- 0:00:41
337500 -- [-429.551] (-425.269) (-430.976) (-431.467) * (-428.951) [-431.869] (-430.357) (-430.540) -- 0:00:41
338000 -- (-428.387) (-425.157) (-429.877) [-431.937] * (-427.485) (-428.214) (-430.152) [-430.062] -- 0:00:41
338500 -- (-428.717) (-427.105) (-427.117) [-432.243] * (-426.934) (-430.440) [-429.657] (-430.593) -- 0:00:41
339000 -- (-425.120) (-427.499) [-428.802] (-426.155) * (-428.940) (-425.770) (-426.832) [-426.340] -- 0:00:40
339500 -- (-428.044) (-428.706) [-426.190] (-434.293) * [-426.648] (-430.005) (-430.519) (-428.760) -- 0:00:40
340000 -- (-426.722) (-428.083) [-427.505] (-429.052) * [-426.158] (-430.759) (-430.757) (-428.553) -- 0:00:40
Average standard deviation of split frequencies: 0.010205
340500 -- [-428.717] (-426.442) (-429.832) (-429.645) * [-428.753] (-429.062) (-427.498) (-427.596) -- 0:00:40
341000 -- [-430.964] (-425.499) (-429.270) (-428.303) * (-428.537) [-431.412] (-429.605) (-428.420) -- 0:00:40
341500 -- (-435.026) [-428.071] (-429.935) (-430.077) * (-426.659) (-428.805) (-428.114) [-427.017] -- 0:00:42
342000 -- [-429.400] (-426.939) (-427.014) (-426.950) * [-427.253] (-429.117) (-428.930) (-428.983) -- 0:00:42
342500 -- (-430.932) (-429.391) (-428.347) [-428.822] * [-429.766] (-428.381) (-429.538) (-429.516) -- 0:00:42
343000 -- (-430.573) (-428.343) (-429.410) [-431.328] * [-428.462] (-429.968) (-431.690) (-427.744) -- 0:00:42
343500 -- (-433.429) (-426.684) (-427.237) [-426.972] * (-430.464) (-428.888) [-428.949] (-431.676) -- 0:00:42
344000 -- (-428.894) (-426.187) (-429.092) [-427.400] * (-431.630) (-429.218) [-428.600] (-428.408) -- 0:00:41
344500 -- (-433.479) [-427.681] (-430.216) (-432.066) * (-435.288) (-427.494) (-428.207) [-429.984] -- 0:00:41
345000 -- (-432.266) (-426.576) (-429.981) [-431.332] * (-431.928) [-427.381] (-428.085) (-426.228) -- 0:00:41
Average standard deviation of split frequencies: 0.008896
345500 -- [-429.272] (-425.596) (-429.732) (-427.886) * (-429.366) [-429.116] (-428.303) (-425.261) -- 0:00:41
346000 -- (-429.925) (-426.730) [-427.111] (-426.895) * [-429.342] (-431.168) (-428.971) (-428.050) -- 0:00:41
346500 -- (-425.864) (-426.833) [-428.660] (-427.775) * [-428.168] (-430.782) (-429.399) (-429.724) -- 0:00:41
347000 -- (-428.632) [-425.382] (-432.361) (-426.575) * (-431.194) [-430.267] (-429.462) (-429.358) -- 0:00:41
347500 -- (-429.874) (-429.175) [-428.657] (-428.131) * (-430.439) (-434.878) (-433.072) [-429.786] -- 0:00:41
348000 -- [-432.574] (-426.340) (-428.372) (-429.133) * [-429.454] (-434.282) (-431.805) (-428.799) -- 0:00:41
348500 -- [-427.284] (-429.160) (-427.538) (-427.165) * (-429.560) (-432.562) [-428.674] (-427.332) -- 0:00:41
349000 -- (-432.214) [-427.982] (-431.014) (-430.953) * [-429.577] (-432.931) (-432.497) (-429.032) -- 0:00:41
349500 -- (-429.165) (-427.365) (-431.308) [-430.240] * (-431.983) (-431.034) (-431.537) [-427.511] -- 0:00:40
350000 -- (-430.825) (-430.872) (-426.868) [-429.577] * (-432.781) (-430.583) (-431.065) [-428.292] -- 0:00:40
Average standard deviation of split frequencies: 0.008654
350500 -- (-429.561) (-426.949) [-429.232] (-431.523) * (-432.259) [-429.785] (-431.076) (-427.827) -- 0:00:40
351000 -- [-426.690] (-427.881) (-429.122) (-425.562) * [-427.626] (-426.531) (-429.589) (-428.191) -- 0:00:40
351500 -- (-426.722) (-428.474) [-428.520] (-431.555) * (-427.558) [-428.696] (-428.043) (-427.284) -- 0:00:40
352000 -- (-428.949) [-432.116] (-430.721) (-432.841) * [-428.741] (-429.609) (-430.846) (-425.776) -- 0:00:40
352500 -- (-429.745) (-427.720) (-428.636) [-427.177] * (-432.158) [-427.591] (-428.433) (-428.166) -- 0:00:40
353000 -- (-429.948) (-427.562) (-425.892) [-427.854] * [-427.977] (-429.800) (-429.640) (-430.829) -- 0:00:40
353500 -- (-430.194) [-426.656] (-433.878) (-427.069) * (-433.482) (-428.760) (-427.510) [-431.719] -- 0:00:40
354000 -- (-432.653) [-427.710] (-429.866) (-429.203) * (-427.573) (-429.763) [-428.501] (-431.107) -- 0:00:40
354500 -- (-430.225) (-426.356) (-427.809) [-425.611] * (-427.683) (-428.515) [-429.014] (-428.379) -- 0:00:40
355000 -- (-430.556) [-425.149] (-428.821) (-425.878) * (-428.876) (-429.273) (-431.534) [-430.735] -- 0:00:39
Average standard deviation of split frequencies: 0.008276
355500 -- (-430.715) [-425.938] (-429.697) (-427.626) * (-427.985) [-428.466] (-429.917) (-430.425) -- 0:00:39
356000 -- (-428.669) [-425.577] (-426.561) (-429.307) * (-426.200) (-429.652) (-430.202) [-431.893] -- 0:00:39
356500 -- (-428.060) [-428.253] (-427.477) (-430.862) * [-428.508] (-428.630) (-430.113) (-428.590) -- 0:00:39
357000 -- [-432.136] (-426.259) (-426.878) (-427.213) * (-425.812) (-428.288) [-429.002] (-431.580) -- 0:00:41
357500 -- (-435.295) (-429.011) (-427.229) [-426.960] * (-426.992) (-428.651) (-428.485) [-433.787] -- 0:00:41
358000 -- (-431.286) (-427.669) (-427.519) [-429.059] * (-429.968) [-428.688] (-429.343) (-429.870) -- 0:00:41
358500 -- (-428.556) (-428.795) (-428.623) [-429.380] * [-427.879] (-429.681) (-429.177) (-428.913) -- 0:00:41
359000 -- (-428.665) (-431.107) [-427.580] (-428.482) * (-430.442) (-426.147) [-426.400] (-428.582) -- 0:00:41
359500 -- (-432.233) [-427.712] (-426.552) (-427.298) * (-429.647) (-428.824) [-430.359] (-425.759) -- 0:00:40
360000 -- (-430.460) (-428.197) [-427.122] (-430.618) * (-427.791) [-431.310] (-427.529) (-426.265) -- 0:00:40
Average standard deviation of split frequencies: 0.008006
360500 -- (-430.510) [-428.385] (-430.409) (-437.033) * (-428.581) (-428.022) [-425.608] (-426.332) -- 0:00:40
361000 -- (-426.517) (-426.659) [-428.720] (-429.376) * (-431.235) [-427.737] (-428.046) (-427.388) -- 0:00:40
361500 -- (-428.658) (-429.307) (-431.388) [-428.609] * (-429.369) [-429.667] (-425.190) (-433.515) -- 0:00:40
362000 -- (-430.743) (-426.983) (-433.960) [-430.944] * [-429.465] (-430.091) (-429.684) (-430.630) -- 0:00:40
362500 -- [-426.643] (-428.069) (-428.861) (-428.235) * [-430.339] (-432.215) (-427.449) (-430.411) -- 0:00:40
363000 -- (-427.920) (-426.391) [-429.424] (-429.274) * (-428.455) (-435.450) [-426.308] (-428.042) -- 0:00:40
363500 -- (-430.313) (-426.340) [-425.852] (-425.791) * (-426.960) (-428.716) [-426.257] (-430.308) -- 0:00:40
364000 -- (-427.613) (-428.033) (-426.509) [-427.414] * (-429.035) (-429.215) (-426.862) [-428.849] -- 0:00:40
364500 -- (-428.893) [-427.424] (-426.495) (-429.490) * (-426.802) (-426.801) [-427.085] (-428.550) -- 0:00:40
365000 -- (-429.782) (-433.518) [-428.216] (-429.794) * (-428.317) [-428.643] (-427.928) (-429.526) -- 0:00:40
Average standard deviation of split frequencies: 0.007084
365500 -- (-429.017) (-428.386) [-431.354] (-428.612) * [-426.135] (-430.127) (-428.258) (-428.545) -- 0:00:39
366000 -- (-428.135) (-427.115) [-427.816] (-429.228) * (-427.955) (-434.809) (-426.444) [-428.257] -- 0:00:39
366500 -- (-427.212) (-428.194) [-424.871] (-428.519) * [-426.067] (-429.452) (-428.107) (-425.802) -- 0:00:39
367000 -- (-428.487) [-427.011] (-426.950) (-427.646) * (-427.545) (-431.555) [-427.566] (-429.076) -- 0:00:39
367500 -- (-429.402) (-426.709) (-431.940) [-425.718] * (-428.711) (-435.255) [-428.667] (-427.814) -- 0:00:39
368000 -- (-427.234) (-428.324) (-426.477) [-427.620] * (-424.537) (-428.194) [-427.519] (-429.436) -- 0:00:39
368500 -- [-427.134] (-430.400) (-427.501) (-427.856) * [-426.367] (-428.650) (-430.242) (-427.923) -- 0:00:39
369000 -- (-429.626) (-427.251) [-424.532] (-427.547) * (-430.587) [-433.526] (-433.472) (-428.279) -- 0:00:39
369500 -- [-426.760] (-434.903) (-424.841) (-428.198) * (-437.173) (-429.098) [-426.157] (-433.380) -- 0:00:39
370000 -- (-429.558) (-436.266) (-425.558) [-425.366] * (-430.943) [-427.335] (-425.926) (-433.175) -- 0:00:39
Average standard deviation of split frequencies: 0.005405
370500 -- (-432.294) (-430.319) (-426.387) [-426.502] * (-428.778) (-428.957) [-428.956] (-435.003) -- 0:00:39
371000 -- (-428.322) (-428.061) (-426.685) [-425.905] * [-430.567] (-429.805) (-431.705) (-429.080) -- 0:00:38
371500 -- (-425.916) [-429.238] (-430.112) (-426.077) * (-430.853) [-424.986] (-427.387) (-428.629) -- 0:00:38
372000 -- (-427.308) (-428.190) (-426.305) [-430.417] * (-429.245) (-432.067) [-427.965] (-428.516) -- 0:00:38
372500 -- (-429.534) (-429.686) (-428.516) [-427.127] * (-429.972) (-428.322) (-427.081) [-427.366] -- 0:00:38
373000 -- (-428.815) (-427.662) [-430.260] (-436.243) * (-428.518) [-427.885] (-428.013) (-428.147) -- 0:00:40
373500 -- (-426.754) (-428.048) (-433.324) [-429.126] * (-428.838) [-426.918] (-427.744) (-426.935) -- 0:00:40
374000 -- (-424.992) (-426.283) (-430.366) [-428.688] * (-426.586) (-429.288) [-427.694] (-431.273) -- 0:00:40
374500 -- [-429.943] (-427.245) (-431.851) (-428.522) * [-427.785] (-429.431) (-424.574) (-433.958) -- 0:00:40
375000 -- (-427.601) (-427.744) (-430.665) [-430.695] * (-428.130) (-428.731) (-426.119) [-428.154] -- 0:00:40
Average standard deviation of split frequencies: 0.005563
375500 -- (-427.773) [-427.250] (-427.709) (-426.987) * (-429.143) (-426.005) [-430.166] (-428.722) -- 0:00:39
376000 -- [-426.467] (-427.724) (-429.517) (-432.196) * (-428.619) [-426.290] (-427.763) (-431.760) -- 0:00:39
376500 -- (-428.718) (-425.369) (-425.868) [-429.344] * [-427.971] (-429.018) (-426.252) (-428.333) -- 0:00:39
377000 -- (-428.093) [-426.592] (-431.006) (-427.913) * [-426.963] (-427.132) (-428.876) (-428.089) -- 0:00:39
377500 -- (-427.795) [-428.915] (-426.928) (-425.851) * (-432.526) [-429.212] (-434.733) (-429.639) -- 0:00:39
378000 -- (-428.846) (-426.259) (-427.917) [-431.373] * (-426.880) (-427.290) [-426.992] (-430.217) -- 0:00:39
378500 -- (-431.829) (-427.868) (-427.988) [-428.130] * (-430.499) [-430.184] (-425.485) (-430.475) -- 0:00:39
379000 -- (-427.414) (-429.566) (-427.350) [-428.043] * (-432.287) (-427.715) [-430.279] (-427.312) -- 0:00:39
379500 -- [-426.848] (-425.995) (-427.849) (-426.720) * (-428.437) (-427.787) (-425.999) [-426.736] -- 0:00:39
380000 -- [-425.719] (-427.710) (-430.264) (-428.458) * (-431.352) (-426.180) [-427.166] (-428.324) -- 0:00:39
Average standard deviation of split frequencies: 0.006966
380500 -- [-425.763] (-429.588) (-427.288) (-426.860) * [-426.315] (-428.363) (-426.546) (-429.762) -- 0:00:39
381000 -- [-425.235] (-428.855) (-427.214) (-426.711) * (-431.337) [-429.255] (-429.589) (-426.452) -- 0:00:38
381500 -- (-425.878) (-426.349) (-428.228) [-427.706] * (-431.033) [-427.840] (-426.719) (-431.970) -- 0:00:38
382000 -- (-425.084) [-427.858] (-430.857) (-427.565) * (-431.411) (-426.423) (-429.335) [-431.489] -- 0:00:38
382500 -- (-429.343) (-427.681) [-428.416] (-426.016) * [-431.087] (-426.640) (-428.226) (-428.524) -- 0:00:38
383000 -- [-427.528] (-425.882) (-429.730) (-428.313) * (-430.274) (-429.041) (-426.964) [-427.397] -- 0:00:38
383500 -- [-427.155] (-432.340) (-427.794) (-426.501) * [-429.021] (-429.013) (-427.778) (-431.276) -- 0:00:38
384000 -- (-429.795) (-428.780) [-431.184] (-427.574) * (-428.511) (-427.303) (-429.721) [-432.479] -- 0:00:38
384500 -- [-426.213] (-428.075) (-430.812) (-427.650) * (-430.950) [-425.568] (-425.720) (-428.417) -- 0:00:38
385000 -- (-428.395) (-431.604) (-426.974) [-428.142] * (-431.824) (-429.137) (-430.560) [-432.527] -- 0:00:38
Average standard deviation of split frequencies: 0.007543
385500 -- [-428.664] (-430.224) (-429.665) (-426.156) * [-429.097] (-426.513) (-431.361) (-430.305) -- 0:00:38
386000 -- (-430.073) (-426.892) (-434.015) [-428.008] * (-428.408) (-430.640) [-428.068] (-426.645) -- 0:00:38
386500 -- [-428.121] (-428.646) (-430.124) (-427.226) * (-428.915) [-427.900] (-426.852) (-430.761) -- 0:00:38
387000 -- [-425.970] (-429.449) (-431.941) (-427.034) * (-433.611) (-430.219) (-429.250) [-427.503] -- 0:00:38
387500 -- [-427.270] (-427.677) (-429.158) (-433.436) * (-426.705) (-431.389) (-428.979) [-429.800] -- 0:00:37
388000 -- (-426.189) [-426.172] (-428.298) (-429.267) * [-427.152] (-431.632) (-428.233) (-428.586) -- 0:00:37
388500 -- (-427.657) [-426.015] (-432.075) (-429.325) * (-430.103) [-430.238] (-429.726) (-427.149) -- 0:00:39
389000 -- (-429.507) [-429.658] (-428.849) (-429.646) * (-433.928) [-426.683] (-429.162) (-427.730) -- 0:00:39
389500 -- (-426.433) (-427.587) (-427.506) [-429.896] * (-432.268) (-426.673) (-431.505) [-427.569] -- 0:00:39
390000 -- [-427.419] (-429.553) (-434.705) (-432.993) * [-429.021] (-428.176) (-429.604) (-427.219) -- 0:00:39
Average standard deviation of split frequencies: 0.007524
390500 -- [-426.876] (-428.426) (-443.193) (-427.595) * (-428.487) (-426.779) (-430.583) [-428.188] -- 0:00:39
391000 -- (-428.818) (-427.721) (-433.407) [-429.531] * (-428.978) (-428.481) [-431.128] (-426.372) -- 0:00:38
391500 -- [-426.777] (-428.571) (-433.831) (-428.471) * [-429.240] (-429.519) (-431.077) (-430.631) -- 0:00:38
392000 -- [-426.719] (-431.715) (-431.023) (-427.175) * (-428.959) (-426.813) [-428.974] (-428.422) -- 0:00:38
392500 -- (-430.621) (-434.027) (-428.526) [-427.893] * (-429.254) (-428.514) (-428.146) [-425.804] -- 0:00:38
393000 -- (-426.816) (-431.274) [-427.340] (-430.408) * (-430.754) [-434.575] (-429.110) (-430.987) -- 0:00:38
393500 -- (-429.801) (-427.285) (-429.464) [-429.767] * (-429.619) (-426.987) (-431.321) [-430.830] -- 0:00:38
394000 -- (-426.304) (-428.844) (-428.560) [-427.304] * (-427.432) [-427.035] (-427.247) (-430.948) -- 0:00:38
394500 -- (-426.960) (-429.309) (-429.957) [-428.012] * [-430.856] (-425.442) (-430.717) (-430.844) -- 0:00:38
395000 -- [-425.267] (-430.628) (-428.554) (-426.789) * (-432.154) (-425.082) [-429.739] (-427.391) -- 0:00:38
Average standard deviation of split frequencies: 0.007283
395500 -- (-431.172) (-425.447) [-425.701] (-428.503) * (-430.185) (-426.633) (-432.739) [-427.499] -- 0:00:38
396000 -- (-426.424) (-428.470) (-427.536) [-426.043] * (-431.940) (-426.665) [-427.931] (-428.634) -- 0:00:38
396500 -- (-428.057) (-430.874) [-426.927] (-425.771) * (-429.795) [-428.455] (-426.859) (-433.089) -- 0:00:38
397000 -- (-429.435) (-427.956) (-429.733) [-426.376] * (-431.743) [-426.488] (-426.638) (-428.838) -- 0:00:37
397500 -- (-429.261) (-427.399) [-428.302] (-427.070) * [-427.581] (-428.166) (-429.886) (-430.002) -- 0:00:37
398000 -- (-429.342) [-427.486] (-434.216) (-427.680) * (-431.482) (-425.856) (-429.717) [-427.226] -- 0:00:37
398500 -- [-430.068] (-430.625) (-430.955) (-430.938) * (-429.550) (-427.544) (-428.323) [-427.581] -- 0:00:37
399000 -- (-428.711) [-428.105] (-430.404) (-429.525) * (-427.048) [-425.227] (-429.499) (-430.323) -- 0:00:37
399500 -- (-428.622) (-429.395) [-429.704] (-428.313) * (-430.892) (-431.315) [-426.818] (-429.794) -- 0:00:37
400000 -- (-432.836) (-429.137) (-437.706) [-427.303] * (-432.868) (-428.122) (-428.702) [-428.142] -- 0:00:37
Average standard deviation of split frequencies: 0.007821
400500 -- [-429.286] (-430.300) (-428.949) (-430.323) * [-428.652] (-428.999) (-429.505) (-430.512) -- 0:00:37
401000 -- (-427.877) [-430.670] (-428.569) (-427.077) * (-427.534) [-428.786] (-427.163) (-429.081) -- 0:00:37
401500 -- [-428.436] (-429.919) (-433.211) (-427.147) * (-427.653) [-434.189] (-427.618) (-429.623) -- 0:00:37
402000 -- (-429.987) (-433.418) [-427.429] (-427.628) * [-425.989] (-426.580) (-432.311) (-427.529) -- 0:00:37
402500 -- (-435.903) (-432.629) [-429.880] (-428.717) * [-428.684] (-427.583) (-435.358) (-427.135) -- 0:00:37
403000 -- [-432.013] (-431.104) (-428.959) (-429.098) * (-431.722) (-426.543) (-434.620) [-424.787] -- 0:00:37
403500 -- [-432.202] (-430.172) (-427.969) (-431.051) * (-430.693) [-430.438] (-429.937) (-427.349) -- 0:00:36
404000 -- (-427.199) (-427.204) [-429.246] (-434.008) * [-430.088] (-435.386) (-425.826) (-429.692) -- 0:00:36
404500 -- (-430.324) (-428.576) (-426.858) [-430.118] * (-431.477) (-427.431) [-424.497] (-427.310) -- 0:00:38
405000 -- (-428.361) (-427.650) [-427.613] (-428.078) * (-433.046) (-429.920) [-429.847] (-433.350) -- 0:00:38
Average standard deviation of split frequencies: 0.008708
405500 -- (-426.955) [-425.996] (-428.655) (-429.954) * (-430.488) [-426.408] (-431.573) (-427.764) -- 0:00:38
406000 -- (-428.743) [-428.761] (-426.425) (-426.690) * (-427.988) [-425.934] (-430.735) (-430.242) -- 0:00:38
406500 -- [-428.178] (-429.554) (-432.032) (-430.312) * (-427.253) [-426.936] (-429.793) (-426.925) -- 0:00:37
407000 -- (-429.377) [-431.790] (-428.172) (-425.547) * [-429.147] (-429.641) (-425.983) (-426.228) -- 0:00:37
407500 -- [-425.290] (-430.374) (-429.670) (-426.427) * (-427.870) (-429.169) (-427.981) [-426.201] -- 0:00:37
408000 -- (-431.299) [-431.053] (-429.959) (-430.343) * (-428.605) (-428.338) [-425.643] (-427.430) -- 0:00:37
408500 -- (-428.489) [-429.021] (-428.688) (-427.502) * (-427.606) [-427.820] (-428.893) (-428.113) -- 0:00:37
409000 -- (-431.028) (-429.545) [-428.625] (-430.322) * (-427.925) (-426.122) (-427.667) [-426.729] -- 0:00:37
409500 -- (-429.537) (-428.375) (-430.425) [-426.336] * (-433.135) (-430.440) [-429.444] (-427.132) -- 0:00:37
410000 -- [-426.421] (-429.541) (-428.762) (-432.901) * (-429.681) [-427.749] (-433.185) (-430.752) -- 0:00:37
Average standard deviation of split frequencies: 0.008877
410500 -- [-428.392] (-430.057) (-429.820) (-430.625) * (-428.204) [-431.406] (-429.003) (-430.271) -- 0:00:37
411000 -- [-427.125] (-433.667) (-428.931) (-429.196) * (-427.624) [-426.907] (-429.834) (-432.193) -- 0:00:37
411500 -- (-428.851) [-430.080] (-428.108) (-427.437) * (-426.997) (-429.171) [-426.981] (-430.973) -- 0:00:37
412000 -- (-430.112) (-433.204) (-429.287) [-427.231] * [-427.033] (-428.131) (-428.801) (-430.542) -- 0:00:37
412500 -- (-427.882) [-427.998] (-429.769) (-428.819) * (-431.443) (-431.720) [-428.784] (-427.701) -- 0:00:37
413000 -- (-434.887) [-426.560] (-429.457) (-426.398) * (-434.762) (-429.802) (-428.556) [-426.343] -- 0:00:36
413500 -- (-429.813) (-428.362) (-429.754) [-426.199] * (-429.624) (-429.318) [-428.020] (-430.868) -- 0:00:36
414000 -- (-430.289) [-428.088] (-432.207) (-427.738) * (-430.483) (-428.827) (-426.110) [-426.273] -- 0:00:36
414500 -- (-428.589) (-426.962) (-430.021) [-427.378] * [-432.037] (-429.294) (-425.725) (-427.573) -- 0:00:36
415000 -- (-429.420) (-429.527) (-428.148) [-430.045] * [-430.476] (-430.426) (-426.755) (-427.344) -- 0:00:36
Average standard deviation of split frequencies: 0.008990
415500 -- (-435.191) (-432.346) (-426.444) [-433.344] * (-428.552) (-429.154) [-427.628] (-430.401) -- 0:00:36
416000 -- (-426.788) (-426.967) [-430.906] (-428.823) * (-430.656) (-426.188) [-429.410] (-429.274) -- 0:00:36
416500 -- (-427.950) (-427.647) [-431.713] (-431.598) * (-432.085) [-428.362] (-426.580) (-429.735) -- 0:00:36
417000 -- (-426.891) (-429.914) [-427.695] (-431.185) * (-432.711) [-430.609] (-429.409) (-432.599) -- 0:00:36
417500 -- (-426.372) [-426.726] (-430.486) (-429.631) * (-429.307) (-427.371) [-429.406] (-427.741) -- 0:00:36
418000 -- (-428.227) (-428.039) (-426.994) [-426.980] * (-429.775) (-429.146) [-425.354] (-430.744) -- 0:00:36
418500 -- (-432.022) (-428.257) [-429.905] (-429.258) * (-431.056) [-427.685] (-428.415) (-428.845) -- 0:00:37
419000 -- (-430.682) (-429.871) (-428.824) [-428.111] * [-427.709] (-430.817) (-430.447) (-428.352) -- 0:00:37
419500 -- (-429.861) [-428.840] (-427.551) (-435.827) * (-427.817) (-426.774) (-432.763) [-430.181] -- 0:00:37
420000 -- [-428.957] (-431.128) (-427.948) (-432.230) * (-427.434) (-425.353) [-425.951] (-428.722) -- 0:00:37
Average standard deviation of split frequencies: 0.008591
420500 -- (-426.841) (-429.488) [-429.199] (-428.630) * [-429.056] (-425.644) (-429.138) (-428.185) -- 0:00:37
421000 -- (-429.505) (-430.569) [-427.120] (-429.174) * (-425.699) (-432.306) (-427.362) [-430.734] -- 0:00:37
421500 -- (-427.107) (-429.857) [-431.126] (-429.863) * (-427.955) (-429.694) (-427.346) [-427.230] -- 0:00:37
422000 -- (-428.053) (-430.191) [-427.023] (-428.602) * (-428.004) [-427.880] (-431.761) (-427.322) -- 0:00:36
422500 -- (-426.280) (-430.659) (-429.319) [-429.719] * (-427.812) (-429.115) [-430.268] (-426.764) -- 0:00:36
423000 -- (-425.322) [-429.683] (-429.027) (-426.377) * (-427.721) [-429.446] (-427.777) (-426.986) -- 0:00:36
423500 -- [-426.878] (-430.604) (-428.764) (-430.608) * (-429.968) (-428.504) (-428.426) [-429.021] -- 0:00:36
424000 -- [-426.547] (-431.944) (-429.085) (-432.622) * (-425.947) (-427.238) [-427.243] (-430.590) -- 0:00:36
424500 -- [-426.362] (-430.463) (-428.317) (-433.544) * (-430.338) [-429.161] (-431.369) (-426.261) -- 0:00:36
425000 -- (-429.930) [-429.878] (-431.227) (-427.179) * (-429.127) (-428.424) [-429.335] (-429.366) -- 0:00:36
Average standard deviation of split frequencies: 0.007894
425500 -- (-425.911) (-431.176) (-426.515) [-427.929] * (-431.432) (-430.813) (-430.458) [-428.931] -- 0:00:36
426000 -- [-425.347] (-429.418) (-427.777) (-427.190) * (-430.476) [-429.195] (-429.307) (-433.863) -- 0:00:36
426500 -- [-430.381] (-429.870) (-426.865) (-429.733) * [-432.044] (-429.166) (-428.998) (-428.974) -- 0:00:36
427000 -- (-425.264) (-428.065) (-428.485) [-427.892] * [-426.936] (-430.846) (-426.712) (-432.272) -- 0:00:36
427500 -- (-426.969) (-427.774) (-427.432) [-427.026] * (-428.305) [-428.215] (-428.725) (-429.957) -- 0:00:36
428000 -- (-425.672) [-429.100] (-427.607) (-428.594) * (-425.873) [-428.353] (-430.486) (-432.305) -- 0:00:36
428500 -- (-427.992) (-428.726) (-427.297) [-429.590] * (-428.077) (-428.207) [-432.540] (-430.250) -- 0:00:36
429000 -- (-427.502) (-428.382) [-429.774] (-430.258) * (-429.799) [-427.722] (-431.221) (-430.232) -- 0:00:35
429500 -- (-427.971) (-430.415) [-426.456] (-427.627) * (-428.407) (-434.678) [-430.394] (-429.861) -- 0:00:35
430000 -- (-432.759) (-429.100) [-429.281] (-428.066) * (-426.968) [-430.220] (-430.611) (-430.259) -- 0:00:35
Average standard deviation of split frequencies: 0.007078
430500 -- (-432.787) (-430.220) (-430.816) [-429.634] * (-428.695) (-428.984) [-430.338] (-433.496) -- 0:00:35
431000 -- (-428.930) (-428.333) [-425.412] (-428.989) * (-427.027) [-431.238] (-430.103) (-431.671) -- 0:00:35
431500 -- (-425.822) (-428.093) [-426.884] (-426.376) * [-428.608] (-437.088) (-431.346) (-428.902) -- 0:00:35
432000 -- [-425.474] (-431.598) (-426.459) (-428.604) * [-428.869] (-426.742) (-432.884) (-429.812) -- 0:00:35
432500 -- (-426.642) [-428.144] (-428.465) (-425.601) * [-429.821] (-428.233) (-425.873) (-427.623) -- 0:00:35
433000 -- [-427.712] (-426.746) (-433.018) (-428.311) * [-428.851] (-430.989) (-426.110) (-427.458) -- 0:00:35
433500 -- (-426.597) (-425.680) (-426.825) [-430.269] * (-430.604) [-428.454] (-429.509) (-430.007) -- 0:00:35
434000 -- (-427.673) [-425.757] (-433.082) (-431.894) * (-432.848) (-426.839) [-428.320] (-430.156) -- 0:00:35
434500 -- (-425.300) [-426.687] (-429.265) (-429.079) * (-426.260) [-427.435] (-436.853) (-431.731) -- 0:00:36
435000 -- [-427.543] (-426.863) (-432.107) (-430.580) * (-428.726) (-429.634) [-428.593] (-431.100) -- 0:00:36
Average standard deviation of split frequencies: 0.006825
435500 -- [-427.210] (-429.947) (-429.184) (-428.268) * [-427.572] (-426.284) (-428.602) (-430.622) -- 0:00:36
436000 -- [-427.409] (-427.634) (-428.520) (-429.146) * (-429.444) [-431.071] (-429.346) (-427.047) -- 0:00:36
436500 -- (-426.001) (-427.670) (-435.201) [-427.705] * [-427.907] (-430.168) (-431.930) (-427.075) -- 0:00:36
437000 -- (-427.793) (-432.646) [-426.804] (-428.293) * (-436.410) [-425.858] (-428.155) (-431.300) -- 0:00:36
437500 -- (-430.044) (-432.827) (-427.097) [-425.434] * (-433.456) [-427.172] (-429.682) (-427.399) -- 0:00:36
438000 -- (-426.905) (-428.848) [-426.906] (-428.992) * (-425.857) (-426.970) (-427.169) [-425.840] -- 0:00:35
438500 -- (-428.708) (-434.135) (-428.773) [-432.318] * (-430.584) (-425.657) (-427.604) [-426.943] -- 0:00:35
439000 -- (-428.418) [-426.480] (-429.114) (-433.627) * [-428.389] (-425.220) (-426.424) (-425.762) -- 0:00:35
439500 -- [-430.002] (-426.500) (-427.612) (-430.071) * (-426.013) [-429.565] (-426.804) (-425.580) -- 0:00:35
440000 -- (-429.652) [-425.915] (-429.760) (-431.198) * (-426.828) (-425.991) (-428.609) [-428.718] -- 0:00:35
Average standard deviation of split frequencies: 0.007020
440500 -- (-431.643) [-427.737] (-429.291) (-425.756) * (-427.763) [-426.733] (-433.669) (-431.286) -- 0:00:35
441000 -- [-431.750] (-428.528) (-429.142) (-428.931) * (-429.112) (-427.857) (-430.013) [-427.147] -- 0:00:35
441500 -- [-428.699] (-428.226) (-425.250) (-427.975) * (-427.989) [-427.075] (-428.615) (-428.202) -- 0:00:35
442000 -- (-428.288) (-426.400) (-427.442) [-428.123] * (-429.419) [-427.627] (-428.794) (-425.739) -- 0:00:35
442500 -- (-426.872) (-427.208) [-426.228] (-426.947) * (-432.169) (-429.451) (-429.966) [-430.410] -- 0:00:35
443000 -- (-432.882) [-432.945] (-425.568) (-427.479) * (-435.634) (-427.664) (-428.763) [-429.291] -- 0:00:35
443500 -- (-429.195) (-427.963) [-430.022] (-426.864) * [-429.049] (-430.192) (-429.074) (-427.899) -- 0:00:35
444000 -- (-428.213) [-429.539] (-431.310) (-434.003) * (-429.089) [-428.288] (-428.150) (-426.297) -- 0:00:35
444500 -- [-427.550] (-430.087) (-429.139) (-428.721) * (-428.923) (-424.548) [-427.924] (-426.493) -- 0:00:34
445000 -- [-426.920] (-428.358) (-429.482) (-428.008) * [-429.082] (-428.917) (-426.843) (-427.854) -- 0:00:34
Average standard deviation of split frequencies: 0.005747
445500 -- (-426.401) (-427.520) (-430.659) [-427.911] * (-429.840) (-427.045) [-427.028] (-426.383) -- 0:00:34
446000 -- (-429.217) [-426.079] (-428.489) (-426.692) * (-427.424) [-425.763] (-427.000) (-428.125) -- 0:00:34
446500 -- (-427.693) [-427.266] (-429.081) (-427.053) * [-426.508] (-426.911) (-432.739) (-429.270) -- 0:00:34
447000 -- [-426.970] (-427.892) (-430.960) (-425.639) * [-427.788] (-427.930) (-435.923) (-427.782) -- 0:00:34
447500 -- [-429.038] (-429.557) (-431.240) (-429.270) * (-428.067) (-428.063) (-430.248) [-429.178] -- 0:00:34
448000 -- (-430.021) [-427.624] (-429.651) (-428.501) * (-431.038) (-428.446) [-429.073] (-431.233) -- 0:00:34
448500 -- (-426.662) (-425.111) (-432.998) [-429.003] * (-426.658) (-429.338) [-428.271] (-427.810) -- 0:00:34
449000 -- [-426.268] (-433.461) (-427.928) (-428.420) * (-427.536) (-427.311) [-427.259] (-430.013) -- 0:00:34
449500 -- (-428.145) (-426.734) (-426.619) [-428.492] * [-429.416] (-426.698) (-432.370) (-428.739) -- 0:00:34
450000 -- (-430.644) (-425.549) [-427.005] (-426.822) * (-428.367) (-428.262) (-429.252) [-425.746] -- 0:00:35
Average standard deviation of split frequencies: 0.006904
450500 -- [-430.146] (-428.164) (-429.778) (-426.315) * (-428.886) [-427.132] (-430.008) (-426.893) -- 0:00:35
451000 -- [-426.707] (-429.413) (-429.686) (-426.651) * (-428.631) (-429.572) (-428.624) [-427.124] -- 0:00:35
451500 -- (-430.646) (-428.163) [-428.196] (-427.708) * (-427.651) [-427.271] (-431.944) (-429.932) -- 0:00:35
452000 -- (-429.669) (-424.425) [-429.837] (-428.483) * (-426.032) (-425.960) [-428.836] (-426.847) -- 0:00:35
452500 -- (-434.151) [-423.680] (-428.424) (-429.332) * (-430.117) [-428.966] (-428.635) (-429.339) -- 0:00:35
453000 -- (-430.636) (-424.813) (-429.473) [-429.352] * [-425.766] (-427.470) (-428.444) (-428.262) -- 0:00:35
453500 -- (-428.727) [-423.805] (-431.542) (-426.712) * (-429.422) (-428.771) (-428.659) [-426.823] -- 0:00:34
454000 -- (-429.816) (-430.205) [-432.042] (-433.187) * (-429.718) [-429.903] (-431.331) (-429.282) -- 0:00:34
454500 -- (-430.753) (-429.899) (-425.642) [-430.199] * [-431.536] (-428.688) (-428.897) (-429.111) -- 0:00:34
455000 -- (-430.063) [-427.356] (-432.399) (-428.459) * (-425.540) (-433.318) [-430.998] (-430.499) -- 0:00:34
Average standard deviation of split frequencies: 0.007305
455500 -- (-430.462) (-427.294) (-431.039) [-428.819] * (-425.832) (-426.827) (-430.494) [-429.553] -- 0:00:34
456000 -- [-430.239] (-429.490) (-427.780) (-427.364) * [-427.669] (-428.068) (-430.375) (-427.757) -- 0:00:34
456500 -- (-429.123) (-427.613) (-428.791) [-429.838] * [-429.211] (-428.235) (-430.762) (-426.523) -- 0:00:34
457000 -- (-430.357) [-427.803] (-427.351) (-434.160) * [-427.115] (-429.223) (-427.683) (-427.760) -- 0:00:34
457500 -- (-428.451) (-428.835) [-425.894] (-427.526) * [-426.916] (-427.130) (-432.023) (-429.577) -- 0:00:34
458000 -- (-428.538) (-428.020) (-430.264) [-429.713] * [-424.630] (-429.168) (-429.099) (-426.717) -- 0:00:34
458500 -- (-428.985) (-428.909) (-426.154) [-430.340] * [-426.906] (-432.558) (-426.941) (-432.165) -- 0:00:34
459000 -- (-430.712) (-427.078) [-426.453] (-430.342) * (-427.844) (-426.976) (-427.180) [-426.148] -- 0:00:34
459500 -- (-431.900) [-427.471] (-427.469) (-432.368) * [-428.241] (-429.165) (-429.678) (-426.160) -- 0:00:34
460000 -- (-428.530) (-427.665) [-427.508] (-428.302) * (-428.254) (-427.886) [-426.520] (-429.145) -- 0:00:34
Average standard deviation of split frequencies: 0.006686
460500 -- (-430.771) [-430.456] (-428.133) (-429.196) * (-429.789) (-428.236) [-425.350] (-427.635) -- 0:00:33
461000 -- (-429.945) (-428.523) (-429.106) [-426.151] * (-428.628) (-432.652) (-427.345) [-426.554] -- 0:00:33
461500 -- (-434.364) (-429.900) (-424.628) [-427.443] * (-425.331) (-430.614) (-429.343) [-428.378] -- 0:00:33
462000 -- [-430.698] (-429.926) (-433.124) (-432.973) * (-428.705) [-428.691] (-426.492) (-429.936) -- 0:00:33
462500 -- (-431.146) [-431.816] (-428.285) (-431.738) * (-425.700) (-426.475) (-425.508) [-427.625] -- 0:00:33
463000 -- [-430.175] (-428.435) (-428.125) (-429.082) * (-429.992) (-427.744) [-429.508] (-427.763) -- 0:00:33
463500 -- (-429.406) (-426.182) (-432.283) [-431.141] * [-429.620] (-429.747) (-427.759) (-429.470) -- 0:00:33
464000 -- (-429.224) [-430.724] (-427.810) (-427.634) * (-427.001) (-433.793) [-427.707] (-427.425) -- 0:00:33
464500 -- (-427.105) [-428.501] (-431.124) (-429.977) * (-428.747) (-426.427) [-427.267] (-431.750) -- 0:00:33
465000 -- (-427.494) (-431.198) [-426.854] (-429.777) * (-429.299) (-426.697) (-428.582) [-433.440] -- 0:00:33
Average standard deviation of split frequencies: 0.006137
465500 -- (-428.627) (-430.591) (-428.885) [-427.021] * (-431.831) (-426.412) (-430.479) [-427.865] -- 0:00:34
466000 -- [-426.861] (-429.080) (-427.996) (-429.125) * (-426.553) (-427.237) (-429.803) [-428.552] -- 0:00:34
466500 -- (-430.175) (-427.848) (-426.781) [-428.638] * [-430.419] (-430.517) (-425.743) (-426.273) -- 0:00:34
467000 -- (-430.007) (-428.726) (-430.840) [-426.997] * (-426.467) (-427.502) (-428.177) [-427.315] -- 0:00:34
467500 -- (-428.372) (-431.164) [-425.889] (-425.444) * (-427.066) [-428.622] (-433.728) (-427.826) -- 0:00:34
468000 -- (-428.596) (-431.244) [-427.994] (-429.780) * [-428.244] (-430.050) (-428.875) (-428.111) -- 0:00:34
468500 -- (-429.312) (-432.528) [-428.215] (-427.724) * (-428.429) (-433.231) (-430.333) [-427.686] -- 0:00:34
469000 -- (-428.997) (-430.405) (-428.873) [-426.686] * (-428.689) [-432.817] (-427.493) (-425.932) -- 0:00:33
469500 -- [-428.962] (-431.737) (-426.562) (-427.169) * [-429.593] (-429.697) (-425.247) (-426.285) -- 0:00:33
470000 -- (-435.069) (-429.512) (-430.885) [-425.082] * (-426.617) (-429.359) (-425.963) [-428.255] -- 0:00:33
Average standard deviation of split frequencies: 0.006410
470500 -- (-432.364) (-428.626) [-429.576] (-425.841) * [-426.756] (-429.091) (-426.548) (-426.632) -- 0:00:33
471000 -- [-428.619] (-430.908) (-427.954) (-434.240) * [-428.846] (-428.240) (-427.601) (-428.133) -- 0:00:33
471500 -- (-434.188) (-430.691) [-429.035] (-429.074) * (-429.392) [-427.412] (-430.614) (-429.000) -- 0:00:33
472000 -- (-430.770) [-431.227] (-428.070) (-427.737) * (-426.231) (-427.936) [-430.040] (-427.585) -- 0:00:33
472500 -- (-435.784) (-430.713) (-427.086) [-427.111] * (-426.857) [-432.522] (-429.550) (-429.281) -- 0:00:33
473000 -- (-430.589) (-426.523) (-429.570) [-428.098] * (-426.475) (-431.833) [-428.370] (-429.985) -- 0:00:33
473500 -- (-427.900) (-428.281) [-430.883] (-428.349) * (-427.118) (-428.034) [-426.673] (-428.469) -- 0:00:33
474000 -- (-428.479) (-427.946) (-427.858) [-426.837] * [-428.282] (-433.575) (-426.999) (-433.026) -- 0:00:33
474500 -- (-429.470) [-428.395] (-426.176) (-427.909) * (-427.797) [-429.967] (-428.423) (-427.368) -- 0:00:33
475000 -- (-428.470) (-431.465) (-426.026) [-424.842] * [-426.612] (-429.193) (-428.601) (-430.355) -- 0:00:33
Average standard deviation of split frequencies: 0.006734
475500 -- [-428.440] (-433.602) (-432.079) (-426.542) * [-426.381] (-430.440) (-427.410) (-426.636) -- 0:00:33
476000 -- (-428.445) (-428.085) [-430.654] (-426.347) * [-426.445] (-429.288) (-428.411) (-429.032) -- 0:00:33
476500 -- (-427.317) [-424.910] (-428.862) (-427.366) * (-426.533) (-428.037) (-427.737) [-426.336] -- 0:00:32
477000 -- (-426.754) [-427.575] (-428.102) (-425.704) * [-431.258] (-428.125) (-430.508) (-429.418) -- 0:00:32
477500 -- (-427.834) (-428.321) (-428.799) [-430.286] * (-427.763) (-428.402) (-427.969) [-430.410] -- 0:00:32
478000 -- (-427.485) (-427.955) [-426.013] (-428.494) * (-427.460) (-427.791) (-428.116) [-428.015] -- 0:00:32
478500 -- [-429.179] (-427.639) (-427.497) (-426.312) * [-427.747] (-431.736) (-431.040) (-427.050) -- 0:00:32
479000 -- (-431.465) (-431.532) [-428.015] (-426.560) * [-425.349] (-426.028) (-427.168) (-427.280) -- 0:00:32
479500 -- (-432.010) [-428.095] (-425.819) (-426.301) * (-426.371) (-426.955) [-427.776] (-425.862) -- 0:00:32
480000 -- (-426.920) [-429.775] (-428.474) (-430.454) * [-426.848] (-429.933) (-425.850) (-428.191) -- 0:00:32
Average standard deviation of split frequencies: 0.006669
480500 -- (-427.253) (-428.646) (-426.619) [-427.969] * (-426.908) [-430.902] (-430.578) (-426.986) -- 0:00:32
481000 -- (-428.308) [-427.758] (-428.327) (-426.425) * (-427.505) [-430.428] (-427.414) (-433.101) -- 0:00:32
481500 -- (-431.106) [-427.135] (-430.160) (-430.958) * (-429.134) (-427.091) (-427.627) [-429.279] -- 0:00:33
482000 -- (-426.985) (-426.945) [-431.072] (-429.126) * (-431.717) [-427.690] (-427.854) (-428.431) -- 0:00:33
482500 -- [-428.969] (-429.187) (-429.614) (-426.018) * (-427.029) (-426.563) (-430.100) [-426.516] -- 0:00:33
483000 -- (-430.906) (-430.827) (-431.124) [-428.533] * [-427.599] (-426.682) (-427.350) (-426.680) -- 0:00:33
483500 -- (-425.585) (-429.971) [-430.839] (-429.935) * (-425.855) [-428.992] (-425.034) (-429.009) -- 0:00:33
484000 -- [-426.100] (-431.409) (-431.091) (-427.927) * (-430.779) [-429.239] (-431.344) (-426.772) -- 0:00:33
484500 -- (-430.616) (-433.033) [-428.517] (-428.858) * (-428.366) (-431.266) (-428.080) [-431.034] -- 0:00:32
485000 -- (-428.671) [-428.944] (-432.307) (-428.186) * (-427.332) [-426.930] (-429.450) (-426.260) -- 0:00:32
Average standard deviation of split frequencies: 0.006402
485500 -- (-430.056) (-429.899) (-430.134) [-427.849] * (-428.221) (-429.036) (-427.346) [-431.430] -- 0:00:32
486000 -- (-426.494) (-428.126) (-427.745) [-425.778] * (-430.045) (-432.129) [-427.106] (-429.487) -- 0:00:32
486500 -- (-429.027) (-429.008) (-429.292) [-428.499] * (-426.350) (-432.637) (-426.275) [-427.366] -- 0:00:32
487000 -- [-426.470] (-425.714) (-434.547) (-425.273) * (-428.784) (-428.794) (-426.824) [-428.294] -- 0:00:32
487500 -- [-428.582] (-432.502) (-429.364) (-427.600) * [-430.569] (-429.211) (-427.036) (-429.458) -- 0:00:32
488000 -- [-427.645] (-428.594) (-431.693) (-428.334) * [-427.025] (-427.007) (-425.907) (-430.477) -- 0:00:32
488500 -- (-432.295) (-429.573) [-426.094] (-427.647) * (-428.661) [-429.156] (-428.416) (-428.561) -- 0:00:32
489000 -- (-432.122) [-426.703] (-426.839) (-427.098) * (-428.814) (-425.746) [-428.343] (-430.047) -- 0:00:32
489500 -- (-429.253) [-427.633] (-427.800) (-430.617) * (-431.116) (-430.023) (-431.226) [-425.822] -- 0:00:32
490000 -- [-431.089] (-427.484) (-429.131) (-430.288) * [-428.859] (-426.388) (-431.409) (-429.014) -- 0:00:32
Average standard deviation of split frequencies: 0.006213
490500 -- (-429.455) (-428.533) [-427.663] (-427.075) * (-425.509) [-425.474] (-430.780) (-426.848) -- 0:00:32
491000 -- (-432.817) (-429.102) [-427.332] (-427.276) * [-427.303] (-427.851) (-428.533) (-429.119) -- 0:00:32
491500 -- (-433.206) [-428.466] (-426.435) (-426.498) * [-430.113] (-426.243) (-428.116) (-427.316) -- 0:00:32
492000 -- (-428.957) (-430.266) [-428.372] (-427.391) * (-429.970) (-426.166) (-426.182) [-428.174] -- 0:00:32
492500 -- (-431.504) (-432.577) (-425.725) [-427.172] * [-426.408] (-430.873) (-426.723) (-432.320) -- 0:00:31
493000 -- (-427.325) (-432.300) [-429.308] (-426.896) * (-430.956) [-428.214] (-427.234) (-431.322) -- 0:00:31
493500 -- (-428.807) (-427.743) [-431.471] (-428.784) * [-427.522] (-427.978) (-429.118) (-430.147) -- 0:00:31
494000 -- (-427.191) (-430.066) [-428.239] (-427.143) * (-426.446) (-431.859) (-429.821) [-429.216] -- 0:00:31
494500 -- [-429.054] (-429.697) (-429.176) (-427.562) * [-429.528] (-432.522) (-436.700) (-425.453) -- 0:00:31
495000 -- (-430.659) (-430.130) [-429.989] (-426.145) * (-431.610) (-428.014) [-426.869] (-430.857) -- 0:00:31
Average standard deviation of split frequencies: 0.006780
495500 -- (-429.720) (-427.139) [-431.058] (-434.113) * (-430.539) (-426.435) [-426.541] (-425.947) -- 0:00:31
496000 -- (-430.763) [-429.329] (-429.516) (-428.208) * (-429.452) (-429.873) [-427.137] (-431.177) -- 0:00:31
496500 -- [-431.143] (-428.350) (-435.677) (-428.730) * (-429.399) (-437.139) [-427.003] (-429.290) -- 0:00:31
497000 -- (-429.944) [-426.238] (-428.305) (-426.801) * (-428.195) (-428.283) [-428.414] (-426.206) -- 0:00:32
497500 -- (-429.579) (-429.385) [-429.237] (-427.419) * (-428.678) [-427.197] (-429.848) (-429.707) -- 0:00:32
498000 -- (-432.566) (-430.924) [-429.897] (-428.959) * [-431.802] (-426.981) (-427.985) (-428.070) -- 0:00:32
498500 -- (-429.066) (-429.467) (-431.163) [-429.026] * (-426.629) (-426.883) [-426.884] (-429.331) -- 0:00:32
499000 -- (-429.263) (-428.287) (-429.008) [-429.658] * [-427.440] (-429.044) (-430.232) (-430.988) -- 0:00:32
499500 -- (-430.722) (-428.675) (-429.534) [-427.620] * (-426.235) (-430.159) (-430.904) [-427.186] -- 0:00:32
500000 -- [-428.348] (-429.295) (-427.175) (-428.783) * (-427.950) (-430.177) (-430.104) [-429.401] -- 0:00:32
Average standard deviation of split frequencies: 0.007093
500500 -- (-432.831) (-428.279) (-430.413) [-428.193] * (-425.151) (-432.088) [-426.319] (-431.899) -- 0:00:31
501000 -- (-427.604) [-427.379] (-426.718) (-427.975) * [-430.626] (-432.044) (-429.051) (-428.801) -- 0:00:31
501500 -- (-430.390) [-428.015] (-427.898) (-429.034) * [-427.005] (-427.474) (-428.417) (-428.062) -- 0:00:31
502000 -- (-428.539) (-427.055) (-427.564) [-430.508] * (-426.716) (-427.184) [-427.185] (-430.102) -- 0:00:31
502500 -- (-429.835) [-428.285] (-429.192) (-429.964) * (-432.429) (-424.869) (-431.500) [-426.680] -- 0:00:31
503000 -- (-429.260) (-429.063) [-425.868] (-427.852) * [-427.517] (-428.662) (-429.222) (-430.728) -- 0:00:31
503500 -- [-428.203] (-428.375) (-427.834) (-428.610) * [-426.189] (-427.454) (-428.421) (-428.974) -- 0:00:31
504000 -- (-430.309) [-427.095] (-427.002) (-426.970) * (-434.204) (-428.326) [-427.374] (-429.935) -- 0:00:31
504500 -- (-429.068) (-427.602) [-429.244] (-433.234) * (-426.799) (-427.102) (-428.807) [-429.168] -- 0:00:31
505000 -- (-430.424) (-427.174) [-428.351] (-432.820) * (-425.918) [-430.168] (-428.020) (-436.442) -- 0:00:31
Average standard deviation of split frequencies: 0.007686
505500 -- (-429.415) (-426.504) (-431.313) [-432.527] * (-428.763) [-425.984] (-431.989) (-426.439) -- 0:00:31
506000 -- (-427.195) (-436.818) [-430.169] (-427.106) * (-425.992) [-428.722] (-427.229) (-429.549) -- 0:00:31
506500 -- (-428.505) (-426.872) (-431.451) [-428.953] * (-428.377) (-430.422) [-432.444] (-431.008) -- 0:00:31
507000 -- (-429.798) [-428.947] (-430.267) (-427.168) * (-425.719) (-428.331) [-430.797] (-429.718) -- 0:00:31
507500 -- [-425.616] (-426.836) (-427.712) (-427.072) * [-429.086] (-429.656) (-428.732) (-428.739) -- 0:00:31
508000 -- (-427.832) [-430.845] (-428.142) (-429.964) * (-428.770) [-432.428] (-429.942) (-426.726) -- 0:00:30
508500 -- (-429.961) (-428.724) [-427.491] (-427.836) * [-426.697] (-429.325) (-426.141) (-428.665) -- 0:00:30
509000 -- (-428.054) (-429.365) [-429.159] (-426.987) * (-425.943) [-427.014] (-427.357) (-429.371) -- 0:00:30
509500 -- (-428.354) (-427.306) (-431.150) [-426.970] * (-428.335) (-429.863) [-431.904] (-428.335) -- 0:00:30
510000 -- (-428.887) (-425.977) [-425.687] (-428.940) * [-435.772] (-429.112) (-427.654) (-433.428) -- 0:00:30
Average standard deviation of split frequencies: 0.008712
510500 -- (-428.222) [-428.586] (-428.082) (-427.365) * (-427.753) [-431.131] (-429.374) (-433.510) -- 0:00:30
511000 -- (-426.653) [-429.667] (-429.167) (-427.696) * (-428.180) [-429.077] (-428.208) (-432.267) -- 0:00:30
511500 -- (-427.671) (-428.506) (-428.243) [-428.653] * (-428.829) (-430.742) [-428.959] (-426.649) -- 0:00:30
512000 -- (-428.139) (-425.581) [-427.699] (-429.327) * (-429.799) [-426.152] (-430.198) (-429.148) -- 0:00:30
512500 -- (-429.637) (-427.228) (-429.511) [-426.357] * [-427.083] (-428.062) (-431.364) (-431.955) -- 0:00:30
513000 -- [-426.161] (-432.031) (-431.006) (-432.841) * (-432.696) [-427.658] (-430.679) (-430.830) -- 0:00:31
513500 -- (-427.915) [-426.466] (-429.445) (-426.388) * [-432.032] (-430.206) (-434.885) (-429.840) -- 0:00:31
514000 -- (-428.952) (-430.113) (-427.333) [-426.906] * [-426.866] (-427.849) (-434.163) (-432.214) -- 0:00:31
514500 -- (-427.752) (-426.580) [-428.856] (-428.634) * [-427.398] (-426.231) (-427.907) (-429.477) -- 0:00:31
515000 -- [-427.064] (-426.522) (-426.964) (-429.221) * (-429.422) (-427.240) [-427.851] (-425.516) -- 0:00:31
Average standard deviation of split frequencies: 0.008921
515500 -- (-428.976) (-433.082) [-426.951] (-428.274) * (-429.484) (-427.010) (-426.319) [-429.145] -- 0:00:31
516000 -- (-426.512) (-430.576) [-430.498] (-435.799) * (-426.711) [-427.789] (-429.648) (-426.067) -- 0:00:30
516500 -- [-426.919] (-431.903) (-427.439) (-429.174) * [-427.746] (-428.221) (-430.286) (-430.199) -- 0:00:30
517000 -- [-427.684] (-426.532) (-428.533) (-428.300) * [-428.170] (-432.207) (-428.260) (-427.792) -- 0:00:30
517500 -- (-438.090) [-430.228] (-429.701) (-427.394) * (-429.406) (-426.582) [-427.169] (-430.165) -- 0:00:30
518000 -- (-437.290) [-426.085] (-429.806) (-430.883) * (-428.545) (-426.279) (-427.134) [-428.859] -- 0:00:30
518500 -- (-433.243) (-428.430) (-430.585) [-428.809] * [-427.856] (-431.380) (-427.092) (-427.910) -- 0:00:30
519000 -- [-430.449] (-426.540) (-429.048) (-432.309) * [-427.426] (-427.896) (-428.492) (-426.248) -- 0:00:30
519500 -- (-428.618) (-427.212) (-425.430) [-428.597] * [-429.121] (-429.931) (-430.271) (-428.039) -- 0:00:30
520000 -- [-430.379] (-426.803) (-425.424) (-425.943) * [-427.236] (-428.774) (-429.162) (-426.895) -- 0:00:30
Average standard deviation of split frequencies: 0.009393
520500 -- [-428.130] (-429.843) (-431.367) (-438.569) * (-427.371) [-425.699] (-429.094) (-427.484) -- 0:00:30
521000 -- [-427.557] (-427.019) (-429.384) (-429.705) * (-425.665) (-428.432) [-426.424] (-428.687) -- 0:00:30
521500 -- (-428.902) (-425.926) [-428.213] (-429.167) * (-427.344) (-426.974) (-427.584) [-427.345] -- 0:00:30
522000 -- [-426.960] (-426.074) (-428.624) (-430.063) * (-429.929) [-430.126] (-427.216) (-434.522) -- 0:00:30
522500 -- (-433.099) (-427.028) (-424.805) [-428.588] * [-431.056] (-429.709) (-430.784) (-434.528) -- 0:00:30
523000 -- (-431.216) [-426.462] (-429.327) (-433.156) * (-431.106) (-428.127) (-430.286) [-426.619] -- 0:00:30
523500 -- (-428.698) (-427.410) (-426.312) [-428.761] * [-427.767] (-429.197) (-429.908) (-428.250) -- 0:00:30
524000 -- (-429.898) (-428.757) [-426.379] (-428.440) * [-431.898] (-428.663) (-428.905) (-427.529) -- 0:00:29
524500 -- (-428.638) [-428.370] (-426.255) (-429.996) * [-426.554] (-431.639) (-432.766) (-431.745) -- 0:00:29
525000 -- (-429.660) [-427.212] (-426.983) (-428.108) * [-427.074] (-426.201) (-430.011) (-427.922) -- 0:00:29
Average standard deviation of split frequencies: 0.010175
525500 -- (-427.155) (-425.169) (-427.563) [-425.178] * (-430.884) [-428.907] (-427.394) (-427.418) -- 0:00:29
526000 -- (-429.046) (-427.792) [-428.412] (-431.655) * [-427.220] (-428.338) (-430.096) (-430.071) -- 0:00:29
526500 -- (-429.302) (-431.269) [-427.112] (-431.784) * (-429.017) (-429.857) [-429.554] (-427.692) -- 0:00:29
527000 -- (-435.393) (-431.311) [-425.803] (-428.679) * [-427.888] (-430.381) (-425.953) (-431.322) -- 0:00:29
527500 -- [-427.561] (-429.036) (-430.461) (-428.374) * (-428.085) (-427.512) [-426.254] (-429.223) -- 0:00:29
528000 -- [-427.257] (-428.746) (-427.765) (-430.176) * (-427.300) (-431.503) (-425.783) [-427.520] -- 0:00:29
528500 -- (-427.240) (-427.927) (-428.364) [-426.543] * [-429.141] (-432.268) (-425.173) (-426.978) -- 0:00:30
529000 -- [-427.316] (-430.568) (-428.621) (-428.227) * (-428.608) (-432.950) [-427.003] (-428.632) -- 0:00:30
529500 -- (-425.737) (-430.245) [-429.618] (-430.679) * (-430.457) (-429.939) [-424.631] (-430.299) -- 0:00:30
530000 -- [-426.909] (-429.582) (-427.519) (-427.545) * (-429.937) (-428.899) [-427.968] (-428.829) -- 0:00:30
Average standard deviation of split frequencies: 0.010160
530500 -- (-431.389) [-429.586] (-429.025) (-428.186) * [-428.612] (-426.956) (-430.289) (-428.185) -- 0:00:30
531000 -- [-429.972] (-426.268) (-430.845) (-427.830) * (-427.942) [-426.350] (-434.512) (-428.691) -- 0:00:30
531500 -- (-429.655) (-428.130) (-428.940) [-426.881] * [-427.590] (-427.260) (-437.594) (-428.697) -- 0:00:29
532000 -- [-428.899] (-427.071) (-425.610) (-427.696) * (-427.028) (-426.926) (-429.758) [-425.214] -- 0:00:29
532500 -- (-429.870) (-426.820) [-429.089] (-433.013) * (-429.837) [-429.572] (-428.289) (-427.246) -- 0:00:29
533000 -- (-427.543) (-431.791) [-427.551] (-426.157) * (-433.643) (-430.131) [-428.477] (-430.673) -- 0:00:29
533500 -- (-430.067) [-431.150] (-435.208) (-431.945) * (-429.866) (-426.719) [-425.775] (-428.079) -- 0:00:29
534000 -- [-428.753] (-428.713) (-429.026) (-429.655) * (-429.208) (-428.763) [-431.344] (-425.952) -- 0:00:29
534500 -- [-427.068] (-429.071) (-429.535) (-426.697) * (-430.314) [-427.046] (-432.517) (-426.103) -- 0:00:29
535000 -- (-427.700) (-428.581) (-428.337) [-425.077] * [-429.640] (-432.218) (-428.169) (-428.182) -- 0:00:29
Average standard deviation of split frequencies: 0.010456
535500 -- (-427.558) [-428.826] (-430.287) (-426.685) * (-430.535) (-434.203) (-429.417) [-429.595] -- 0:00:29
536000 -- (-435.190) (-438.882) (-428.560) [-427.324] * (-429.563) [-433.579] (-432.984) (-428.741) -- 0:00:29
536500 -- (-436.260) (-432.821) (-427.895) [-425.991] * [-427.176] (-428.473) (-426.421) (-428.763) -- 0:00:29
537000 -- [-431.306] (-429.182) (-428.903) (-426.877) * [-426.555] (-431.907) (-427.479) (-428.123) -- 0:00:29
537500 -- (-431.739) (-432.869) [-429.698] (-426.475) * (-427.101) (-431.110) (-428.850) [-425.994] -- 0:00:29
538000 -- (-426.644) (-432.970) (-433.241) [-428.898] * [-427.665] (-429.887) (-427.438) (-430.473) -- 0:00:29
538500 -- (-433.330) (-431.112) [-430.738] (-427.047) * (-432.105) (-427.353) [-427.434] (-427.086) -- 0:00:29
539000 -- (-430.456) (-428.780) (-429.246) [-428.779] * (-430.547) (-427.655) (-428.208) [-433.449] -- 0:00:29
539500 -- (-429.561) (-430.091) [-428.754] (-427.369) * (-429.664) (-426.585) (-429.354) [-425.714] -- 0:00:29
540000 -- [-428.783] (-432.445) (-428.136) (-430.065) * (-428.163) (-425.713) (-430.854) [-425.520] -- 0:00:28
Average standard deviation of split frequencies: 0.010899
540500 -- (-428.819) [-430.518] (-430.122) (-426.586) * (-430.327) (-428.504) (-427.893) [-426.613] -- 0:00:28
541000 -- [-432.213] (-428.724) (-429.242) (-428.548) * (-429.497) (-425.402) [-430.200] (-428.489) -- 0:00:28
541500 -- [-429.271] (-427.368) (-431.964) (-426.296) * (-431.034) (-426.784) (-426.426) [-427.214] -- 0:00:28
542000 -- [-427.645] (-426.006) (-429.186) (-428.787) * [-428.897] (-427.588) (-427.462) (-429.768) -- 0:00:28
542500 -- [-426.457] (-432.280) (-435.275) (-427.682) * (-430.783) (-431.783) (-427.249) [-428.116] -- 0:00:28
543000 -- (-426.559) [-427.229] (-434.855) (-436.781) * [-426.604] (-431.617) (-427.926) (-425.493) -- 0:00:28
543500 -- [-430.895] (-428.162) (-429.282) (-435.922) * (-428.859) [-427.487] (-426.355) (-425.763) -- 0:00:28
544000 -- (-428.659) (-430.984) [-425.699] (-429.844) * (-425.827) (-428.511) [-425.732] (-428.215) -- 0:00:28
544500 -- [-428.133] (-426.494) (-428.971) (-426.014) * (-429.604) (-431.404) (-428.370) [-428.292] -- 0:00:29
545000 -- [-428.004] (-430.008) (-428.776) (-427.664) * (-426.918) (-427.300) (-428.856) [-426.549] -- 0:00:29
Average standard deviation of split frequencies: 0.011224
545500 -- [-427.167] (-429.394) (-427.973) (-425.792) * (-427.915) (-429.172) (-428.208) [-428.039] -- 0:00:29
546000 -- (-429.771) (-428.631) (-428.453) [-428.030] * (-433.122) (-430.388) [-425.737] (-429.417) -- 0:00:29
546500 -- (-427.472) (-431.144) [-428.213] (-433.341) * (-428.931) (-428.315) (-425.621) [-428.565] -- 0:00:29
547000 -- (-429.943) (-427.778) (-429.299) [-428.515] * (-428.802) (-430.738) [-428.477] (-429.554) -- 0:00:28
547500 -- (-434.146) [-427.343] (-427.582) (-429.339) * (-430.245) [-431.479] (-428.194) (-430.476) -- 0:00:28
548000 -- (-427.296) [-427.474] (-431.680) (-428.287) * (-428.335) (-426.660) (-427.442) [-428.617] -- 0:00:28
548500 -- (-429.226) (-426.642) [-428.922] (-427.930) * [-427.333] (-430.482) (-428.335) (-425.167) -- 0:00:28
549000 -- (-427.214) (-430.130) (-427.043) [-427.081] * (-428.730) [-429.944] (-428.237) (-429.352) -- 0:00:28
549500 -- (-431.862) (-429.574) [-430.399] (-428.061) * (-429.475) [-428.549] (-426.933) (-430.440) -- 0:00:28
550000 -- (-428.440) [-427.040] (-429.951) (-425.465) * (-427.242) (-428.125) (-428.623) [-427.704] -- 0:00:28
Average standard deviation of split frequencies: 0.011700
550500 -- (-431.122) (-432.120) (-428.740) [-430.595] * [-428.282] (-425.910) (-428.436) (-428.129) -- 0:00:28
551000 -- (-429.775) [-428.124] (-425.763) (-429.051) * (-429.999) (-426.166) [-428.255] (-428.800) -- 0:00:28
551500 -- (-430.208) [-431.689] (-430.194) (-428.453) * [-428.100] (-433.028) (-428.201) (-433.290) -- 0:00:28
552000 -- (-431.458) [-428.747] (-428.999) (-424.683) * (-428.305) [-427.335] (-426.781) (-427.746) -- 0:00:28
552500 -- (-430.987) (-428.508) [-425.553] (-427.148) * [-427.390] (-431.411) (-426.706) (-431.123) -- 0:00:28
553000 -- (-431.813) [-426.802] (-428.726) (-426.131) * [-429.094] (-428.178) (-428.702) (-428.659) -- 0:00:28
553500 -- (-429.864) (-431.447) (-428.933) [-428.789] * (-430.538) [-429.211] (-430.364) (-425.234) -- 0:00:28
554000 -- (-427.224) (-430.912) (-428.798) [-429.259] * (-430.857) (-430.789) (-432.410) [-425.807] -- 0:00:28
554500 -- (-426.460) [-427.567] (-430.110) (-431.585) * (-427.143) (-426.369) (-430.493) [-427.743] -- 0:00:28
555000 -- (-429.453) (-427.854) (-428.081) [-429.767] * (-429.129) (-426.939) [-425.724] (-427.975) -- 0:00:28
Average standard deviation of split frequencies: 0.011493
555500 -- [-427.481] (-432.782) (-428.433) (-432.535) * (-432.817) (-427.542) (-426.778) [-427.801] -- 0:00:28
556000 -- (-428.476) (-428.194) [-426.692] (-429.182) * (-429.199) (-429.665) (-429.341) [-430.697] -- 0:00:27
556500 -- [-428.828] (-430.083) (-431.265) (-428.639) * (-435.206) [-428.423] (-431.811) (-428.958) -- 0:00:27
557000 -- (-428.923) (-428.971) [-427.213] (-426.588) * [-428.457] (-429.862) (-430.611) (-428.850) -- 0:00:27
557500 -- (-430.068) (-429.104) [-427.634] (-426.068) * (-427.910) [-430.200] (-427.728) (-430.093) -- 0:00:27
558000 -- [-429.369] (-431.652) (-428.793) (-431.126) * [-430.495] (-428.045) (-426.722) (-427.632) -- 0:00:27
558500 -- (-428.616) (-431.169) [-427.197] (-428.473) * (-425.491) (-429.876) [-429.387] (-427.381) -- 0:00:27
559000 -- (-429.072) [-426.651] (-427.237) (-428.008) * (-430.473) (-430.169) (-432.129) [-425.157] -- 0:00:27
559500 -- (-429.799) [-427.158] (-430.153) (-427.502) * (-429.398) [-430.061] (-430.680) (-426.667) -- 0:00:27
560000 -- (-427.579) (-431.197) (-428.685) [-426.063] * [-430.468] (-430.680) (-428.564) (-427.428) -- 0:00:27
Average standard deviation of split frequencies: 0.011164
560500 -- (-430.654) [-427.944] (-429.038) (-425.698) * [-425.471] (-430.430) (-430.625) (-426.610) -- 0:00:28
561000 -- [-426.170] (-427.081) (-428.749) (-428.070) * (-430.735) (-430.234) (-429.826) [-427.800] -- 0:00:28
561500 -- (-429.574) (-428.635) [-429.573] (-426.348) * (-429.345) (-430.319) [-428.084] (-428.066) -- 0:00:28
562000 -- (-427.894) [-428.818] (-427.297) (-427.773) * (-430.893) (-434.836) (-428.673) [-428.540] -- 0:00:28
562500 -- (-428.955) (-427.381) [-426.824] (-429.440) * (-428.294) (-432.604) [-426.250] (-426.924) -- 0:00:28
563000 -- (-429.841) [-426.566] (-427.188) (-429.050) * (-430.545) (-430.253) (-426.805) [-426.834] -- 0:00:27
563500 -- (-429.946) (-428.702) [-425.876] (-430.544) * (-425.960) (-428.332) (-424.918) [-427.169] -- 0:00:27
564000 -- [-425.721] (-431.275) (-430.287) (-430.047) * [-427.013] (-429.326) (-428.449) (-426.422) -- 0:00:27
564500 -- (-431.273) (-428.175) (-430.770) [-428.431] * [-425.764] (-429.468) (-428.232) (-431.413) -- 0:00:27
565000 -- (-430.022) (-429.870) (-430.176) [-428.873] * (-428.066) (-429.654) [-425.916] (-426.937) -- 0:00:27
Average standard deviation of split frequencies: 0.010226
565500 -- (-428.250) (-425.138) (-430.539) [-430.156] * (-430.007) (-431.470) [-427.190] (-427.790) -- 0:00:27
566000 -- (-433.784) (-429.339) (-428.032) [-430.151] * (-428.081) (-428.804) (-430.025) [-427.401] -- 0:00:27
566500 -- (-432.030) [-430.893] (-428.093) (-435.440) * (-432.440) (-428.572) [-426.086] (-430.385) -- 0:00:27
567000 -- [-429.353] (-429.594) (-428.071) (-430.048) * (-431.038) [-431.480] (-426.023) (-426.715) -- 0:00:27
567500 -- [-427.742] (-429.514) (-428.683) (-428.589) * (-428.163) (-425.730) [-427.760] (-427.500) -- 0:00:27
568000 -- (-428.844) (-429.769) [-427.579] (-430.962) * (-429.411) (-429.733) (-433.956) [-427.385] -- 0:00:27
568500 -- (-434.154) (-432.485) (-430.740) [-427.448] * (-430.906) [-427.357] (-430.596) (-427.148) -- 0:00:27
569000 -- (-428.383) (-430.231) [-428.822] (-430.929) * (-431.359) [-427.410] (-430.947) (-428.322) -- 0:00:27
569500 -- (-432.244) (-431.114) [-428.452] (-429.004) * (-427.587) (-433.095) (-431.977) [-425.827] -- 0:00:27
570000 -- (-426.493) (-431.779) [-427.588] (-429.338) * (-426.355) (-430.230) (-425.300) [-427.422] -- 0:00:27
Average standard deviation of split frequencies: 0.009573
570500 -- [-432.152] (-428.949) (-428.121) (-427.611) * (-430.485) (-426.690) [-426.511] (-430.936) -- 0:00:27
571000 -- (-431.125) (-429.923) [-432.640] (-433.267) * (-428.259) [-426.351] (-426.480) (-429.637) -- 0:00:27
571500 -- (-431.200) (-427.942) (-429.048) [-425.649] * (-429.347) [-427.670] (-426.689) (-427.929) -- 0:00:26
572000 -- [-429.341] (-427.844) (-429.065) (-427.992) * (-431.750) [-427.976] (-428.067) (-427.370) -- 0:00:26
572500 -- (-426.621) [-428.155] (-430.463) (-425.306) * (-434.520) (-430.587) (-427.676) [-427.101] -- 0:00:26
573000 -- (-425.604) (-430.376) (-429.718) [-425.629] * [-428.158] (-427.954) (-429.783) (-433.908) -- 0:00:26
573500 -- (-430.395) [-427.189] (-426.213) (-426.434) * [-425.402] (-427.359) (-427.379) (-427.744) -- 0:00:26
574000 -- (-429.324) (-426.842) (-427.304) [-427.978] * (-427.193) (-426.244) [-426.717] (-428.749) -- 0:00:26
574500 -- (-428.331) (-431.922) [-429.753] (-427.314) * (-435.426) [-430.221] (-427.638) (-429.174) -- 0:00:26
575000 -- (-426.612) (-431.285) (-428.854) [-428.417] * (-429.141) (-430.671) (-430.623) [-425.451] -- 0:00:26
Average standard deviation of split frequencies: 0.009340
575500 -- [-428.883] (-429.299) (-426.976) (-427.108) * (-428.074) (-426.667) (-429.433) [-429.797] -- 0:00:27
576000 -- [-426.275] (-430.724) (-431.047) (-427.376) * (-425.889) (-426.727) (-429.347) [-428.848] -- 0:00:27
576500 -- [-425.035] (-430.433) (-428.589) (-434.581) * (-430.645) (-430.637) [-426.626] (-426.732) -- 0:00:27
577000 -- (-426.223) (-426.537) [-427.167] (-429.589) * [-426.314] (-428.155) (-429.152) (-429.541) -- 0:00:27
577500 -- (-430.885) [-428.794] (-428.275) (-430.071) * (-429.467) (-438.994) (-433.635) [-429.090] -- 0:00:27
578000 -- (-428.418) (-427.912) (-428.282) [-426.425] * (-428.833) (-431.514) (-430.830) [-427.643] -- 0:00:27
578500 -- (-426.955) (-428.961) [-428.785] (-429.035) * [-427.989] (-425.315) (-429.217) (-431.877) -- 0:00:26
579000 -- (-428.313) (-428.479) (-424.213) [-428.700] * (-427.393) [-425.183] (-427.759) (-430.058) -- 0:00:26
579500 -- (-427.139) (-426.214) (-427.163) [-425.182] * (-428.322) (-428.854) (-430.922) [-428.951] -- 0:00:26
580000 -- (-428.099) [-427.607] (-426.868) (-429.296) * (-429.717) (-427.458) [-430.854] (-430.906) -- 0:00:26
Average standard deviation of split frequencies: 0.009488
580500 -- (-434.425) (-427.266) [-429.222] (-425.859) * (-429.661) (-425.818) (-432.236) [-428.389] -- 0:00:26
581000 -- (-429.067) (-429.888) (-428.102) [-427.533] * [-425.901] (-431.382) (-441.277) (-430.241) -- 0:00:26
581500 -- (-429.288) (-431.099) (-428.289) [-427.724] * (-428.010) (-427.979) [-429.778] (-426.819) -- 0:00:26
582000 -- (-429.046) [-433.861] (-425.478) (-427.310) * (-432.957) [-428.907] (-427.531) (-428.859) -- 0:00:26
582500 -- (-428.687) (-430.187) [-426.849] (-430.862) * (-426.497) (-429.862) (-426.362) [-428.802] -- 0:00:26
583000 -- (-431.250) [-426.548] (-429.768) (-433.226) * [-425.616] (-428.871) (-425.787) (-430.193) -- 0:00:26
583500 -- (-430.187) (-426.572) [-425.988] (-428.133) * (-429.844) (-427.518) [-426.461] (-428.046) -- 0:00:26
584000 -- [-428.283] (-426.956) (-428.190) (-429.203) * (-428.033) (-428.059) [-425.984] (-428.991) -- 0:00:26
584500 -- (-428.593) (-429.471) [-425.540] (-427.390) * (-427.851) [-425.143] (-426.937) (-432.007) -- 0:00:26
585000 -- (-430.623) (-426.752) [-425.937] (-433.286) * [-429.068] (-429.102) (-425.790) (-432.612) -- 0:00:26
Average standard deviation of split frequencies: 0.008949
585500 -- (-429.492) [-424.936] (-429.815) (-428.448) * (-427.943) (-432.531) (-427.456) [-429.778] -- 0:00:26
586000 -- (-430.831) [-426.095] (-428.826) (-431.671) * (-427.699) [-428.214] (-427.043) (-430.345) -- 0:00:26
586500 -- (-429.559) (-430.943) (-428.530) [-429.551] * (-430.661) [-434.415] (-428.541) (-429.666) -- 0:00:26
587000 -- (-429.625) [-426.471] (-428.145) (-433.075) * [-426.494] (-428.783) (-430.213) (-430.550) -- 0:00:26
587500 -- (-425.930) (-428.220) (-429.754) [-429.138] * (-430.450) (-430.462) (-430.596) [-430.268] -- 0:00:25
588000 -- (-430.043) (-426.621) (-427.214) [-427.527] * (-434.272) [-427.385] (-429.943) (-425.918) -- 0:00:25
588500 -- (-426.503) (-429.921) (-429.915) [-431.188] * (-428.156) [-430.513] (-428.976) (-432.363) -- 0:00:25
589000 -- (-430.720) (-428.634) (-430.045) [-427.241] * (-426.709) (-427.430) [-430.902] (-431.141) -- 0:00:25
589500 -- (-429.574) (-429.591) [-424.459] (-428.424) * (-429.487) (-425.735) [-428.120] (-431.135) -- 0:00:25
590000 -- [-426.372] (-430.017) (-428.604) (-427.800) * [-430.787] (-429.179) (-427.165) (-427.855) -- 0:00:25
Average standard deviation of split frequencies: 0.008879
590500 -- [-426.029] (-427.678) (-425.963) (-430.733) * [-424.968] (-428.877) (-432.312) (-426.236) -- 0:00:25
591000 -- (-427.256) (-426.639) (-426.963) [-427.425] * (-427.167) [-426.304] (-427.706) (-428.296) -- 0:00:25
591500 -- (-428.595) [-426.607] (-427.953) (-430.319) * (-426.613) (-431.872) (-430.020) [-427.104] -- 0:00:26
592000 -- (-428.754) (-426.778) [-429.031] (-431.636) * (-426.930) [-431.372] (-426.987) (-428.375) -- 0:00:26
592500 -- (-428.853) (-428.331) [-427.420] (-429.587) * [-430.308] (-430.772) (-429.121) (-426.889) -- 0:00:26
593000 -- (-425.950) (-431.917) [-430.722] (-429.258) * [-427.650] (-427.153) (-428.542) (-427.399) -- 0:00:26
593500 -- [-426.705] (-427.691) (-428.545) (-426.686) * (-426.322) [-426.047] (-428.314) (-426.728) -- 0:00:26
594000 -- (-428.338) (-430.165) [-428.974] (-428.282) * [-427.862] (-431.537) (-428.001) (-428.692) -- 0:00:25
594500 -- (-426.366) [-427.210] (-424.840) (-428.765) * (-427.102) (-435.841) (-427.120) [-428.749] -- 0:00:25
595000 -- [-428.298] (-436.168) (-435.887) (-429.741) * (-429.541) (-436.763) [-428.604] (-429.120) -- 0:00:25
Average standard deviation of split frequencies: 0.008948
595500 -- (-427.932) (-428.973) (-430.479) [-428.005] * (-430.032) (-429.381) (-428.482) [-426.595] -- 0:00:25
596000 -- (-426.386) (-426.863) (-428.103) [-429.279] * (-429.167) (-428.990) [-428.676] (-425.255) -- 0:00:25
596500 -- (-427.128) (-431.636) [-427.884] (-429.600) * (-428.183) (-426.443) (-429.135) [-429.865] -- 0:00:25
597000 -- (-427.829) (-427.085) [-425.240] (-429.005) * (-426.968) (-429.052) (-427.636) [-427.628] -- 0:00:25
597500 -- [-427.707] (-427.511) (-434.115) (-427.325) * (-433.887) [-428.086] (-427.258) (-427.026) -- 0:00:25
598000 -- (-427.116) (-426.616) [-428.334] (-427.279) * (-428.859) (-431.170) [-424.573] (-427.814) -- 0:00:25
598500 -- [-426.525] (-426.352) (-428.192) (-428.589) * (-430.521) [-426.238] (-429.015) (-428.161) -- 0:00:25
599000 -- (-428.716) [-427.927] (-427.168) (-429.257) * (-431.292) [-432.103] (-431.083) (-429.306) -- 0:00:25
599500 -- [-428.291] (-429.787) (-431.807) (-428.143) * (-427.893) [-430.659] (-430.728) (-429.770) -- 0:00:25
600000 -- (-428.556) (-426.975) [-430.162] (-427.903) * (-425.084) (-425.858) [-430.128] (-427.286) -- 0:00:25
Average standard deviation of split frequencies: 0.008633
600500 -- (-428.526) (-426.590) [-428.849] (-427.030) * (-426.783) (-425.969) [-428.063] (-430.734) -- 0:00:25
601000 -- (-428.777) (-426.943) [-426.540] (-428.041) * (-428.713) [-429.052] (-427.417) (-429.819) -- 0:00:25
601500 -- (-430.573) (-426.442) [-429.310] (-427.824) * [-430.864] (-428.324) (-430.528) (-437.540) -- 0:00:25
602000 -- (-426.252) [-428.830] (-429.120) (-426.839) * [-427.131] (-429.538) (-426.417) (-432.757) -- 0:00:25
602500 -- (-427.804) (-428.635) (-430.046) [-427.786] * (-425.429) (-425.837) [-429.645] (-427.991) -- 0:00:25
603000 -- [-427.839] (-427.680) (-428.855) (-429.149) * (-427.484) [-427.183] (-432.102) (-430.932) -- 0:00:25
603500 -- [-426.492] (-428.757) (-427.257) (-430.364) * (-430.036) [-426.768] (-427.772) (-427.064) -- 0:00:24
604000 -- (-425.588) (-426.654) [-428.578] (-427.915) * (-429.650) [-428.296] (-432.323) (-434.002) -- 0:00:24
604500 -- (-425.970) [-426.327] (-426.488) (-430.602) * (-426.976) [-429.293] (-432.648) (-428.051) -- 0:00:24
605000 -- (-426.743) [-426.319] (-426.505) (-428.452) * (-429.710) (-435.813) [-430.753] (-427.737) -- 0:00:24
Average standard deviation of split frequencies: 0.008654
605500 -- (-429.292) [-426.279] (-427.116) (-428.696) * (-429.918) [-428.524] (-430.362) (-426.822) -- 0:00:24
606000 -- (-426.667) (-427.149) [-425.911] (-429.044) * [-429.163] (-432.350) (-429.491) (-429.323) -- 0:00:24
606500 -- [-426.917] (-425.237) (-432.386) (-427.593) * (-434.010) (-429.769) (-429.478) [-427.117] -- 0:00:24
607000 -- [-429.726] (-426.800) (-429.141) (-426.321) * (-426.864) [-429.456] (-433.011) (-430.903) -- 0:00:25
607500 -- (-427.107) (-426.702) (-430.796) [-426.718] * [-428.177] (-429.319) (-428.781) (-428.948) -- 0:00:25
608000 -- (-424.981) (-433.366) (-429.906) [-429.195] * [-429.674] (-432.277) (-427.550) (-426.816) -- 0:00:25
608500 -- [-425.301] (-428.039) (-433.001) (-433.093) * (-427.101) (-432.924) (-426.060) [-427.783] -- 0:00:25
609000 -- (-424.728) [-429.074] (-427.423) (-428.903) * [-428.723] (-426.235) (-426.714) (-429.458) -- 0:00:25
609500 -- (-427.578) (-427.269) (-426.374) [-429.525] * (-426.252) [-427.547] (-427.149) (-428.094) -- 0:00:24
610000 -- (-426.752) (-426.003) (-427.972) [-427.934] * [-428.303] (-427.457) (-429.763) (-431.184) -- 0:00:24
Average standard deviation of split frequencies: 0.009022
610500 -- (-428.527) [-426.824] (-429.048) (-428.486) * [-428.051] (-427.364) (-427.841) (-426.623) -- 0:00:24
611000 -- (-429.939) (-426.323) (-427.950) [-427.126] * (-429.477) (-427.750) [-428.345] (-428.853) -- 0:00:24
611500 -- [-428.519] (-426.921) (-430.593) (-431.463) * (-430.649) (-428.487) [-427.647] (-427.334) -- 0:00:24
612000 -- (-426.364) (-429.194) [-427.280] (-429.203) * (-428.134) (-429.250) (-430.211) [-428.139] -- 0:00:24
612500 -- (-427.657) [-425.788] (-426.731) (-431.429) * (-428.450) (-427.915) (-429.979) [-425.978] -- 0:00:24
613000 -- (-434.657) (-426.496) (-426.708) [-428.003] * (-432.125) (-427.616) [-427.601] (-427.327) -- 0:00:24
613500 -- (-435.435) [-429.062] (-429.868) (-426.590) * (-435.732) [-427.498] (-430.572) (-427.795) -- 0:00:24
614000 -- (-425.325) [-429.809] (-428.657) (-432.474) * (-428.278) (-430.890) (-428.128) [-429.604] -- 0:00:24
614500 -- (-425.775) (-425.663) [-427.747] (-429.385) * [-432.378] (-429.553) (-427.890) (-429.738) -- 0:00:24
615000 -- (-427.717) [-428.255] (-427.832) (-427.643) * [-428.333] (-426.428) (-429.500) (-430.380) -- 0:00:24
Average standard deviation of split frequencies: 0.009183
615500 -- (-428.549) (-430.599) [-427.204] (-428.568) * (-432.396) [-427.219] (-426.309) (-428.978) -- 0:00:24
616000 -- (-428.278) (-426.849) [-427.321] (-426.360) * (-429.009) [-426.896] (-428.376) (-427.562) -- 0:00:24
616500 -- (-429.117) [-428.164] (-428.818) (-429.262) * (-428.607) [-427.815] (-427.621) (-426.165) -- 0:00:24
617000 -- (-437.948) [-428.946] (-428.505) (-428.372) * (-428.866) (-428.370) [-428.257] (-430.724) -- 0:00:24
617500 -- (-429.548) [-434.123] (-426.742) (-426.589) * (-430.577) (-429.019) (-429.092) [-427.142] -- 0:00:24
618000 -- (-431.318) (-429.761) (-428.831) [-428.582] * (-430.975) (-428.384) [-427.193] (-426.595) -- 0:00:24
618500 -- (-431.235) [-429.166] (-428.864) (-429.405) * [-430.344] (-427.252) (-430.721) (-427.170) -- 0:00:24
619000 -- (-429.123) [-432.687] (-429.585) (-432.916) * (-428.466) [-431.332] (-429.499) (-429.709) -- 0:00:24
619500 -- [-428.364] (-436.551) (-428.099) (-432.927) * (-426.686) [-428.929] (-428.356) (-427.609) -- 0:00:23
620000 -- (-427.019) [-427.271] (-427.518) (-433.272) * (-431.032) [-428.586] (-431.608) (-427.265) -- 0:00:23
Average standard deviation of split frequencies: 0.009162
620500 -- [-426.902] (-426.550) (-426.423) (-434.324) * (-428.161) (-427.262) (-428.277) [-425.315] -- 0:00:23
621000 -- (-427.635) [-427.668] (-433.621) (-430.445) * (-432.282) (-428.504) [-427.146] (-428.577) -- 0:00:23
621500 -- [-426.855] (-425.788) (-430.600) (-429.766) * [-426.852] (-427.849) (-428.695) (-430.070) -- 0:00:23
622000 -- (-426.933) (-430.190) [-428.725] (-425.682) * (-432.822) (-428.411) [-428.836] (-433.471) -- 0:00:23
622500 -- (-428.246) (-430.433) (-431.862) [-425.917] * (-429.603) [-427.002] (-427.084) (-429.673) -- 0:00:23
623000 -- (-430.112) (-432.704) [-434.877] (-426.169) * (-427.002) (-430.646) [-430.333] (-428.507) -- 0:00:24
623500 -- (-426.524) (-430.640) (-431.371) [-430.767] * (-428.119) [-429.765] (-428.329) (-426.660) -- 0:00:24
624000 -- (-426.165) (-432.175) [-427.926] (-430.909) * [-427.939] (-427.268) (-426.748) (-428.569) -- 0:00:24
624500 -- (-427.878) (-428.264) [-429.315] (-427.576) * (-428.433) [-428.582] (-428.353) (-428.455) -- 0:00:24
625000 -- [-426.973] (-430.023) (-429.911) (-427.397) * [-426.887] (-430.857) (-428.303) (-428.262) -- 0:00:24
Average standard deviation of split frequencies: 0.009460
625500 -- (-429.254) (-428.135) [-429.574] (-429.106) * (-427.424) (-430.790) [-429.885] (-428.681) -- 0:00:23
626000 -- (-428.617) [-427.269] (-428.909) (-426.813) * [-428.100] (-430.441) (-427.844) (-428.320) -- 0:00:23
626500 -- (-428.736) (-428.401) [-432.610] (-428.747) * (-431.866) (-432.688) (-430.662) [-426.936] -- 0:00:23
627000 -- (-429.834) (-428.561) [-430.509] (-431.675) * (-430.683) (-429.346) [-428.661] (-427.445) -- 0:00:23
627500 -- (-427.026) [-425.511] (-426.889) (-427.904) * [-429.714] (-430.871) (-429.882) (-427.111) -- 0:00:23
628000 -- (-428.987) (-426.957) [-427.777] (-433.927) * (-427.770) (-430.102) (-427.077) [-426.763] -- 0:00:23
628500 -- (-426.094) (-431.490) [-432.991] (-428.979) * (-429.432) (-426.326) (-425.502) [-426.377] -- 0:00:23
629000 -- (-427.323) (-425.164) [-428.036] (-432.911) * (-428.938) (-431.339) (-427.235) [-426.665] -- 0:00:23
629500 -- [-430.440] (-426.885) (-426.562) (-427.467) * (-428.726) (-429.932) (-433.358) [-428.225] -- 0:00:23
630000 -- (-430.050) [-425.679] (-425.660) (-427.608) * [-429.214] (-431.476) (-429.330) (-426.686) -- 0:00:23
Average standard deviation of split frequencies: 0.008829
630500 -- (-430.917) (-429.294) (-426.596) [-428.572] * [-426.269] (-429.132) (-427.952) (-429.698) -- 0:00:23
631000 -- (-424.889) (-427.009) (-429.502) [-426.416] * (-429.378) (-428.043) (-426.111) [-433.771] -- 0:00:23
631500 -- (-430.381) (-429.738) [-429.765] (-430.057) * (-428.557) [-426.267] (-426.594) (-430.126) -- 0:00:23
632000 -- [-427.363] (-429.817) (-429.113) (-429.602) * (-432.598) [-432.158] (-429.650) (-430.931) -- 0:00:23
632500 -- (-425.672) (-429.817) [-429.354] (-427.990) * (-430.824) [-429.436] (-425.564) (-434.745) -- 0:00:23
633000 -- (-426.478) (-428.588) (-430.145) [-427.910] * [-434.746] (-429.057) (-429.010) (-429.293) -- 0:00:23
633500 -- (-429.325) [-428.363] (-430.298) (-428.781) * [-429.385] (-427.647) (-429.120) (-427.354) -- 0:00:23
634000 -- [-428.145] (-430.313) (-425.953) (-431.088) * (-429.847) [-429.803] (-426.898) (-427.997) -- 0:00:23
634500 -- [-428.544] (-428.091) (-429.923) (-431.792) * (-431.192) (-428.488) [-427.381] (-432.862) -- 0:00:23
635000 -- (-426.533) (-428.414) (-428.933) [-426.995] * [-427.239] (-429.284) (-435.542) (-426.835) -- 0:00:22
Average standard deviation of split frequencies: 0.008431
635500 -- (-429.251) (-428.166) [-429.869] (-428.510) * (-428.070) (-429.728) (-426.634) [-429.483] -- 0:00:22
636000 -- (-428.062) (-429.636) (-427.366) [-427.111] * (-432.859) (-428.658) [-428.205] (-433.287) -- 0:00:22
636500 -- [-426.024] (-429.464) (-427.818) (-428.978) * (-427.113) (-436.880) (-431.427) [-427.514] -- 0:00:22
637000 -- [-427.416] (-430.632) (-427.976) (-427.628) * (-428.539) (-429.969) (-427.363) [-430.910] -- 0:00:22
637500 -- [-427.723] (-430.616) (-429.703) (-427.074) * (-430.310) (-429.847) (-428.774) [-429.183] -- 0:00:22
638000 -- [-427.853] (-430.024) (-429.044) (-426.049) * (-431.929) (-433.189) (-427.176) [-426.961] -- 0:00:22
638500 -- (-429.035) (-427.557) [-428.997] (-425.590) * (-429.524) (-430.802) (-429.674) [-428.821] -- 0:00:22
639000 -- [-427.437] (-433.605) (-431.674) (-429.285) * [-429.514] (-427.018) (-429.069) (-427.989) -- 0:00:23
639500 -- (-426.866) (-428.695) [-427.886] (-429.125) * (-430.094) (-427.136) [-429.770] (-429.067) -- 0:00:23
640000 -- (-429.444) [-428.657] (-430.094) (-433.785) * [-428.354] (-430.583) (-428.207) (-426.277) -- 0:00:23
Average standard deviation of split frequencies: 0.008416
640500 -- (-430.885) (-430.647) [-426.788] (-433.034) * (-429.313) (-431.256) [-429.065] (-427.857) -- 0:00:23
641000 -- [-430.563] (-429.745) (-430.417) (-430.284) * (-430.948) (-431.166) [-426.064] (-427.015) -- 0:00:22
641500 -- (-427.703) (-430.929) [-429.274] (-425.980) * (-429.205) (-430.033) (-429.239) [-427.235] -- 0:00:22
642000 -- (-428.109) (-431.242) (-427.159) [-428.048] * (-428.274) (-428.267) [-428.939] (-427.486) -- 0:00:22
642500 -- (-428.891) (-428.702) [-427.215] (-429.043) * (-429.387) [-429.253] (-427.996) (-426.750) -- 0:00:22
643000 -- (-427.149) (-428.016) [-430.907] (-429.465) * (-432.933) (-437.013) [-429.190] (-426.638) -- 0:00:22
643500 -- (-428.608) (-430.117) (-428.689) [-430.482] * [-434.920] (-430.491) (-428.521) (-428.752) -- 0:00:22
644000 -- [-427.491] (-431.515) (-428.648) (-430.138) * (-431.841) (-427.192) [-428.143] (-427.886) -- 0:00:22
644500 -- (-431.558) [-428.244] (-431.628) (-431.577) * [-429.596] (-427.264) (-427.008) (-424.425) -- 0:00:22
645000 -- [-430.798] (-425.957) (-433.549) (-428.254) * (-429.425) (-430.850) (-427.474) [-427.286] -- 0:00:22
Average standard deviation of split frequencies: 0.008757
645500 -- (-431.984) (-427.971) [-428.205] (-426.966) * (-427.638) (-426.757) [-429.236] (-429.182) -- 0:00:22
646000 -- (-433.452) (-428.291) (-428.974) [-430.064] * (-428.950) (-427.112) [-427.497] (-430.615) -- 0:00:22
646500 -- (-433.379) (-430.340) (-430.077) [-428.922] * (-429.676) (-428.951) [-426.501] (-427.577) -- 0:00:22
647000 -- (-429.211) (-429.731) [-427.447] (-428.352) * (-428.255) (-430.230) (-428.991) [-427.964] -- 0:00:22
647500 -- (-431.319) [-428.990] (-428.174) (-429.120) * (-429.578) [-426.917] (-429.700) (-428.036) -- 0:00:22
648000 -- (-431.690) (-429.977) [-428.435] (-428.239) * (-431.648) (-426.295) (-428.611) [-429.179] -- 0:00:22
648500 -- (-429.704) [-426.097] (-429.749) (-428.419) * (-430.930) (-426.779) (-427.968) [-427.592] -- 0:00:22
649000 -- (-429.681) [-427.786] (-427.988) (-434.168) * (-429.255) (-428.285) (-428.676) [-429.722] -- 0:00:22
649500 -- (-430.402) (-431.427) (-426.672) [-428.240] * (-432.511) (-428.827) (-429.332) [-426.814] -- 0:00:22
650000 -- [-428.559] (-427.738) (-427.114) (-430.845) * (-433.952) (-428.642) [-427.095] (-428.571) -- 0:00:22
Average standard deviation of split frequencies: 0.008737
650500 -- (-428.152) (-430.584) [-427.850] (-430.030) * (-433.853) (-427.339) [-429.640] (-431.254) -- 0:00:22
651000 -- (-430.828) [-430.886] (-431.779) (-432.025) * (-429.896) (-428.373) (-431.237) [-428.180] -- 0:00:21
651500 -- (-428.613) [-429.674] (-430.542) (-432.162) * [-427.964] (-431.221) (-430.194) (-427.080) -- 0:00:21
652000 -- [-427.805] (-429.681) (-429.606) (-430.818) * (-429.961) (-430.564) [-425.540] (-429.298) -- 0:00:21
652500 -- (-431.260) (-432.066) (-429.476) [-428.252] * (-428.178) [-426.592] (-429.452) (-430.863) -- 0:00:21
653000 -- (-433.257) [-430.285] (-427.604) (-429.526) * (-428.626) (-428.800) (-434.909) [-424.484] -- 0:00:21
653500 -- (-426.958) [-426.453] (-427.435) (-429.902) * (-427.906) (-427.256) [-427.433] (-429.058) -- 0:00:21
654000 -- (-428.974) [-428.143] (-429.579) (-429.082) * (-429.579) [-429.790] (-429.291) (-430.055) -- 0:00:21
654500 -- (-429.174) (-429.534) [-429.075] (-429.898) * (-428.267) (-427.955) [-427.460] (-426.052) -- 0:00:22
655000 -- (-432.482) (-429.299) [-430.515] (-426.664) * (-427.334) [-428.351] (-429.163) (-428.332) -- 0:00:22
Average standard deviation of split frequencies: 0.007815
655500 -- [-427.623] (-427.589) (-432.833) (-430.493) * (-426.136) (-426.722) (-432.802) [-428.543] -- 0:00:22
656000 -- (-428.882) [-429.083] (-427.290) (-429.133) * (-429.083) (-442.006) (-428.243) [-429.580] -- 0:00:22
656500 -- [-426.758] (-429.978) (-428.084) (-429.046) * (-433.654) (-429.322) (-430.282) [-429.874] -- 0:00:21
657000 -- (-429.412) [-429.887] (-431.650) (-429.727) * (-430.437) (-427.453) [-427.998] (-430.939) -- 0:00:21
657500 -- (-429.065) [-427.828] (-428.341) (-430.235) * (-428.804) [-429.928] (-430.335) (-428.843) -- 0:00:21
658000 -- [-430.045] (-428.030) (-428.045) (-431.180) * [-432.726] (-425.335) (-433.129) (-429.580) -- 0:00:21
658500 -- (-432.839) (-427.033) (-429.615) [-430.608] * (-432.330) [-428.616] (-426.886) (-429.718) -- 0:00:21
659000 -- [-427.173] (-427.397) (-428.481) (-429.776) * (-433.413) [-425.298] (-428.139) (-428.918) -- 0:00:21
659500 -- (-427.687) (-427.700) [-426.449] (-431.169) * (-431.587) (-425.392) [-424.912] (-427.684) -- 0:00:21
660000 -- [-428.109] (-428.052) (-431.941) (-429.147) * [-428.607] (-428.106) (-428.817) (-432.823) -- 0:00:21
Average standard deviation of split frequencies: 0.007447
660500 -- (-428.972) (-429.764) [-426.041] (-430.200) * [-428.416] (-433.209) (-430.581) (-426.004) -- 0:00:21
661000 -- [-428.727] (-426.516) (-426.484) (-427.605) * (-428.269) (-428.598) (-430.518) [-430.359] -- 0:00:21
661500 -- (-427.717) (-426.689) [-426.529] (-427.332) * (-428.498) (-426.920) [-427.136] (-429.946) -- 0:00:21
662000 -- [-424.878] (-427.128) (-425.785) (-429.046) * (-429.921) (-427.374) [-428.239] (-428.232) -- 0:00:21
662500 -- [-425.778] (-426.635) (-426.665) (-428.607) * [-428.726] (-426.665) (-433.031) (-432.768) -- 0:00:21
663000 -- (-430.419) (-428.580) (-428.013) [-425.957] * [-430.362] (-427.174) (-429.391) (-430.534) -- 0:00:21
663500 -- (-428.873) [-429.080] (-427.368) (-427.861) * [-428.206] (-430.628) (-428.851) (-429.265) -- 0:00:21
664000 -- (-429.588) [-428.153] (-431.295) (-428.298) * [-428.361] (-430.051) (-430.179) (-429.209) -- 0:00:21
664500 -- (-426.384) (-428.177) [-427.919] (-430.768) * [-430.463] (-431.252) (-428.501) (-429.993) -- 0:00:21
665000 -- (-429.416) [-426.194] (-425.581) (-429.421) * [-432.429] (-426.456) (-430.341) (-428.444) -- 0:00:21
Average standard deviation of split frequencies: 0.008369
665500 -- (-432.533) [-427.784] (-432.733) (-427.496) * (-430.717) (-425.433) [-430.477] (-430.515) -- 0:00:21
666000 -- (-427.082) (-431.861) (-429.276) [-428.646] * (-430.157) (-429.028) [-426.023] (-430.046) -- 0:00:21
666500 -- [-427.156] (-428.474) (-428.165) (-429.915) * (-428.591) (-426.911) (-429.672) [-433.200] -- 0:00:21
667000 -- [-426.227] (-432.404) (-428.620) (-429.300) * (-428.937) (-425.333) [-434.030] (-435.679) -- 0:00:20
667500 -- [-426.245] (-429.856) (-430.702) (-427.515) * (-429.666) [-428.164] (-428.933) (-430.695) -- 0:00:20
668000 -- (-427.511) [-429.596] (-426.259) (-429.585) * (-428.547) [-426.368] (-428.837) (-432.544) -- 0:00:20
668500 -- (-426.626) (-431.479) (-425.691) [-427.432] * (-426.323) [-424.477] (-430.073) (-430.306) -- 0:00:20
669000 -- (-430.071) (-430.820) (-426.601) [-431.341] * [-429.732] (-426.014) (-428.561) (-426.577) -- 0:00:20
669500 -- [-427.190] (-427.885) (-429.510) (-429.486) * (-429.098) [-427.502] (-429.705) (-427.890) -- 0:00:20
670000 -- (-429.092) (-428.446) (-432.647) [-430.058] * (-430.676) [-424.793] (-429.783) (-427.885) -- 0:00:20
Average standard deviation of split frequencies: 0.008807
670500 -- (-427.733) [-429.082] (-426.367) (-427.399) * [-429.664] (-425.137) (-430.949) (-428.640) -- 0:00:21
671000 -- (-429.686) (-427.968) [-425.847] (-428.367) * (-429.411) (-428.975) (-427.651) [-428.522] -- 0:00:21
671500 -- (-431.910) (-430.034) [-429.288] (-428.476) * (-429.297) [-428.859] (-430.670) (-426.689) -- 0:00:21
672000 -- (-427.640) (-428.611) (-428.001) [-429.406] * (-427.849) [-425.430] (-432.005) (-427.388) -- 0:00:20
672500 -- (-426.311) [-427.925] (-428.126) (-426.430) * [-428.126] (-427.894) (-432.226) (-432.034) -- 0:00:20
673000 -- (-428.719) (-431.770) (-429.369) [-427.997] * (-430.046) [-426.551] (-430.819) (-427.637) -- 0:00:20
673500 -- (-429.411) (-429.042) [-431.900] (-431.822) * (-427.080) (-428.179) [-430.124] (-428.172) -- 0:00:20
674000 -- [-427.701] (-428.733) (-428.230) (-427.254) * [-430.200] (-426.591) (-426.238) (-428.048) -- 0:00:20
674500 -- [-427.571] (-431.838) (-426.768) (-427.591) * [-430.113] (-427.415) (-426.328) (-429.425) -- 0:00:20
675000 -- [-428.673] (-431.940) (-427.250) (-428.353) * (-430.792) (-429.385) (-427.635) [-425.912] -- 0:00:20
Average standard deviation of split frequencies: 0.008778
675500 -- [-430.516] (-427.698) (-427.926) (-426.588) * (-428.902) (-426.995) [-427.094] (-427.613) -- 0:00:20
676000 -- (-429.644) (-428.014) [-425.190] (-426.006) * (-432.394) [-428.445] (-429.471) (-428.591) -- 0:00:20
676500 -- [-428.803] (-428.700) (-426.645) (-428.158) * [-430.451] (-432.303) (-428.505) (-427.247) -- 0:00:20
677000 -- [-428.755] (-432.032) (-425.883) (-429.304) * (-430.119) [-429.625] (-428.701) (-428.590) -- 0:00:20
677500 -- [-427.412] (-429.777) (-427.716) (-429.723) * (-428.710) (-428.536) [-429.157] (-428.467) -- 0:00:20
678000 -- [-430.755] (-429.275) (-426.217) (-428.270) * (-427.249) [-433.539] (-428.405) (-430.827) -- 0:00:20
678500 -- (-432.447) (-430.258) (-427.653) [-428.788] * (-428.536) (-426.314) (-426.769) [-429.559] -- 0:00:20
679000 -- [-430.505] (-433.650) (-428.536) (-427.505) * (-433.099) (-428.593) (-430.834) [-430.424] -- 0:00:20
679500 -- (-426.566) (-427.877) (-427.546) [-433.159] * [-433.201] (-427.460) (-430.657) (-428.252) -- 0:00:20
680000 -- (-426.304) (-427.213) (-427.778) [-428.859] * (-429.714) (-427.592) [-431.555] (-428.166) -- 0:00:20
Average standard deviation of split frequencies: 0.008800
680500 -- [-426.527] (-430.063) (-428.084) (-427.915) * (-428.555) (-428.556) (-431.556) [-426.632] -- 0:00:20
681000 -- [-424.318] (-430.568) (-429.243) (-432.764) * (-426.622) (-429.002) [-430.323] (-430.074) -- 0:00:20
681500 -- [-427.113] (-429.111) (-428.500) (-431.222) * (-426.575) (-428.988) (-432.994) [-431.434] -- 0:00:20
682000 -- (-426.438) (-429.304) [-429.855] (-427.430) * (-428.787) [-428.827] (-430.130) (-426.574) -- 0:00:20
682500 -- (-429.692) (-432.359) [-427.502] (-427.422) * (-430.813) [-426.185] (-430.617) (-426.547) -- 0:00:20
683000 -- (-431.252) (-434.056) (-427.543) [-429.036] * [-430.297] (-427.147) (-427.625) (-434.710) -- 0:00:19
683500 -- [-427.486] (-427.888) (-426.958) (-428.791) * (-429.120) [-426.309] (-430.099) (-426.945) -- 0:00:19
684000 -- [-427.872] (-435.475) (-426.976) (-426.848) * [-431.685] (-427.140) (-427.986) (-429.935) -- 0:00:19
684500 -- [-425.433] (-429.239) (-426.974) (-428.045) * [-431.478] (-428.399) (-428.847) (-431.391) -- 0:00:19
685000 -- [-427.151] (-428.791) (-429.397) (-429.712) * (-430.742) (-426.797) [-428.496] (-430.749) -- 0:00:19
Average standard deviation of split frequencies: 0.008367
685500 -- (-430.495) [-427.941] (-427.796) (-429.451) * (-430.789) (-428.649) [-430.006] (-427.940) -- 0:00:19
686000 -- (-429.459) (-431.111) [-431.566] (-428.759) * (-430.314) (-429.370) (-430.748) [-428.419] -- 0:00:19
686500 -- (-428.027) (-432.993) [-426.047] (-429.205) * [-428.709] (-430.756) (-431.156) (-428.059) -- 0:00:20
687000 -- (-428.926) (-428.757) [-425.145] (-426.679) * [-427.152] (-429.624) (-431.455) (-432.677) -- 0:00:20
687500 -- (-429.139) (-427.668) [-428.174] (-432.787) * (-427.528) [-430.543] (-431.253) (-430.290) -- 0:00:20
688000 -- [-427.716] (-426.868) (-429.651) (-429.853) * (-429.651) (-433.026) [-427.389] (-427.823) -- 0:00:19
688500 -- (-430.301) (-428.734) [-427.957] (-433.545) * (-431.975) (-428.187) (-428.545) [-428.425] -- 0:00:19
689000 -- (-430.099) [-426.775] (-427.709) (-429.222) * (-430.549) (-431.401) (-430.772) [-429.233] -- 0:00:19
689500 -- (-429.128) [-427.229] (-428.786) (-430.109) * (-433.623) (-432.454) (-434.097) [-428.942] -- 0:00:19
690000 -- (-431.041) [-429.482] (-427.704) (-429.998) * (-431.607) (-428.112) (-430.180) [-425.916] -- 0:00:19
Average standard deviation of split frequencies: 0.008231
690500 -- [-428.652] (-426.304) (-429.386) (-429.585) * (-427.428) [-425.501] (-428.680) (-426.295) -- 0:00:19
691000 -- [-427.672] (-427.303) (-427.585) (-433.990) * (-430.545) (-430.654) [-427.704] (-430.162) -- 0:00:19
691500 -- [-430.098] (-428.814) (-429.323) (-434.961) * (-432.693) [-425.006] (-427.533) (-426.005) -- 0:00:19
692000 -- (-429.608) (-429.417) [-426.563] (-430.105) * (-430.512) (-425.845) (-428.746) [-429.371] -- 0:00:19
692500 -- (-430.645) (-432.781) [-427.973] (-429.426) * (-432.137) (-432.402) (-430.847) [-430.263] -- 0:00:19
693000 -- (-429.023) (-426.801) [-426.986] (-429.602) * (-430.889) (-427.564) (-427.735) [-426.064] -- 0:00:19
693500 -- (-430.467) (-429.395) [-427.074] (-429.571) * (-429.812) (-431.466) [-429.367] (-428.138) -- 0:00:19
694000 -- (-428.320) (-431.513) (-432.456) [-430.589] * (-428.303) [-427.937] (-428.739) (-428.858) -- 0:00:19
694500 -- (-428.924) (-430.450) [-428.839] (-429.628) * (-431.008) (-428.872) [-428.179] (-428.236) -- 0:00:19
695000 -- (-430.192) (-429.802) [-429.562] (-428.531) * (-429.196) (-429.747) [-432.145] (-426.077) -- 0:00:19
Average standard deviation of split frequencies: 0.007874
695500 -- (-429.402) (-428.268) (-425.177) [-427.783] * (-429.902) (-432.582) [-426.105] (-433.977) -- 0:00:19
696000 -- [-427.148] (-428.219) (-427.668) (-426.838) * (-427.660) (-428.882) [-426.094] (-428.927) -- 0:00:19
696500 -- (-426.648) [-429.040] (-430.492) (-431.716) * (-427.036) [-427.008] (-429.363) (-427.041) -- 0:00:19
697000 -- (-429.329) (-425.165) (-429.122) [-430.480] * (-427.185) (-427.296) [-428.386] (-426.725) -- 0:00:19
697500 -- (-431.087) [-432.797] (-425.819) (-434.530) * (-432.227) (-430.262) [-426.846] (-426.338) -- 0:00:19
698000 -- (-435.587) (-429.641) (-430.511) [-431.757] * (-428.615) [-430.032] (-429.081) (-429.350) -- 0:00:19
698500 -- (-427.283) [-432.855] (-429.871) (-432.812) * (-430.071) (-427.248) [-434.236] (-428.605) -- 0:00:18
699000 -- (-429.468) (-427.295) (-426.703) [-440.076] * [-428.848] (-431.195) (-428.429) (-429.523) -- 0:00:18
699500 -- [-427.177] (-430.864) (-429.527) (-431.019) * (-431.497) (-425.248) [-428.066] (-429.639) -- 0:00:18
700000 -- (-430.710) (-429.413) (-427.680) [-428.041] * (-429.078) (-427.179) [-430.368] (-428.505) -- 0:00:18
Average standard deviation of split frequencies: 0.007821
700500 -- (-428.313) [-426.713] (-427.827) (-430.299) * (-429.056) (-430.530) [-427.286] (-429.873) -- 0:00:18
701000 -- (-429.124) (-428.528) [-426.363] (-429.364) * (-426.845) [-429.584] (-428.966) (-429.747) -- 0:00:18
701500 -- [-427.806] (-427.569) (-428.166) (-432.119) * (-426.862) (-429.928) (-434.943) [-425.521] -- 0:00:18
702000 -- (-429.692) (-427.904) (-427.553) [-432.225] * [-427.960] (-429.338) (-429.998) (-429.002) -- 0:00:19
702500 -- (-429.055) [-428.826] (-428.751) (-431.360) * (-427.295) [-429.169] (-427.170) (-429.394) -- 0:00:19
703000 -- (-428.883) [-425.495] (-427.769) (-427.122) * [-427.654] (-428.057) (-428.794) (-427.828) -- 0:00:19
703500 -- (-428.230) (-428.856) (-429.629) [-426.682] * (-426.789) (-426.894) [-425.662] (-426.987) -- 0:00:18
704000 -- (-433.857) (-428.986) (-427.361) [-426.608] * (-426.544) (-428.834) (-426.653) [-431.400] -- 0:00:18
704500 -- (-432.866) (-426.320) [-425.900] (-430.573) * [-427.227] (-430.305) (-434.616) (-431.808) -- 0:00:18
705000 -- (-432.807) (-427.619) (-427.984) [-427.632] * [-431.542] (-432.357) (-429.964) (-425.898) -- 0:00:18
Average standard deviation of split frequencies: 0.007777
705500 -- [-426.435] (-426.130) (-429.413) (-431.521) * (-429.236) (-430.928) [-428.730] (-427.842) -- 0:00:18
706000 -- (-427.151) [-425.938] (-431.219) (-428.780) * [-425.758] (-431.918) (-428.358) (-429.753) -- 0:00:18
706500 -- [-427.205] (-429.185) (-429.852) (-429.146) * [-425.941] (-429.757) (-428.805) (-430.045) -- 0:00:18
707000 -- (-431.556) (-427.654) [-427.509] (-428.299) * [-425.712] (-429.602) (-432.196) (-428.838) -- 0:00:18
707500 -- [-429.099] (-428.719) (-429.803) (-429.549) * (-426.625) (-426.914) (-437.273) [-428.260] -- 0:00:18
708000 -- [-430.534] (-425.537) (-427.716) (-429.512) * (-428.710) (-426.891) (-428.989) [-425.751] -- 0:00:18
708500 -- (-430.476) (-426.077) (-428.333) [-427.333] * (-427.003) (-425.959) [-429.811] (-427.040) -- 0:00:18
709000 -- (-425.510) [-427.279] (-431.394) (-437.016) * (-429.223) (-429.634) [-431.768] (-429.925) -- 0:00:18
709500 -- (-427.686) (-425.793) (-427.502) [-427.228] * (-427.002) (-428.438) [-432.259] (-435.652) -- 0:00:18
710000 -- (-429.273) [-425.851] (-429.634) (-427.337) * (-425.874) (-427.878) (-426.935) [-429.452] -- 0:00:18
Average standard deviation of split frequencies: 0.007687
710500 -- (-429.729) (-426.373) (-426.429) [-427.222] * [-428.108] (-426.030) (-426.483) (-430.664) -- 0:00:18
711000 -- (-425.994) [-427.874] (-431.673) (-426.746) * (-424.866) (-431.797) (-428.512) [-429.180] -- 0:00:18
711500 -- (-427.884) (-425.678) [-427.716] (-427.267) * [-428.392] (-426.570) (-429.325) (-427.746) -- 0:00:18
712000 -- (-427.195) (-428.674) (-430.938) [-426.343] * (-424.972) (-426.533) (-428.535) [-426.203] -- 0:00:18
712500 -- (-427.764) (-428.949) [-427.607] (-431.148) * [-426.862] (-426.968) (-430.673) (-428.929) -- 0:00:18
713000 -- (-428.354) (-427.126) [-427.488] (-430.898) * [-431.476] (-427.060) (-428.250) (-427.708) -- 0:00:18
713500 -- (-428.924) (-430.089) [-428.153] (-431.004) * [-428.420] (-426.377) (-433.675) (-426.074) -- 0:00:18
714000 -- [-430.394] (-429.605) (-430.982) (-430.129) * (-428.155) (-427.838) (-430.187) [-428.966] -- 0:00:18
714500 -- [-425.871] (-427.215) (-433.037) (-428.759) * (-427.560) [-431.844] (-429.079) (-430.103) -- 0:00:17
715000 -- (-427.017) [-428.971] (-430.164) (-432.034) * (-427.853) [-431.946] (-431.579) (-427.038) -- 0:00:17
Average standard deviation of split frequencies: 0.007901
715500 -- (-428.675) [-426.838] (-431.870) (-432.286) * (-429.651) (-426.114) [-429.155] (-432.458) -- 0:00:17
716000 -- (-429.867) [-427.629] (-428.674) (-431.109) * [-428.523] (-426.944) (-427.151) (-430.447) -- 0:00:17
716500 -- (-428.167) (-426.835) (-430.098) [-425.189] * (-428.359) [-426.747] (-431.473) (-426.561) -- 0:00:17
717000 -- [-426.229] (-430.234) (-426.220) (-430.706) * (-427.572) [-430.961] (-431.966) (-425.636) -- 0:00:17
717500 -- (-427.975) [-425.868] (-427.757) (-433.350) * (-427.427) (-425.819) [-429.668] (-426.112) -- 0:00:18
718000 -- (-427.551) (-427.217) (-427.061) [-426.430] * (-427.780) [-428.833] (-428.249) (-427.883) -- 0:00:18
718500 -- (-425.989) [-425.911] (-427.639) (-427.144) * (-427.438) [-429.223] (-430.625) (-427.742) -- 0:00:18
719000 -- (-433.926) [-427.272] (-426.668) (-426.323) * (-426.227) (-426.251) (-431.260) [-426.270] -- 0:00:17
719500 -- (-428.083) (-428.845) [-428.740] (-428.635) * (-425.724) (-427.950) (-430.264) [-425.542] -- 0:00:17
720000 -- [-427.566] (-429.658) (-429.051) (-425.940) * (-427.758) (-428.593) [-428.900] (-426.302) -- 0:00:17
Average standard deviation of split frequencies: 0.007888
720500 -- (-428.737) (-427.149) [-426.042] (-427.185) * (-429.236) [-430.949] (-433.730) (-428.719) -- 0:00:17
721000 -- (-426.911) (-427.673) (-426.701) [-429.034] * [-425.874] (-427.659) (-428.667) (-430.203) -- 0:00:17
721500 -- (-426.621) [-425.290] (-425.821) (-429.049) * (-427.663) [-432.843] (-428.968) (-430.371) -- 0:00:17
722000 -- [-427.844] (-426.240) (-429.656) (-427.515) * (-429.483) [-428.967] (-433.251) (-428.147) -- 0:00:17
722500 -- [-426.596] (-432.926) (-428.046) (-430.299) * (-426.826) (-431.789) [-429.327] (-430.160) -- 0:00:17
723000 -- (-428.997) (-428.817) (-428.261) [-429.302] * (-427.491) (-432.515) [-430.413] (-429.311) -- 0:00:17
723500 -- (-428.927) (-427.671) (-429.168) [-427.918] * (-431.071) (-432.307) (-428.280) [-428.510] -- 0:00:17
724000 -- (-431.477) (-426.308) [-425.398] (-429.012) * (-428.890) (-426.019) [-430.877] (-427.441) -- 0:00:17
724500 -- (-428.919) (-427.519) [-425.877] (-428.612) * (-429.425) [-431.223] (-429.514) (-429.077) -- 0:00:17
725000 -- (-429.640) (-426.806) [-430.653] (-425.412) * (-429.128) (-430.622) (-430.282) [-428.750] -- 0:00:17
Average standard deviation of split frequencies: 0.007386
725500 -- (-428.809) (-427.556) (-429.814) [-427.601] * (-428.267) (-430.202) [-428.321] (-429.397) -- 0:00:17
726000 -- (-430.784) (-433.631) [-429.334] (-426.712) * (-427.475) (-430.942) [-428.772] (-430.772) -- 0:00:17
726500 -- [-428.456] (-427.307) (-427.282) (-427.389) * (-429.847) (-427.340) [-427.681] (-429.005) -- 0:00:17
727000 -- [-431.894] (-429.262) (-429.158) (-427.008) * (-429.491) (-428.336) (-427.599) [-428.758] -- 0:00:17
727500 -- (-427.739) [-428.662] (-429.323) (-426.749) * (-428.620) (-427.804) [-427.623] (-428.275) -- 0:00:17
728000 -- [-427.666] (-426.888) (-427.600) (-426.193) * (-427.890) (-427.386) (-427.076) [-427.096] -- 0:00:17
728500 -- (-427.268) [-427.579] (-430.529) (-430.046) * (-430.836) (-426.859) (-429.727) [-425.869] -- 0:00:17
729000 -- [-425.719] (-430.083) (-433.055) (-429.940) * (-427.047) (-428.388) (-428.736) [-432.356] -- 0:00:17
729500 -- (-429.796) (-430.234) [-428.591] (-430.976) * (-428.057) (-426.618) [-427.097] (-431.812) -- 0:00:17
730000 -- (-432.245) (-426.922) [-427.219] (-426.453) * (-431.955) (-425.371) (-431.664) [-428.289] -- 0:00:17
Average standard deviation of split frequencies: 0.007178
730500 -- (-431.310) [-431.364] (-430.213) (-428.331) * (-432.984) (-426.786) [-426.783] (-427.587) -- 0:00:16
731000 -- (-434.819) (-428.762) [-429.590] (-428.867) * [-426.821] (-427.496) (-430.884) (-427.740) -- 0:00:16
731500 -- (-431.837) (-428.959) (-427.625) [-426.856] * (-425.434) (-428.048) (-427.690) [-429.308] -- 0:00:16
732000 -- [-428.617] (-428.847) (-426.034) (-431.395) * [-424.881] (-427.212) (-427.995) (-425.729) -- 0:00:16
732500 -- (-428.764) (-428.942) [-428.551] (-426.291) * (-427.843) [-428.808] (-426.964) (-428.188) -- 0:00:16
733000 -- (-433.560) [-429.047] (-427.234) (-426.785) * (-426.444) [-432.852] (-426.277) (-430.712) -- 0:00:16
733500 -- (-435.986) [-425.845] (-428.725) (-428.223) * (-428.926) [-428.490] (-427.073) (-427.905) -- 0:00:17
734000 -- (-431.662) (-426.828) (-428.174) [-429.536] * (-427.619) (-432.519) [-427.453] (-428.944) -- 0:00:17
734500 -- (-429.369) (-428.760) (-428.598) [-425.302] * (-426.206) (-428.298) [-428.420] (-431.695) -- 0:00:16
735000 -- [-429.297] (-427.223) (-427.308) (-428.869) * [-425.921] (-430.217) (-428.969) (-428.265) -- 0:00:16
Average standard deviation of split frequencies: 0.007166
735500 -- (-430.093) (-428.088) (-428.706) [-429.459] * (-429.928) [-429.703] (-430.867) (-428.475) -- 0:00:16
736000 -- [-431.152] (-429.676) (-427.474) (-425.496) * (-426.747) (-428.481) [-431.602] (-429.402) -- 0:00:16
736500 -- (-430.640) (-426.393) [-427.328] (-426.826) * (-428.697) [-432.851] (-428.779) (-427.571) -- 0:00:16
737000 -- (-428.798) (-425.208) (-428.097) [-427.821] * (-428.085) (-429.569) (-426.576) [-426.818] -- 0:00:16
737500 -- (-425.327) (-427.991) (-429.182) [-428.682] * [-429.171] (-429.365) (-428.102) (-426.335) -- 0:00:16
738000 -- (-429.066) (-427.913) (-430.745) [-425.214] * [-431.604] (-429.591) (-426.972) (-427.415) -- 0:00:16
738500 -- (-430.315) (-426.185) [-429.156] (-429.277) * [-427.480] (-436.331) (-428.209) (-432.064) -- 0:00:16
739000 -- (-429.956) [-428.388] (-432.096) (-427.846) * (-430.190) (-430.748) (-429.530) [-427.267] -- 0:00:16
739500 -- (-428.305) [-428.583] (-427.748) (-427.604) * (-428.963) [-426.782] (-425.985) (-429.335) -- 0:00:16
740000 -- (-427.076) [-428.198] (-429.642) (-428.764) * (-431.981) (-427.510) [-429.954] (-426.508) -- 0:00:16
Average standard deviation of split frequencies: 0.006662
740500 -- (-429.731) (-428.606) (-429.977) [-426.125] * [-427.348] (-427.705) (-426.736) (-428.080) -- 0:00:16
741000 -- [-431.158] (-427.392) (-428.196) (-426.548) * [-429.368] (-426.901) (-432.217) (-430.418) -- 0:00:16
741500 -- (-426.798) (-425.755) (-427.399) [-427.215] * (-430.436) (-427.593) (-432.042) [-426.133] -- 0:00:16
742000 -- (-428.501) [-428.360] (-427.499) (-426.834) * [-426.080] (-428.764) (-432.247) (-429.094) -- 0:00:16
742500 -- (-432.401) (-429.319) (-428.564) [-429.913] * (-426.754) [-428.766] (-431.417) (-425.955) -- 0:00:16
743000 -- (-426.582) [-431.520] (-428.765) (-426.216) * (-430.057) (-426.931) [-427.249] (-430.849) -- 0:00:16
743500 -- (-426.974) (-428.870) (-425.879) [-430.332] * [-429.050] (-426.506) (-428.025) (-432.479) -- 0:00:16
744000 -- (-427.519) (-430.403) [-428.805] (-428.797) * (-429.183) (-429.858) (-429.437) [-425.712] -- 0:00:16
744500 -- [-433.052] (-434.397) (-429.250) (-428.002) * (-430.067) (-427.945) [-426.845] (-431.058) -- 0:00:16
745000 -- (-426.339) (-432.201) [-432.276] (-428.973) * (-428.738) (-432.321) (-428.805) [-427.949] -- 0:00:16
Average standard deviation of split frequencies: 0.007030
745500 -- (-427.243) (-429.859) (-428.135) [-425.654] * (-436.404) (-429.596) [-431.631] (-429.556) -- 0:00:16
746000 -- [-426.389] (-425.433) (-427.438) (-427.442) * (-428.755) (-428.863) (-428.254) [-430.221] -- 0:00:16
746500 -- (-425.860) (-429.139) (-428.940) [-428.672] * (-428.112) (-429.193) [-426.302] (-430.552) -- 0:00:15
747000 -- (-426.747) [-430.627] (-429.265) (-428.889) * (-428.409) [-429.906] (-428.544) (-427.780) -- 0:00:15
747500 -- [-427.900] (-426.610) (-427.048) (-426.500) * (-430.672) [-430.858] (-427.993) (-426.909) -- 0:00:15
748000 -- (-430.160) (-431.091) [-428.191] (-429.086) * (-430.268) [-430.012] (-427.405) (-430.238) -- 0:00:15
748500 -- (-435.127) [-431.296] (-435.201) (-428.075) * [-427.268] (-427.579) (-427.316) (-429.659) -- 0:00:15
749000 -- (-436.691) [-427.192] (-431.972) (-427.950) * (-428.000) [-427.168] (-425.900) (-434.295) -- 0:00:16
749500 -- [-426.303] (-428.306) (-429.313) (-428.929) * (-432.474) (-426.578) (-427.624) [-428.988] -- 0:00:16
750000 -- (-426.734) (-431.106) (-425.887) [-428.233] * (-430.866) [-432.476] (-431.517) (-429.214) -- 0:00:16
Average standard deviation of split frequencies: 0.007222
750500 -- (-428.061) (-429.772) (-428.988) [-428.128] * (-427.836) (-431.215) (-431.643) [-427.652] -- 0:00:15
751000 -- [-428.648] (-428.163) (-433.783) (-426.957) * (-428.955) (-431.651) (-429.177) [-426.541] -- 0:00:15
751500 -- (-430.169) [-426.449] (-429.335) (-428.019) * (-429.149) (-429.272) [-427.155] (-429.529) -- 0:00:15
752000 -- (-430.051) (-429.618) [-430.197] (-432.277) * (-434.258) (-432.571) [-428.330] (-433.147) -- 0:00:15
752500 -- [-431.914] (-426.727) (-428.812) (-427.877) * (-428.412) (-427.643) [-426.918] (-429.692) -- 0:00:15
753000 -- [-432.062] (-428.287) (-429.567) (-431.695) * [-427.126] (-429.258) (-428.701) (-429.049) -- 0:00:15
753500 -- [-426.912] (-426.618) (-430.011) (-427.026) * (-427.980) (-431.090) [-429.016] (-429.521) -- 0:00:15
754000 -- (-431.789) (-427.154) (-429.377) [-426.868] * (-426.603) (-431.447) (-428.122) [-428.350] -- 0:00:15
754500 -- (-428.545) (-429.017) (-429.340) [-427.735] * (-429.525) [-428.739] (-426.311) (-430.639) -- 0:00:15
755000 -- (-431.984) (-428.888) (-432.030) [-428.960] * (-426.863) (-428.456) (-429.646) [-428.833] -- 0:00:15
Average standard deviation of split frequencies: 0.006651
755500 -- (-430.503) [-428.443] (-434.271) (-428.795) * [-425.987] (-428.312) (-427.083) (-429.836) -- 0:00:15
756000 -- (-431.086) [-426.761] (-426.915) (-427.050) * [-426.133] (-426.359) (-427.413) (-429.059) -- 0:00:15
756500 -- [-426.847] (-427.968) (-429.702) (-430.170) * (-427.392) [-426.093] (-436.634) (-428.692) -- 0:00:15
757000 -- (-428.238) (-431.815) (-432.822) [-429.573] * (-430.151) [-427.170] (-429.838) (-430.369) -- 0:00:15
757500 -- (-427.983) [-426.289] (-427.103) (-428.381) * (-426.750) (-429.524) [-427.956] (-432.921) -- 0:00:15
758000 -- [-429.170] (-429.656) (-429.571) (-428.104) * (-427.332) (-428.202) [-427.812] (-426.582) -- 0:00:15
758500 -- (-429.663) (-432.741) (-429.526) [-429.395] * (-425.253) (-426.838) (-428.723) [-425.042] -- 0:00:15
759000 -- [-425.847] (-432.500) (-429.621) (-427.094) * (-426.885) (-428.901) (-432.726) [-426.470] -- 0:00:15
759500 -- (-431.384) (-428.407) [-428.368] (-430.203) * (-426.157) (-430.001) (-431.491) [-429.051] -- 0:00:15
760000 -- (-428.771) [-428.845] (-427.333) (-431.855) * (-428.727) (-430.181) (-429.704) [-427.074] -- 0:00:15
Average standard deviation of split frequencies: 0.007127
760500 -- (-429.442) [-429.831] (-426.515) (-429.721) * (-430.324) (-430.637) (-428.013) [-427.349] -- 0:00:15
761000 -- (-430.894) [-428.660] (-429.435) (-430.083) * [-427.377] (-439.267) (-427.458) (-432.047) -- 0:00:15
761500 -- (-430.184) (-428.752) [-425.683] (-428.608) * (-427.375) (-428.306) (-428.764) [-425.755] -- 0:00:15
762000 -- (-431.637) (-430.340) (-427.267) [-431.790] * (-427.998) (-428.129) [-427.887] (-425.940) -- 0:00:14
762500 -- (-427.211) (-431.500) [-429.770] (-427.038) * [-429.181] (-429.509) (-427.191) (-427.290) -- 0:00:14
763000 -- [-426.980] (-430.191) (-428.372) (-429.962) * [-426.425] (-431.396) (-426.779) (-430.870) -- 0:00:14
763500 -- [-426.312] (-430.779) (-429.541) (-427.578) * (-427.738) (-429.903) (-425.442) [-428.010] -- 0:00:14
764000 -- [-426.831] (-427.572) (-427.219) (-427.802) * (-428.362) (-429.384) [-426.434] (-427.555) -- 0:00:14
764500 -- [-428.169] (-429.870) (-427.174) (-433.966) * (-427.650) [-427.711] (-427.051) (-427.442) -- 0:00:14
765000 -- (-430.176) (-426.350) [-427.575] (-428.592) * (-428.927) (-429.224) (-425.003) [-429.635] -- 0:00:15
Average standard deviation of split frequencies: 0.007346
765500 -- (-428.315) (-429.527) (-428.595) [-426.902] * (-433.499) (-432.240) (-427.400) [-426.694] -- 0:00:15
766000 -- [-427.904] (-426.482) (-429.150) (-427.324) * (-432.468) (-428.901) (-428.008) [-428.793] -- 0:00:14
766500 -- [-429.530] (-428.964) (-430.193) (-428.530) * (-428.738) (-428.348) (-433.561) [-426.651] -- 0:00:14
767000 -- (-427.941) (-432.367) [-429.513] (-428.918) * (-428.861) (-429.155) [-428.241] (-425.695) -- 0:00:14
767500 -- [-425.689] (-430.405) (-428.920) (-427.554) * [-428.216] (-427.699) (-426.822) (-430.125) -- 0:00:14
768000 -- [-427.764] (-426.771) (-426.314) (-435.706) * (-431.360) [-426.373] (-432.787) (-428.703) -- 0:00:14
768500 -- [-428.838] (-428.381) (-430.344) (-430.668) * [-427.461] (-428.297) (-431.025) (-429.491) -- 0:00:14
769000 -- (-427.629) [-428.258] (-428.918) (-428.964) * (-429.449) [-428.159] (-433.696) (-428.400) -- 0:00:14
769500 -- (-427.047) (-428.298) (-430.018) [-428.483] * [-427.765] (-430.589) (-429.514) (-429.462) -- 0:00:14
770000 -- (-429.952) [-431.689] (-427.628) (-439.836) * (-427.414) [-428.681] (-435.086) (-429.731) -- 0:00:14
Average standard deviation of split frequencies: 0.007761
770500 -- (-432.924) [-430.299] (-431.757) (-433.434) * (-428.338) (-431.133) (-429.394) [-427.182] -- 0:00:14
771000 -- [-427.959] (-429.036) (-430.603) (-428.525) * (-429.322) (-429.940) (-429.878) [-428.385] -- 0:00:14
771500 -- [-426.398] (-426.915) (-430.981) (-429.006) * (-426.907) (-427.784) (-429.514) [-426.157] -- 0:00:14
772000 -- (-427.149) [-427.708] (-429.016) (-435.491) * (-429.651) (-426.678) [-429.798] (-428.205) -- 0:00:14
772500 -- (-425.516) (-427.534) [-427.786] (-429.189) * (-431.707) (-428.451) [-429.453] (-426.981) -- 0:00:14
773000 -- (-428.161) [-426.449] (-429.692) (-431.522) * [-430.541] (-428.766) (-427.559) (-429.033) -- 0:00:14
773500 -- (-427.429) [-427.237] (-433.087) (-427.974) * [-428.909] (-427.128) (-428.970) (-431.310) -- 0:00:14
774000 -- (-427.855) (-427.989) [-427.449] (-429.042) * [-428.873] (-425.330) (-431.048) (-431.573) -- 0:00:14
774500 -- (-427.783) (-431.097) [-426.895] (-429.411) * (-429.769) [-432.006] (-427.494) (-427.609) -- 0:00:14
775000 -- [-431.123] (-432.342) (-430.016) (-428.242) * [-429.627] (-434.199) (-428.672) (-428.983) -- 0:00:14
Average standard deviation of split frequencies: 0.007654
775500 -- (-426.518) (-427.488) (-431.584) [-427.558] * (-427.547) (-430.041) (-429.348) [-425.642] -- 0:00:14
776000 -- (-430.852) (-428.254) (-431.341) [-429.190] * (-427.939) (-427.741) (-427.247) [-429.643] -- 0:00:14
776500 -- (-430.366) [-426.407] (-431.105) (-427.163) * (-427.016) [-429.242] (-429.244) (-429.707) -- 0:00:14
777000 -- (-429.292) [-428.593] (-432.680) (-429.998) * (-429.072) (-426.980) [-427.014] (-427.991) -- 0:00:14
777500 -- (-432.557) (-428.438) (-431.534) [-428.277] * [-428.730] (-429.971) (-426.330) (-430.027) -- 0:00:14
778000 -- [-429.788] (-430.037) (-429.532) (-426.806) * (-429.673) [-429.443] (-430.089) (-430.433) -- 0:00:13
778500 -- (-426.233) (-427.842) (-430.543) [-430.582] * (-427.993) (-432.235) [-426.644] (-426.758) -- 0:00:13
779000 -- (-428.256) (-427.977) [-428.324] (-429.994) * [-430.032] (-430.889) (-426.493) (-427.077) -- 0:00:13
779500 -- (-427.279) (-429.837) (-428.751) [-432.906] * (-432.538) (-427.457) (-426.535) [-425.249] -- 0:00:13
780000 -- (-425.049) (-430.596) (-426.761) [-426.614] * (-433.615) (-427.137) (-426.291) [-425.403] -- 0:00:13
Average standard deviation of split frequencies: 0.008011
780500 -- (-430.298) (-432.217) [-426.181] (-430.655) * [-432.009] (-429.346) (-427.636) (-427.109) -- 0:00:14
781000 -- [-428.234] (-427.851) (-426.022) (-428.277) * (-432.020) (-428.662) (-429.310) [-426.353] -- 0:00:14
781500 -- [-428.564] (-427.775) (-427.131) (-428.635) * [-426.995] (-426.271) (-429.060) (-428.743) -- 0:00:13
782000 -- [-428.209] (-428.351) (-427.852) (-428.787) * [-429.172] (-428.451) (-428.087) (-429.686) -- 0:00:13
782500 -- [-426.620] (-428.546) (-425.402) (-430.468) * (-432.379) (-432.576) (-431.282) [-425.777] -- 0:00:13
783000 -- [-432.189] (-425.895) (-429.010) (-428.669) * (-433.062) (-428.133) (-433.274) [-426.757] -- 0:00:13
783500 -- [-427.502] (-433.901) (-427.919) (-430.952) * (-427.649) (-429.027) [-430.598] (-429.964) -- 0:00:13
784000 -- (-427.684) [-428.061] (-429.912) (-428.254) * (-428.170) [-429.621] (-432.402) (-427.163) -- 0:00:13
784500 -- [-426.417] (-428.891) (-428.775) (-430.592) * (-430.307) (-425.475) (-428.595) [-429.018] -- 0:00:13
785000 -- (-426.330) (-430.032) (-429.845) [-428.183] * (-428.684) [-426.671] (-430.208) (-427.859) -- 0:00:13
Average standard deviation of split frequencies: 0.008357
785500 -- (-430.608) [-429.780] (-427.899) (-428.903) * (-426.501) (-425.621) (-429.445) [-426.773] -- 0:00:13
786000 -- [-429.779] (-428.002) (-426.806) (-428.420) * (-429.374) (-427.763) (-429.584) [-427.109] -- 0:00:13
786500 -- (-430.392) [-427.582] (-431.725) (-428.065) * (-427.065) [-433.463] (-426.607) (-426.567) -- 0:00:13
787000 -- [-426.947] (-430.228) (-427.556) (-428.304) * [-425.790] (-434.806) (-430.245) (-428.926) -- 0:00:13
787500 -- (-426.459) (-428.852) [-427.211] (-430.632) * (-430.932) (-433.245) (-428.780) [-429.646] -- 0:00:13
788000 -- (-427.983) [-427.116] (-427.179) (-433.520) * (-428.431) (-429.287) [-427.573] (-425.073) -- 0:00:13
788500 -- [-427.550] (-431.592) (-431.709) (-429.079) * (-426.673) (-429.268) (-435.252) [-425.994] -- 0:00:13
789000 -- [-427.316] (-427.712) (-432.824) (-427.189) * (-427.826) (-429.050) [-428.778] (-433.410) -- 0:00:13
789500 -- (-433.478) (-428.563) [-432.160] (-428.081) * [-430.289] (-432.703) (-428.233) (-428.908) -- 0:00:13
790000 -- [-425.651] (-427.537) (-431.311) (-427.805) * (-428.615) [-431.145] (-430.311) (-427.364) -- 0:00:13
Average standard deviation of split frequencies: 0.008069
790500 -- [-427.789] (-430.208) (-433.566) (-427.375) * (-431.471) (-430.563) [-430.018] (-427.215) -- 0:00:13
791000 -- (-428.057) (-438.391) (-428.125) [-426.744] * (-430.507) (-425.968) (-429.028) [-427.656] -- 0:00:13
791500 -- (-428.422) (-430.299) (-428.730) [-426.814] * (-430.724) (-427.653) (-429.170) [-428.458] -- 0:00:13
792000 -- (-427.022) (-430.850) [-428.952] (-426.123) * (-429.733) (-426.484) (-429.002) [-429.533] -- 0:00:13
792500 -- (-426.986) (-433.264) [-428.509] (-429.269) * (-430.365) (-429.219) [-429.008] (-428.913) -- 0:00:13
793000 -- [-428.293] (-428.980) (-431.729) (-429.195) * (-432.797) [-428.521] (-426.586) (-427.430) -- 0:00:13
793500 -- (-428.827) (-430.496) (-426.290) [-428.519] * (-428.582) (-436.239) (-429.321) [-427.215] -- 0:00:13
794000 -- (-431.367) (-432.150) (-429.771) [-431.159] * (-426.711) [-432.447] (-432.786) (-425.609) -- 0:00:12
794500 -- (-429.563) (-432.408) [-426.501] (-428.374) * (-426.857) (-426.629) (-434.221) [-428.322] -- 0:00:12
795000 -- (-431.901) (-432.625) (-428.004) [-433.232] * [-428.321] (-427.802) (-429.046) (-428.569) -- 0:00:12
Average standard deviation of split frequencies: 0.008370
795500 -- [-428.504] (-432.822) (-430.089) (-425.765) * [-429.085] (-428.132) (-428.697) (-428.864) -- 0:00:12
796000 -- (-429.303) (-428.286) (-432.309) [-426.372] * (-426.751) (-427.147) [-428.081] (-432.020) -- 0:00:12
796500 -- (-428.806) [-429.274] (-428.168) (-429.034) * [-428.386] (-426.587) (-431.184) (-427.912) -- 0:00:13
797000 -- [-427.748] (-431.473) (-429.363) (-426.232) * (-433.657) (-428.570) [-427.042] (-431.624) -- 0:00:12
797500 -- (-427.829) (-427.981) (-431.107) [-428.130] * (-427.778) [-428.101] (-432.090) (-431.656) -- 0:00:12
798000 -- (-428.132) [-425.392] (-429.958) (-426.263) * (-426.382) (-427.759) (-427.837) [-429.211] -- 0:00:12
798500 -- [-428.119] (-429.737) (-432.575) (-424.668) * (-427.629) [-428.062] (-430.269) (-430.311) -- 0:00:12
799000 -- (-428.921) (-433.632) (-429.746) [-426.517] * (-428.634) [-431.563] (-429.131) (-429.760) -- 0:00:12
799500 -- [-428.209] (-431.394) (-429.384) (-428.089) * (-428.098) (-425.531) (-428.665) [-429.455] -- 0:00:12
800000 -- [-427.858] (-429.113) (-430.623) (-427.073) * (-431.643) (-429.161) [-431.985] (-426.806) -- 0:00:12
Average standard deviation of split frequencies: 0.008164
800500 -- (-428.001) (-430.942) (-429.110) [-427.560] * (-427.882) (-429.643) [-427.420] (-428.863) -- 0:00:12
801000 -- (-428.040) (-427.045) [-431.952] (-426.670) * (-431.390) [-427.339] (-427.166) (-428.048) -- 0:00:12
801500 -- [-428.824] (-428.969) (-431.360) (-428.566) * (-426.994) (-430.804) (-427.119) [-427.940] -- 0:00:12
802000 -- [-431.482] (-425.178) (-430.534) (-431.850) * (-428.174) (-429.683) [-426.116] (-428.942) -- 0:00:12
802500 -- [-428.093] (-430.216) (-433.784) (-433.714) * (-434.038) [-430.157] (-428.871) (-432.411) -- 0:00:12
803000 -- (-429.668) (-430.786) [-430.804] (-432.880) * (-429.189) [-431.298] (-429.289) (-437.553) -- 0:00:12
803500 -- [-425.049] (-429.063) (-427.249) (-429.981) * (-427.925) (-427.354) [-427.275] (-429.767) -- 0:00:12
804000 -- (-428.031) (-433.215) (-430.582) [-426.993] * (-427.921) [-429.219] (-431.914) (-432.044) -- 0:00:12
804500 -- (-435.684) (-428.800) [-426.384] (-431.754) * [-429.112] (-429.950) (-426.840) (-427.056) -- 0:00:12
805000 -- (-438.046) [-429.597] (-430.011) (-427.533) * (-431.441) (-429.983) [-427.894] (-426.041) -- 0:00:12
Average standard deviation of split frequencies: 0.007347
805500 -- [-427.680] (-428.177) (-426.141) (-429.017) * (-429.343) (-429.441) (-433.172) [-429.373] -- 0:00:12
806000 -- (-428.255) (-427.980) [-426.819] (-429.110) * [-426.113] (-430.520) (-430.777) (-426.778) -- 0:00:12
806500 -- [-428.647] (-434.204) (-429.884) (-426.758) * [-426.790] (-427.502) (-427.158) (-427.311) -- 0:00:12
807000 -- (-432.165) (-429.452) [-425.812] (-428.844) * (-430.775) (-430.374) [-427.998] (-429.911) -- 0:00:12
807500 -- (-426.941) [-429.149] (-428.800) (-433.064) * (-431.365) (-429.494) [-425.122] (-427.138) -- 0:00:12
808000 -- [-427.828] (-428.573) (-429.515) (-426.629) * [-427.128] (-434.120) (-428.658) (-426.114) -- 0:00:12
808500 -- [-425.447] (-428.417) (-431.590) (-429.145) * (-426.670) (-427.145) [-430.997] (-428.963) -- 0:00:12
809000 -- (-425.929) [-429.497] (-427.999) (-429.505) * (-427.946) (-428.562) [-427.514] (-429.973) -- 0:00:12
809500 -- (-426.896) [-426.130] (-428.943) (-426.922) * (-431.665) [-428.609] (-425.586) (-427.707) -- 0:00:12
810000 -- (-434.372) (-427.060) (-430.465) [-427.480] * [-426.808] (-427.739) (-431.698) (-429.500) -- 0:00:11
Average standard deviation of split frequencies: 0.007850
810500 -- (-429.671) [-429.372] (-430.026) (-429.150) * (-427.602) (-427.742) [-424.721] (-428.979) -- 0:00:11
811000 -- (-427.448) (-427.052) (-428.910) [-426.819] * [-426.698] (-432.254) (-427.386) (-430.122) -- 0:00:11
811500 -- (-427.465) [-428.144] (-432.200) (-428.753) * (-427.006) (-430.483) (-425.480) [-429.630] -- 0:00:11
812000 -- (-432.305) [-430.244] (-426.116) (-428.159) * (-426.559) [-426.889] (-427.857) (-428.317) -- 0:00:12
812500 -- (-428.807) (-431.344) (-428.165) [-428.697] * (-427.555) [-430.391] (-427.101) (-428.955) -- 0:00:12
813000 -- (-425.773) [-427.356] (-428.891) (-428.097) * (-427.735) [-426.383] (-426.736) (-430.193) -- 0:00:11
813500 -- (-427.323) [-426.633] (-428.322) (-428.573) * [-429.355] (-429.714) (-428.253) (-427.753) -- 0:00:11
814000 -- (-426.434) (-427.774) (-431.979) [-426.523] * (-430.137) (-430.139) (-429.717) [-426.140] -- 0:00:11
814500 -- (-426.984) [-429.359] (-433.478) (-427.460) * (-428.780) [-427.251] (-427.763) (-426.733) -- 0:00:11
815000 -- (-427.491) (-428.436) (-428.482) [-428.417] * (-427.846) (-433.894) [-429.496] (-427.728) -- 0:00:11
Average standard deviation of split frequencies: 0.007691
815500 -- (-429.597) [-425.225] (-428.029) (-432.457) * (-430.014) (-430.866) [-427.664] (-428.894) -- 0:00:11
816000 -- (-433.114) (-428.001) (-429.168) [-427.443] * (-426.451) (-429.657) [-428.083] (-426.119) -- 0:00:11
816500 -- (-433.413) [-428.074] (-429.147) (-427.794) * [-431.877] (-429.323) (-427.881) (-429.330) -- 0:00:11
817000 -- (-428.562) [-426.846] (-428.081) (-426.201) * (-428.170) (-430.771) [-427.562] (-431.353) -- 0:00:11
817500 -- (-428.714) (-427.814) [-426.742] (-425.240) * [-426.617] (-428.048) (-427.334) (-431.443) -- 0:00:11
818000 -- [-425.784] (-427.113) (-431.092) (-426.432) * (-427.051) (-426.458) (-428.061) [-427.515] -- 0:00:11
818500 -- [-431.790] (-427.334) (-426.940) (-426.422) * (-431.778) (-429.185) (-425.437) [-425.973] -- 0:00:11
819000 -- (-430.958) (-428.408) [-431.254] (-427.063) * (-427.372) (-431.418) [-429.711] (-427.764) -- 0:00:11
819500 -- (-433.812) [-429.203] (-431.945) (-428.302) * (-427.779) [-428.174] (-425.471) (-430.004) -- 0:00:11
820000 -- [-425.170] (-427.467) (-431.702) (-427.331) * (-431.131) (-430.010) (-425.706) [-425.591] -- 0:00:11
Average standard deviation of split frequencies: 0.007360
820500 -- [-426.869] (-428.462) (-429.955) (-428.476) * (-431.224) (-432.313) [-425.078] (-434.958) -- 0:00:11
821000 -- [-427.153] (-429.605) (-429.159) (-429.674) * (-426.892) (-432.237) [-427.024] (-428.640) -- 0:00:11
821500 -- (-429.109) [-431.881] (-428.302) (-429.625) * (-426.784) (-430.338) [-427.332] (-430.841) -- 0:00:11
822000 -- (-428.807) (-428.287) [-426.071] (-428.380) * [-427.533] (-429.588) (-427.308) (-427.739) -- 0:00:11
822500 -- [-425.683] (-428.837) (-428.286) (-427.702) * [-427.755] (-431.091) (-431.109) (-432.512) -- 0:00:11
823000 -- (-426.621) (-432.411) [-429.209] (-428.870) * (-430.494) [-426.034] (-428.167) (-425.470) -- 0:00:11
823500 -- (-424.838) (-429.058) [-428.254] (-428.132) * (-430.696) (-432.581) [-431.072] (-426.050) -- 0:00:11
824000 -- (-424.899) (-426.781) [-425.845] (-434.027) * (-427.439) (-425.303) (-432.969) [-426.835] -- 0:00:11
824500 -- (-429.167) (-428.388) (-429.167) [-426.901] * (-427.955) [-427.131] (-429.016) (-427.181) -- 0:00:11
825000 -- (-426.866) [-427.740] (-430.467) (-426.534) * (-427.808) (-425.998) (-429.867) [-433.137] -- 0:00:11
Average standard deviation of split frequencies: 0.007526
825500 -- (-430.799) [-426.246] (-432.269) (-431.403) * [-427.336] (-427.896) (-427.312) (-429.429) -- 0:00:10
826000 -- (-428.891) [-429.216] (-426.151) (-427.889) * (-425.980) (-425.031) [-427.373] (-427.346) -- 0:00:10
826500 -- (-426.558) (-429.001) [-425.994] (-425.168) * (-429.353) (-427.287) (-430.432) [-427.666] -- 0:00:10
827000 -- (-430.078) [-427.460] (-430.832) (-424.662) * (-429.687) (-427.739) [-430.829] (-428.917) -- 0:00:10
827500 -- (-427.688) (-429.324) (-428.499) [-425.655] * [-427.572] (-428.058) (-430.962) (-426.905) -- 0:00:11
828000 -- (-429.075) [-427.617] (-429.436) (-431.077) * (-430.053) [-428.709] (-426.845) (-430.838) -- 0:00:11
828500 -- (-428.178) (-429.087) [-427.517] (-431.203) * (-429.596) [-427.137] (-427.915) (-429.430) -- 0:00:10
829000 -- (-425.275) (-427.250) [-427.781] (-427.353) * [-429.600] (-427.463) (-426.302) (-429.495) -- 0:00:10
829500 -- (-427.767) [-425.506] (-427.875) (-434.229) * (-428.890) (-428.595) [-426.808] (-427.518) -- 0:00:10
830000 -- (-426.707) (-426.798) [-426.284] (-427.840) * (-428.116) (-433.056) [-425.997] (-429.113) -- 0:00:10
Average standard deviation of split frequencies: 0.007980
830500 -- (-427.500) [-428.889] (-427.827) (-426.329) * (-428.946) [-426.081] (-429.268) (-427.917) -- 0:00:10
831000 -- [-427.232] (-427.949) (-431.344) (-426.724) * [-428.666] (-426.737) (-427.473) (-426.460) -- 0:00:10
831500 -- (-430.398) [-427.282] (-433.060) (-430.050) * (-427.807) (-427.040) [-425.948] (-434.306) -- 0:00:10
832000 -- [-428.962] (-427.090) (-428.062) (-429.439) * (-428.119) (-429.228) [-426.175] (-430.835) -- 0:00:10
832500 -- (-425.963) (-429.022) [-428.917] (-429.746) * [-429.285] (-431.580) (-426.938) (-429.947) -- 0:00:10
833000 -- (-430.385) [-430.508] (-429.844) (-427.827) * [-430.199] (-428.646) (-428.867) (-432.086) -- 0:00:10
833500 -- (-427.879) (-427.117) [-427.524] (-428.590) * [-429.007] (-434.530) (-430.019) (-429.174) -- 0:00:10
834000 -- [-428.748] (-427.231) (-427.034) (-428.449) * (-434.280) (-427.897) [-429.630] (-428.218) -- 0:00:10
834500 -- [-428.081] (-430.127) (-426.841) (-426.185) * (-428.889) (-427.865) [-429.883] (-429.579) -- 0:00:10
835000 -- (-430.304) (-431.085) (-427.534) [-429.533] * (-429.541) (-430.591) (-427.553) [-427.442] -- 0:00:10
Average standard deviation of split frequencies: 0.008106
835500 -- (-426.539) (-431.884) [-429.806] (-428.905) * (-426.677) [-428.190] (-431.058) (-428.550) -- 0:00:10
836000 -- (-429.618) [-428.393] (-427.998) (-425.059) * (-426.245) (-429.972) (-431.711) [-428.208] -- 0:00:10
836500 -- [-429.472] (-429.174) (-430.241) (-426.840) * (-424.508) (-427.094) [-428.435] (-428.521) -- 0:00:10
837000 -- (-429.091) (-426.415) (-428.882) [-424.858] * (-427.424) (-429.767) (-430.453) [-431.062] -- 0:00:10
837500 -- [-426.816] (-431.699) (-428.883) (-425.833) * (-428.989) [-425.549] (-436.584) (-428.578) -- 0:00:10
838000 -- (-433.123) (-436.238) (-429.948) [-428.075] * [-428.587] (-426.272) (-432.331) (-430.526) -- 0:00:10
838500 -- [-434.398] (-427.406) (-434.742) (-428.098) * (-426.123) (-424.636) [-427.348] (-429.989) -- 0:00:10
839000 -- (-426.025) [-426.002] (-428.817) (-426.641) * (-427.827) (-429.793) [-430.950] (-429.519) -- 0:00:10
839500 -- [-426.849] (-427.268) (-427.218) (-427.361) * (-429.784) [-426.971] (-428.189) (-429.012) -- 0:00:10
840000 -- (-432.670) (-428.597) [-428.579] (-425.696) * [-430.493] (-427.792) (-426.722) (-429.049) -- 0:00:10
Average standard deviation of split frequencies: 0.008061
840500 -- (-431.780) (-429.562) (-427.910) [-426.786] * [-425.343] (-428.531) (-426.393) (-429.428) -- 0:00:10
841000 -- (-427.338) (-427.719) [-425.519] (-428.348) * (-428.593) (-429.974) [-426.848] (-429.294) -- 0:00:10
841500 -- [-427.926] (-430.107) (-427.405) (-429.577) * [-426.017] (-426.707) (-428.876) (-428.982) -- 0:00:09
842000 -- (-427.912) (-426.495) [-428.128] (-427.941) * (-428.693) [-429.056] (-431.500) (-427.126) -- 0:00:09
842500 -- (-426.868) [-426.062] (-429.606) (-429.777) * [-427.721] (-430.635) (-428.420) (-428.375) -- 0:00:09
843000 -- (-430.000) (-425.776) [-428.089] (-430.019) * [-429.865] (-429.858) (-429.853) (-427.406) -- 0:00:09
843500 -- (-428.090) (-432.371) [-434.844] (-428.162) * (-430.132) (-424.232) (-429.716) [-427.533] -- 0:00:10
844000 -- (-428.672) (-427.605) [-429.108] (-433.802) * [-428.881] (-427.084) (-427.543) (-426.324) -- 0:00:09
844500 -- (-427.874) (-429.884) (-428.065) [-432.260] * (-431.000) [-428.029] (-426.337) (-430.452) -- 0:00:09
845000 -- (-428.508) (-429.031) (-429.395) [-432.375] * (-431.000) (-427.038) (-428.174) [-427.441] -- 0:00:09
Average standard deviation of split frequencies: 0.007871
845500 -- (-429.321) (-429.303) (-427.061) [-427.246] * (-427.928) (-427.971) (-426.766) [-425.363] -- 0:00:09
846000 -- (-429.492) (-429.045) [-429.668] (-426.909) * (-429.815) [-428.331] (-427.466) (-428.564) -- 0:00:09
846500 -- [-426.568] (-434.697) (-429.336) (-430.390) * (-427.598) [-430.762] (-430.768) (-431.560) -- 0:00:09
847000 -- (-426.990) (-429.868) (-428.228) [-428.289] * [-426.585] (-434.480) (-428.877) (-426.089) -- 0:00:09
847500 -- (-427.836) (-428.879) [-426.802] (-429.346) * (-427.564) (-427.675) [-427.913] (-426.641) -- 0:00:09
848000 -- (-430.323) [-426.255] (-428.648) (-429.197) * (-428.868) [-429.803] (-425.748) (-428.686) -- 0:00:09
848500 -- [-429.073] (-427.077) (-427.836) (-429.543) * (-427.471) (-428.777) [-425.952] (-432.357) -- 0:00:09
849000 -- (-429.105) (-427.525) (-428.145) [-429.386] * (-428.102) (-428.800) (-427.112) [-431.910] -- 0:00:09
849500 -- (-428.044) (-431.041) (-431.661) [-427.663] * [-427.375] (-426.537) (-428.995) (-431.459) -- 0:00:09
850000 -- [-427.080] (-432.506) (-431.427) (-428.754) * (-427.903) (-436.840) [-426.097] (-433.016) -- 0:00:09
Average standard deviation of split frequencies: 0.008312
850500 -- (-427.654) (-429.832) (-428.892) [-427.661] * [-426.747] (-426.517) (-428.497) (-429.541) -- 0:00:09
851000 -- [-428.034] (-430.292) (-428.213) (-427.441) * (-426.517) (-428.495) [-430.342] (-429.968) -- 0:00:09
851500 -- (-433.020) (-425.575) [-426.700] (-430.860) * (-429.467) (-427.618) [-428.570] (-427.174) -- 0:00:09
852000 -- (-431.243) (-427.729) [-429.240] (-426.983) * (-428.562) (-429.534) [-431.600] (-428.523) -- 0:00:09
852500 -- (-433.066) (-428.509) (-435.267) [-428.242] * (-430.213) (-428.234) (-429.067) [-427.680] -- 0:00:09
853000 -- (-428.341) (-432.397) [-426.124] (-429.438) * (-431.322) [-434.624] (-428.883) (-426.691) -- 0:00:09
853500 -- (-430.339) [-430.951] (-427.150) (-425.925) * (-431.069) (-428.592) (-429.114) [-426.047] -- 0:00:09
854000 -- (-427.052) (-427.215) [-426.898] (-430.320) * (-429.892) (-429.084) [-429.530] (-427.800) -- 0:00:09
854500 -- (-424.703) (-428.798) (-429.619) [-429.256] * (-430.075) (-430.961) [-427.083] (-429.143) -- 0:00:09
855000 -- [-425.442] (-427.905) (-429.985) (-434.044) * (-431.352) (-430.970) [-427.910] (-431.279) -- 0:00:09
Average standard deviation of split frequencies: 0.008518
855500 -- (-430.775) (-427.437) (-430.078) [-426.364] * (-431.000) (-430.539) [-426.758] (-429.061) -- 0:00:09
856000 -- (-431.493) [-427.559] (-430.901) (-428.034) * (-430.268) [-429.573] (-430.923) (-430.661) -- 0:00:09
856500 -- (-433.021) [-428.321] (-424.630) (-426.836) * [-427.652] (-432.330) (-428.281) (-430.848) -- 0:00:09
857000 -- (-428.281) [-426.217] (-429.976) (-427.375) * (-428.045) (-427.155) [-428.714] (-435.229) -- 0:00:09
857500 -- (-426.695) (-432.550) (-428.812) [-427.283] * [-427.126] (-424.992) (-426.519) (-430.169) -- 0:00:08
858000 -- (-427.032) (-426.480) [-426.227] (-432.018) * (-430.900) [-429.904] (-427.254) (-429.548) -- 0:00:08
858500 -- (-432.173) (-431.450) (-426.995) [-434.020] * (-433.363) (-427.789) (-427.615) [-427.987] -- 0:00:08
859000 -- (-430.412) (-432.878) [-428.907] (-431.507) * (-431.496) (-426.132) [-426.591] (-425.995) -- 0:00:09
859500 -- (-433.060) (-425.979) [-425.861] (-429.405) * (-429.102) (-429.131) (-426.439) [-426.823] -- 0:00:08
860000 -- (-429.702) (-426.313) [-426.654] (-426.418) * (-427.517) [-429.109] (-429.685) (-428.329) -- 0:00:08
Average standard deviation of split frequencies: 0.009003
860500 -- (-427.131) [-427.723] (-427.142) (-428.727) * (-427.769) (-427.691) (-427.077) [-426.725] -- 0:00:08
861000 -- [-427.715] (-425.052) (-427.214) (-426.369) * (-429.042) (-428.608) [-429.115] (-427.869) -- 0:00:08
861500 -- (-428.673) [-430.014] (-426.073) (-431.495) * (-430.546) (-427.274) (-427.385) [-428.480] -- 0:00:08
862000 -- (-427.019) (-428.086) [-428.629] (-432.872) * (-427.327) (-426.080) [-426.531] (-429.484) -- 0:00:08
862500 -- (-427.742) [-425.831] (-431.949) (-434.296) * [-428.449] (-426.610) (-434.566) (-432.651) -- 0:00:08
863000 -- (-425.487) (-427.837) [-426.528] (-430.283) * (-428.002) (-427.993) (-427.999) [-427.562] -- 0:00:08
863500 -- (-427.593) (-426.696) (-425.578) [-427.981] * (-433.972) (-432.353) [-427.953] (-431.586) -- 0:00:08
864000 -- [-427.480] (-425.792) (-429.066) (-427.426) * (-432.268) (-432.379) [-428.660] (-432.136) -- 0:00:08
864500 -- (-430.311) [-426.609] (-429.212) (-429.106) * (-429.511) (-428.848) [-427.806] (-430.697) -- 0:00:08
865000 -- [-428.226] (-427.776) (-431.778) (-429.932) * (-427.129) (-431.986) [-427.878] (-428.171) -- 0:00:08
Average standard deviation of split frequencies: 0.008678
865500 -- (-429.495) [-430.377] (-427.664) (-427.398) * (-428.309) [-427.136] (-426.823) (-427.899) -- 0:00:08
866000 -- (-428.615) (-428.422) (-434.774) [-429.382] * (-428.830) [-430.101] (-428.155) (-428.190) -- 0:00:08
866500 -- (-428.608) (-427.380) [-425.764] (-428.263) * (-429.846) (-428.134) [-426.058] (-428.799) -- 0:00:08
867000 -- (-426.441) [-428.478] (-425.785) (-429.424) * (-432.313) (-429.034) [-427.726] (-430.053) -- 0:00:08
867500 -- [-430.163] (-425.191) (-429.868) (-434.767) * (-426.298) (-427.443) [-429.025] (-427.069) -- 0:00:08
868000 -- (-428.630) (-429.243) [-430.070] (-432.025) * (-428.346) [-427.567] (-428.546) (-426.885) -- 0:00:08
868500 -- (-429.973) [-426.374] (-431.055) (-428.547) * (-427.921) [-428.983] (-426.832) (-431.618) -- 0:00:08
869000 -- (-430.267) [-426.749] (-431.192) (-427.301) * (-428.515) [-432.053] (-431.448) (-426.668) -- 0:00:08
869500 -- (-426.388) [-429.029] (-426.050) (-427.608) * (-429.167) [-430.366] (-427.295) (-432.698) -- 0:00:08
870000 -- (-427.147) (-429.263) [-426.902] (-424.957) * [-426.580] (-429.692) (-431.062) (-429.871) -- 0:00:08
Average standard deviation of split frequencies: 0.009295
870500 -- (-428.797) (-430.557) (-427.525) [-424.356] * (-428.252) (-427.665) (-431.539) [-427.302] -- 0:00:08
871000 -- (-430.545) (-429.392) [-430.432] (-427.676) * (-426.510) [-429.329] (-432.291) (-433.206) -- 0:00:08
871500 -- (-428.059) (-428.440) (-428.285) [-427.855] * (-428.082) (-430.142) [-427.968] (-429.928) -- 0:00:08
872000 -- [-428.660] (-429.796) (-428.128) (-428.872) * (-430.496) (-426.721) (-427.194) [-427.338] -- 0:00:08
872500 -- (-429.041) (-428.174) (-428.380) [-427.291] * [-428.756] (-427.702) (-429.946) (-427.249) -- 0:00:08
873000 -- (-427.680) [-426.425] (-431.561) (-430.875) * (-428.629) (-432.410) [-428.897] (-427.249) -- 0:00:08
873500 -- (-427.318) (-427.957) [-428.935] (-427.863) * [-429.276] (-430.781) (-428.300) (-427.483) -- 0:00:07
874000 -- (-433.146) [-426.185] (-426.109) (-428.816) * (-431.057) (-431.625) (-431.288) [-430.215] -- 0:00:07
874500 -- [-429.386] (-431.476) (-424.535) (-428.597) * [-428.869] (-429.160) (-427.364) (-427.522) -- 0:00:07
875000 -- (-428.232) [-430.177] (-428.360) (-426.979) * [-427.808] (-429.108) (-428.431) (-426.054) -- 0:00:08
Average standard deviation of split frequencies: 0.009243
875500 -- [-425.518] (-429.425) (-431.209) (-431.072) * [-429.585] (-428.550) (-430.569) (-427.660) -- 0:00:07
876000 -- [-426.490] (-426.444) (-428.721) (-427.661) * (-427.213) (-429.829) [-428.905] (-427.719) -- 0:00:07
876500 -- (-427.474) [-430.568] (-431.389) (-429.344) * (-427.005) (-428.599) (-427.753) [-426.943] -- 0:00:07
877000 -- (-425.187) [-429.740] (-429.833) (-428.628) * [-428.789] (-427.420) (-427.706) (-429.171) -- 0:00:07
877500 -- (-429.243) [-428.338] (-428.838) (-431.225) * (-431.416) [-425.760] (-427.765) (-431.828) -- 0:00:07
878000 -- (-426.590) (-427.368) [-432.456] (-429.306) * [-430.496] (-430.077) (-428.055) (-430.178) -- 0:00:07
878500 -- [-428.151] (-427.993) (-432.133) (-429.448) * (-426.805) (-426.989) [-428.478] (-428.509) -- 0:00:07
879000 -- [-428.424] (-430.384) (-428.932) (-428.744) * (-428.123) [-429.021] (-429.803) (-427.590) -- 0:00:07
879500 -- (-428.683) (-427.568) [-425.958] (-428.381) * (-429.170) [-426.800] (-432.579) (-428.249) -- 0:00:07
880000 -- (-430.575) (-426.751) (-427.808) [-428.237] * (-428.961) (-428.581) (-433.725) [-430.779] -- 0:00:07
Average standard deviation of split frequencies: 0.009257
880500 -- [-429.207] (-426.745) (-430.077) (-430.177) * (-427.908) [-428.400] (-431.608) (-429.459) -- 0:00:07
881000 -- [-429.936] (-428.644) (-427.355) (-429.269) * [-429.329] (-429.178) (-430.443) (-428.263) -- 0:00:07
881500 -- (-427.102) (-430.880) (-426.569) [-427.452] * (-429.326) (-429.505) [-427.380] (-428.394) -- 0:00:07
882000 -- [-427.952] (-431.392) (-431.399) (-426.633) * (-428.345) (-429.008) (-430.572) [-426.500] -- 0:00:07
882500 -- (-429.915) [-429.248] (-428.706) (-427.472) * (-427.363) (-428.685) [-426.159] (-430.936) -- 0:00:07
883000 -- (-430.073) (-428.279) [-430.885] (-427.841) * (-428.090) [-425.878] (-427.504) (-426.983) -- 0:00:07
883500 -- (-425.976) (-427.479) [-430.476] (-429.601) * (-428.318) (-428.272) (-425.152) [-426.979] -- 0:00:07
884000 -- (-428.638) (-428.846) (-429.852) [-428.650] * (-433.174) [-428.199] (-426.579) (-426.682) -- 0:00:07
884500 -- (-426.133) [-428.184] (-432.779) (-432.114) * (-426.468) [-426.996] (-430.668) (-427.522) -- 0:00:07
885000 -- (-428.197) [-429.322] (-436.489) (-431.004) * (-428.660) (-426.241) [-425.678] (-426.574) -- 0:00:07
Average standard deviation of split frequencies: 0.009252
885500 -- (-430.625) (-430.440) [-428.052] (-426.129) * (-426.029) [-427.890] (-428.349) (-429.054) -- 0:00:07
886000 -- (-430.438) [-426.959] (-426.573) (-425.661) * (-428.826) [-425.413] (-430.495) (-428.766) -- 0:00:07
886500 -- (-431.243) (-429.202) (-428.447) [-425.651] * [-429.465] (-431.897) (-429.377) (-428.089) -- 0:00:07
887000 -- (-427.182) [-430.335] (-426.994) (-425.033) * (-429.357) (-428.776) [-427.186] (-427.022) -- 0:00:07
887500 -- (-425.252) (-426.739) [-428.857] (-428.943) * (-427.779) (-427.525) (-427.285) [-427.298] -- 0:00:07
888000 -- (-428.797) [-428.441] (-429.324) (-429.280) * (-430.732) (-427.673) (-425.536) [-426.992] -- 0:00:07
888500 -- (-427.602) (-429.955) [-427.473] (-427.283) * [-429.719] (-428.275) (-435.703) (-428.720) -- 0:00:07
889000 -- [-428.733] (-430.009) (-429.138) (-427.491) * (-427.177) (-427.026) [-429.469] (-427.667) -- 0:00:06
889500 -- (-432.011) [-427.725] (-427.084) (-433.959) * (-426.348) (-429.101) [-428.682] (-428.900) -- 0:00:06
890000 -- (-430.528) (-430.056) (-428.049) [-427.249] * [-427.109] (-427.575) (-429.177) (-431.486) -- 0:00:06
Average standard deviation of split frequencies: 0.009115
890500 -- [-428.649] (-428.814) (-428.369) (-426.206) * (-427.823) (-427.534) [-427.675] (-432.439) -- 0:00:07
891000 -- (-427.976) (-429.448) [-428.761] (-429.108) * [-427.869] (-426.003) (-426.039) (-427.535) -- 0:00:06
891500 -- (-429.078) [-427.748] (-427.381) (-430.346) * (-427.456) (-430.391) [-428.831] (-427.336) -- 0:00:06
892000 -- [-431.317] (-433.555) (-432.613) (-429.603) * (-428.435) (-427.567) [-429.274] (-432.200) -- 0:00:06
892500 -- (-428.029) [-427.808] (-429.342) (-427.243) * (-426.735) [-426.217] (-427.008) (-427.023) -- 0:00:06
893000 -- (-426.443) (-427.519) (-441.153) [-426.443] * (-427.304) (-429.805) [-428.306] (-431.721) -- 0:00:06
893500 -- (-431.965) (-427.244) [-429.498] (-430.297) * (-430.179) [-428.153] (-431.173) (-428.926) -- 0:00:06
894000 -- (-427.040) [-430.499] (-428.387) (-425.452) * [-426.652] (-429.565) (-429.766) (-429.862) -- 0:00:06
894500 -- (-427.371) [-426.626] (-428.613) (-426.461) * (-432.776) (-428.862) (-426.444) [-427.473] -- 0:00:06
895000 -- [-427.156] (-428.509) (-430.444) (-425.366) * [-432.143] (-429.661) (-428.873) (-427.803) -- 0:00:06
Average standard deviation of split frequencies: 0.008727
895500 -- (-426.942) (-428.489) [-426.916] (-426.825) * (-427.473) [-427.991] (-429.233) (-428.040) -- 0:00:06
896000 -- (-426.623) (-425.501) [-427.559] (-428.518) * (-427.537) (-432.872) [-431.443] (-427.914) -- 0:00:06
896500 -- (-426.015) [-427.805] (-426.238) (-429.216) * (-432.910) [-428.677] (-427.947) (-429.579) -- 0:00:06
897000 -- (-427.753) [-428.700] (-427.604) (-427.864) * (-431.342) (-430.451) [-426.986] (-435.280) -- 0:00:06
897500 -- [-428.149] (-428.989) (-428.719) (-430.745) * (-428.541) (-428.676) (-428.297) [-427.735] -- 0:00:06
898000 -- [-428.424] (-427.058) (-429.396) (-428.689) * [-429.147] (-429.224) (-428.690) (-426.619) -- 0:00:06
898500 -- (-426.639) (-430.689) [-427.948] (-429.867) * (-428.419) [-429.526] (-429.180) (-429.202) -- 0:00:06
899000 -- [-430.354] (-430.019) (-428.277) (-428.961) * (-427.219) (-425.672) (-426.944) [-428.422] -- 0:00:06
899500 -- (-428.769) (-426.179) (-426.597) [-427.942] * (-428.153) [-430.481] (-427.860) (-426.492) -- 0:00:06
900000 -- [-425.551] (-428.847) (-428.219) (-430.906) * [-430.698] (-427.225) (-428.681) (-429.719) -- 0:00:06
Average standard deviation of split frequencies: 0.008836
900500 -- [-428.597] (-428.899) (-427.649) (-431.490) * (-434.671) (-428.123) [-432.664] (-428.156) -- 0:00:06
901000 -- (-430.561) [-428.572] (-428.950) (-426.555) * [-429.033] (-427.442) (-427.912) (-429.576) -- 0:00:06
901500 -- [-425.884] (-429.359) (-428.430) (-426.765) * (-429.563) (-433.562) [-428.596] (-428.764) -- 0:00:06
902000 -- (-429.074) (-428.505) [-427.113] (-431.253) * (-428.733) (-427.002) [-426.925] (-426.923) -- 0:00:06
902500 -- [-429.640] (-431.417) (-426.020) (-426.514) * (-427.258) [-426.318] (-426.712) (-426.930) -- 0:00:06
903000 -- (-428.228) (-428.140) (-428.210) [-428.653] * (-435.593) (-428.966) [-429.942] (-428.242) -- 0:00:06
903500 -- (-426.328) (-430.527) (-425.466) [-427.717] * (-429.565) (-426.789) (-425.738) [-428.791] -- 0:00:06
904000 -- (-430.120) (-425.698) [-425.808] (-428.183) * [-429.367] (-427.972) (-429.750) (-430.256) -- 0:00:06
904500 -- (-432.320) (-427.793) [-427.040] (-429.149) * (-429.530) [-431.362] (-427.723) (-427.565) -- 0:00:06
905000 -- (-428.411) (-432.771) (-426.822) [-426.573] * [-431.190] (-431.378) (-426.269) (-432.073) -- 0:00:06
Average standard deviation of split frequencies: 0.009279
905500 -- [-436.646] (-431.412) (-427.284) (-428.110) * (-428.767) (-436.144) [-428.152] (-428.115) -- 0:00:06
906000 -- (-434.555) (-426.144) (-429.864) [-428.629] * (-430.253) [-429.115] (-431.911) (-429.695) -- 0:00:06
906500 -- (-430.313) (-425.218) (-427.948) [-428.398] * [-428.074] (-426.218) (-425.994) (-429.629) -- 0:00:05
907000 -- (-430.466) (-426.203) (-426.477) [-426.505] * [-428.337] (-432.717) (-428.804) (-426.974) -- 0:00:05
907500 -- (-428.073) [-426.847] (-428.521) (-428.639) * (-427.603) (-431.091) [-428.672] (-425.201) -- 0:00:05
908000 -- (-430.284) (-429.300) (-429.497) [-429.946] * [-426.604] (-428.110) (-431.843) (-427.830) -- 0:00:05
908500 -- (-433.670) (-431.027) [-428.600] (-432.936) * (-426.219) (-428.712) [-425.128] (-428.348) -- 0:00:05
909000 -- (-428.858) (-431.526) (-432.078) [-428.449] * (-428.102) (-429.468) (-427.417) [-428.596] -- 0:00:05
909500 -- (-429.737) (-425.517) [-428.136] (-427.174) * [-428.971] (-430.030) (-426.249) (-429.267) -- 0:00:05
910000 -- (-428.801) (-428.847) (-432.070) [-426.079] * [-429.943] (-427.252) (-426.752) (-427.564) -- 0:00:05
Average standard deviation of split frequencies: 0.008830
910500 -- (-427.190) [-429.165] (-425.908) (-428.337) * [-430.794] (-426.021) (-426.211) (-432.914) -- 0:00:05
911000 -- (-428.431) (-431.187) [-428.709] (-428.689) * (-429.506) [-427.678] (-429.378) (-427.360) -- 0:00:05
911500 -- (-431.222) (-430.659) [-427.409] (-431.242) * (-433.059) [-427.197] (-424.975) (-428.958) -- 0:00:05
912000 -- (-429.044) [-426.615] (-430.397) (-424.774) * (-427.431) [-426.835] (-426.636) (-428.840) -- 0:00:05
912500 -- (-427.688) (-428.242) (-431.135) [-428.216] * (-428.414) (-431.800) [-432.375] (-431.176) -- 0:00:05
913000 -- (-429.196) (-426.302) (-428.824) [-426.962] * (-429.764) [-426.746] (-425.881) (-430.802) -- 0:00:05
913500 -- [-427.505] (-429.430) (-428.227) (-426.811) * (-429.287) (-429.357) [-428.322] (-428.925) -- 0:00:05
914000 -- (-426.680) (-430.962) [-425.981] (-427.047) * [-430.039] (-430.678) (-424.849) (-430.230) -- 0:00:05
914500 -- (-426.149) (-429.887) [-430.865] (-430.856) * [-426.941] (-433.356) (-426.966) (-432.714) -- 0:00:05
915000 -- (-428.116) (-427.706) (-429.635) [-431.050] * (-428.615) [-431.519] (-428.483) (-431.369) -- 0:00:05
Average standard deviation of split frequencies: 0.008900
915500 -- (-428.520) (-425.957) (-430.225) [-429.759] * (-428.917) [-429.713] (-433.005) (-428.792) -- 0:00:05
916000 -- [-429.167] (-428.509) (-428.344) (-432.014) * (-429.655) (-427.518) (-426.784) [-430.620] -- 0:00:05
916500 -- (-428.547) [-426.778] (-429.613) (-433.859) * (-430.604) [-426.828] (-429.028) (-427.253) -- 0:00:05
917000 -- [-427.870] (-429.638) (-425.318) (-428.079) * (-427.084) [-425.399] (-428.767) (-428.728) -- 0:00:05
917500 -- (-430.023) (-429.066) (-430.404) [-429.638] * [-426.830] (-427.307) (-428.830) (-432.729) -- 0:00:05
918000 -- (-433.158) (-429.122) [-425.774] (-431.490) * [-428.352] (-428.336) (-426.867) (-429.583) -- 0:00:05
918500 -- (-428.072) (-432.170) [-428.436] (-427.748) * (-429.490) (-427.922) (-427.685) [-429.449] -- 0:00:05
919000 -- (-428.608) (-431.079) [-427.840] (-428.337) * (-431.695) (-430.267) (-427.378) [-429.739] -- 0:00:05
919500 -- [-430.711] (-428.385) (-429.663) (-428.461) * (-429.308) [-429.395] (-427.271) (-431.815) -- 0:00:05
920000 -- (-430.817) (-427.354) (-429.410) [-429.311] * (-428.608) (-426.888) [-428.899] (-432.957) -- 0:00:05
Average standard deviation of split frequencies: 0.008773
920500 -- (-426.665) [-429.127] (-431.367) (-427.724) * (-428.080) (-427.070) (-429.358) [-426.677] -- 0:00:05
921000 -- (-428.996) (-429.264) [-430.516] (-428.032) * (-427.257) (-429.527) (-430.738) [-427.467] -- 0:00:05
921500 -- (-430.267) [-430.382] (-429.927) (-427.974) * (-428.014) (-429.456) [-428.483] (-428.287) -- 0:00:05
922000 -- (-425.528) (-432.113) (-427.935) [-427.446] * (-426.580) [-431.684] (-425.676) (-429.968) -- 0:00:04
922500 -- [-430.762] (-434.650) (-426.976) (-426.958) * (-429.585) (-434.619) [-425.632] (-428.345) -- 0:00:04
923000 -- [-427.135] (-428.979) (-431.548) (-428.022) * [-429.488] (-430.394) (-430.556) (-429.336) -- 0:00:04
923500 -- (-428.890) (-427.617) (-427.685) [-425.630] * [-429.535] (-429.690) (-432.891) (-429.827) -- 0:00:04
924000 -- (-427.926) (-427.612) (-427.771) [-426.013] * (-428.362) (-432.172) (-431.677) [-428.264] -- 0:00:04
924500 -- (-432.315) (-431.733) (-432.339) [-425.876] * (-427.900) [-429.993] (-430.792) (-428.777) -- 0:00:04
925000 -- [-429.061] (-429.472) (-430.684) (-429.879) * [-426.606] (-427.145) (-431.623) (-429.594) -- 0:00:04
Average standard deviation of split frequencies: 0.008527
925500 -- (-428.792) (-426.114) [-427.616] (-432.296) * (-427.447) (-429.875) (-427.925) [-426.538] -- 0:00:04
926000 -- [-427.245] (-430.162) (-428.663) (-431.892) * [-428.958] (-431.685) (-429.680) (-425.631) -- 0:00:04
926500 -- [-430.191] (-428.123) (-426.273) (-427.174) * [-428.210] (-435.147) (-427.130) (-426.334) -- 0:00:04
927000 -- (-430.660) (-426.504) [-427.234] (-430.392) * (-428.163) [-427.417] (-430.050) (-435.369) -- 0:00:04
927500 -- [-427.157] (-427.304) (-429.176) (-428.597) * [-427.050] (-426.342) (-428.959) (-429.654) -- 0:00:04
928000 -- (-429.126) (-426.163) [-431.648] (-427.397) * (-427.420) (-435.448) [-426.418] (-429.285) -- 0:00:04
928500 -- (-425.696) (-426.474) [-428.199] (-430.404) * (-427.196) [-430.256] (-426.110) (-431.310) -- 0:00:04
929000 -- [-427.937] (-427.189) (-428.691) (-429.634) * (-429.328) (-425.771) (-430.356) [-427.221] -- 0:00:04
929500 -- (-430.060) [-427.578] (-428.785) (-429.024) * (-432.374) [-424.505] (-430.728) (-426.001) -- 0:00:04
930000 -- (-426.450) (-431.104) [-427.690] (-426.773) * (-440.905) (-424.804) (-437.046) [-425.976] -- 0:00:04
Average standard deviation of split frequencies: 0.008879
930500 -- (-427.326) (-432.692) (-430.757) [-429.900] * (-438.458) (-428.831) (-430.507) [-429.210] -- 0:00:04
931000 -- (-433.123) (-432.203) (-427.457) [-428.819] * (-437.840) [-428.744] (-429.761) (-432.043) -- 0:00:04
931500 -- (-426.144) (-427.120) [-427.260] (-429.612) * (-434.972) (-426.553) [-429.775] (-425.221) -- 0:00:04
932000 -- (-432.510) [-426.822] (-427.225) (-429.381) * (-428.089) [-427.344] (-428.387) (-428.437) -- 0:00:04
932500 -- (-429.536) (-427.065) (-428.068) [-429.087] * (-433.033) [-427.384] (-427.817) (-426.083) -- 0:00:04
933000 -- (-426.610) (-430.593) (-429.812) [-428.944] * (-427.456) [-426.609] (-430.953) (-428.071) -- 0:00:04
933500 -- (-428.562) (-429.627) [-426.226] (-429.184) * (-424.706) (-430.018) (-430.528) [-426.042] -- 0:00:04
934000 -- (-432.439) (-430.799) (-426.141) [-430.246] * (-427.795) (-430.893) (-430.369) [-428.641] -- 0:00:04
934500 -- (-430.044) (-428.236) (-430.741) [-427.683] * [-431.550] (-426.464) (-429.786) (-427.559) -- 0:00:04
935000 -- (-426.802) (-427.910) [-429.033] (-431.847) * (-429.531) (-431.934) [-428.210] (-427.775) -- 0:00:04
Average standard deviation of split frequencies: 0.009125
935500 -- [-427.497] (-427.292) (-430.851) (-431.569) * (-425.030) (-427.382) [-428.125] (-432.137) -- 0:00:04
936000 -- [-427.875] (-427.849) (-427.277) (-432.108) * (-427.782) (-428.217) (-426.923) [-430.735] -- 0:00:04
936500 -- (-426.920) (-441.465) (-428.747) [-430.453] * (-427.706) [-429.475] (-427.823) (-426.544) -- 0:00:04
937000 -- (-427.359) [-429.289] (-430.967) (-432.238) * (-428.196) (-428.734) [-428.996] (-425.609) -- 0:00:04
937500 -- (-432.472) [-428.314] (-428.967) (-432.929) * (-430.362) (-428.004) [-427.402] (-425.872) -- 0:00:04
938000 -- (-428.685) (-427.747) (-426.519) [-431.425] * (-434.101) [-426.908] (-427.362) (-425.528) -- 0:00:03
938500 -- (-428.359) [-427.788] (-426.447) (-430.235) * (-430.058) (-429.128) [-429.271] (-428.486) -- 0:00:03
939000 -- [-428.541] (-429.164) (-425.418) (-428.868) * (-427.354) [-429.171] (-429.237) (-427.874) -- 0:00:03
939500 -- (-427.832) (-429.062) [-426.532] (-429.335) * (-427.827) (-428.032) (-430.342) [-429.570] -- 0:00:03
940000 -- [-426.864] (-428.697) (-428.978) (-429.028) * (-431.403) (-431.804) [-428.864] (-428.064) -- 0:00:03
Average standard deviation of split frequencies: 0.008726
940500 -- [-428.157] (-427.647) (-428.842) (-425.732) * (-430.030) (-426.897) [-427.831] (-428.490) -- 0:00:03
941000 -- [-429.879] (-429.183) (-427.545) (-432.526) * [-426.196] (-427.340) (-429.831) (-428.218) -- 0:00:03
941500 -- (-429.856) (-430.044) (-428.322) [-430.290] * (-425.979) (-426.322) [-426.926] (-427.848) -- 0:00:03
942000 -- (-431.288) (-428.291) (-429.986) [-427.401] * [-428.244] (-427.633) (-429.062) (-430.065) -- 0:00:03
942500 -- [-428.010] (-428.436) (-429.104) (-430.497) * (-430.259) (-431.585) [-428.851] (-429.121) -- 0:00:03
943000 -- [-428.786] (-429.013) (-428.422) (-429.327) * (-429.114) [-426.879] (-426.946) (-431.493) -- 0:00:03
943500 -- (-425.599) (-429.564) [-427.930] (-434.241) * (-428.991) [-429.581] (-429.226) (-430.486) -- 0:00:03
944000 -- (-429.564) [-427.811] (-428.626) (-426.524) * (-429.525) (-426.436) [-428.371] (-428.045) -- 0:00:03
944500 -- [-427.112] (-430.043) (-430.572) (-430.998) * (-432.981) (-428.507) [-427.137] (-429.052) -- 0:00:03
945000 -- (-427.829) (-427.186) (-432.164) [-426.149] * [-426.579] (-425.768) (-431.187) (-430.331) -- 0:00:03
Average standard deviation of split frequencies: 0.009028
945500 -- (-428.403) (-425.845) (-430.392) [-427.764] * (-429.310) [-426.966] (-430.713) (-426.498) -- 0:00:03
946000 -- [-427.959] (-432.166) (-431.653) (-428.024) * [-427.769] (-426.543) (-431.645) (-427.424) -- 0:00:03
946500 -- (-429.495) [-434.938] (-432.587) (-433.478) * [-427.013] (-425.948) (-428.215) (-432.325) -- 0:00:03
947000 -- (-427.440) [-429.008] (-426.033) (-428.953) * (-427.549) (-433.868) [-430.119] (-427.813) -- 0:00:03
947500 -- [-430.864] (-428.769) (-428.964) (-426.455) * (-426.016) [-432.410] (-429.949) (-426.731) -- 0:00:03
948000 -- [-427.745] (-429.975) (-429.595) (-427.473) * [-426.805] (-429.262) (-430.165) (-428.857) -- 0:00:03
948500 -- [-430.822] (-428.519) (-431.754) (-432.655) * (-428.131) (-428.750) (-429.452) [-426.330] -- 0:00:03
949000 -- (-430.211) (-426.593) (-428.659) [-429.405] * (-433.400) [-426.366] (-427.639) (-428.460) -- 0:00:03
949500 -- (-431.112) [-427.368] (-431.325) (-427.984) * (-427.728) (-426.761) [-426.444] (-426.470) -- 0:00:03
950000 -- (-428.150) [-427.098] (-429.420) (-428.592) * (-430.186) [-427.149] (-427.152) (-426.310) -- 0:00:03
Average standard deviation of split frequencies: 0.009130
950500 -- (-428.663) (-428.940) (-427.522) [-429.933] * (-429.910) (-426.057) [-425.463] (-427.182) -- 0:00:03
951000 -- (-430.994) [-430.692] (-428.320) (-430.734) * (-429.258) (-431.510) [-426.445] (-427.565) -- 0:00:03
951500 -- (-430.076) [-428.228] (-432.114) (-428.316) * (-430.991) [-428.675] (-426.534) (-427.619) -- 0:00:03
952000 -- [-428.943] (-428.416) (-428.998) (-427.416) * (-425.541) (-427.454) (-432.503) [-426.032] -- 0:00:03
952500 -- (-425.189) (-431.821) [-426.664] (-427.321) * [-428.884] (-429.688) (-425.819) (-429.419) -- 0:00:03
953000 -- (-426.902) (-427.053) [-431.535] (-435.390) * (-430.677) (-424.261) [-425.579] (-429.495) -- 0:00:03
953500 -- [-428.752] (-426.463) (-429.281) (-428.013) * (-426.178) (-426.376) [-428.149] (-427.943) -- 0:00:02
954000 -- (-428.808) (-426.570) [-429.689] (-427.018) * (-425.748) (-429.911) [-428.364] (-429.286) -- 0:00:02
954500 -- (-432.145) [-426.364] (-429.593) (-427.606) * (-425.564) (-425.798) (-426.275) [-426.793] -- 0:00:02
955000 -- (-427.296) (-429.027) (-428.051) [-426.748] * (-427.537) (-432.595) (-426.908) [-427.561] -- 0:00:02
Average standard deviation of split frequencies: 0.008942
955500 -- [-432.030] (-428.392) (-429.108) (-431.581) * [-428.500] (-427.262) (-427.489) (-429.914) -- 0:00:02
956000 -- (-431.446) (-428.146) [-427.313] (-430.274) * (-427.821) [-426.836] (-427.404) (-434.553) -- 0:00:02
956500 -- (-427.654) (-430.154) [-427.064] (-431.828) * [-426.698] (-432.988) (-430.998) (-427.158) -- 0:00:02
957000 -- (-431.024) (-427.443) [-430.264] (-429.341) * (-431.196) (-427.315) (-431.335) [-427.351] -- 0:00:02
957500 -- [-427.302] (-428.668) (-430.955) (-428.818) * (-431.381) [-431.455] (-431.520) (-428.373) -- 0:00:02
958000 -- [-428.379] (-426.527) (-429.615) (-426.983) * (-433.541) (-428.061) [-427.580] (-424.840) -- 0:00:02
958500 -- (-430.947) [-427.579] (-429.527) (-429.399) * [-430.383] (-431.489) (-429.768) (-426.700) -- 0:00:02
959000 -- (-430.419) [-425.198] (-430.926) (-433.543) * (-428.383) [-427.111] (-425.438) (-426.315) -- 0:00:02
959500 -- (-426.818) (-428.433) (-428.611) [-427.516] * [-427.598] (-428.561) (-425.669) (-429.346) -- 0:00:02
960000 -- (-430.577) (-428.751) [-430.257] (-427.760) * (-427.920) (-429.462) (-428.519) [-425.441] -- 0:00:02
Average standard deviation of split frequencies: 0.008767
960500 -- (-431.010) [-428.386] (-431.264) (-429.204) * (-426.752) (-430.063) [-428.273] (-426.194) -- 0:00:02
961000 -- (-428.416) (-433.628) [-429.478] (-426.350) * (-428.359) (-428.656) (-428.746) [-424.624] -- 0:00:02
961500 -- (-427.843) (-428.226) [-426.500] (-426.321) * (-427.838) (-430.168) (-429.096) [-427.319] -- 0:00:02
962000 -- (-433.124) [-426.460] (-429.666) (-427.482) * (-434.954) (-426.976) [-426.341] (-426.179) -- 0:00:02
962500 -- (-433.468) (-431.937) (-429.236) [-425.235] * (-437.536) [-428.525] (-428.938) (-431.318) -- 0:00:02
963000 -- (-429.236) [-426.396] (-425.916) (-433.341) * (-441.243) [-425.509] (-431.108) (-426.515) -- 0:00:02
963500 -- (-429.166) [-428.226] (-425.326) (-428.764) * (-434.353) [-425.579] (-425.503) (-429.278) -- 0:00:02
964000 -- [-428.468] (-427.579) (-430.522) (-429.889) * (-427.179) (-427.476) (-431.688) [-427.481] -- 0:00:02
964500 -- (-428.654) [-425.309] (-430.055) (-432.042) * (-428.796) (-432.690) (-437.247) [-431.072] -- 0:00:02
965000 -- (-429.503) [-429.167] (-432.235) (-427.361) * [-426.970] (-426.133) (-429.080) (-430.081) -- 0:00:02
Average standard deviation of split frequencies: 0.008263
965500 -- [-428.956] (-429.148) (-426.473) (-427.114) * (-432.225) (-429.143) [-431.840] (-428.568) -- 0:00:02
966000 -- (-428.208) (-429.064) [-426.711] (-430.042) * [-427.137] (-426.835) (-427.430) (-427.143) -- 0:00:02
966500 -- (-427.356) [-426.465] (-428.994) (-429.699) * (-430.588) (-425.693) [-426.533] (-428.468) -- 0:00:02
967000 -- [-428.813] (-427.404) (-428.131) (-428.537) * (-429.310) (-426.033) [-424.894] (-428.146) -- 0:00:02
967500 -- (-428.154) (-429.039) [-431.765] (-429.713) * (-428.588) (-430.329) [-428.397] (-426.389) -- 0:00:02
968000 -- (-429.884) [-425.763] (-428.970) (-428.344) * (-433.803) [-426.938] (-430.447) (-429.176) -- 0:00:02
968500 -- (-426.142) [-428.528] (-426.554) (-428.119) * [-430.738] (-429.959) (-428.867) (-427.317) -- 0:00:02
969000 -- (-427.465) (-431.510) [-430.782] (-425.866) * (-429.834) [-428.713] (-432.618) (-430.195) -- 0:00:01
969500 -- (-424.310) (-428.748) [-426.459] (-429.709) * (-426.144) [-428.466] (-428.752) (-431.322) -- 0:00:01
970000 -- (-429.423) [-427.236] (-427.110) (-429.082) * (-425.438) [-427.887] (-432.711) (-429.326) -- 0:00:01
Average standard deviation of split frequencies: 0.008547
970500 -- (-430.107) (-429.197) [-426.522] (-427.141) * (-428.682) (-426.785) [-427.728] (-427.263) -- 0:00:01
971000 -- (-429.271) (-429.207) [-427.515] (-428.596) * (-429.188) (-429.196) [-431.355] (-430.256) -- 0:00:01
971500 -- (-432.319) (-431.397) [-426.789] (-427.356) * (-427.417) (-433.547) [-428.966] (-429.673) -- 0:00:01
972000 -- (-426.688) (-431.444) [-432.739] (-426.768) * (-426.375) [-426.746] (-427.743) (-427.931) -- 0:00:01
972500 -- [-430.991] (-430.716) (-430.223) (-427.887) * (-430.994) [-426.230] (-428.507) (-426.256) -- 0:00:01
973000 -- (-429.454) (-430.639) (-429.907) [-428.581] * [-432.376] (-426.928) (-432.963) (-429.330) -- 0:00:01
973500 -- (-425.910) (-427.519) (-429.422) [-429.070] * (-427.609) (-432.880) (-428.895) [-427.332] -- 0:00:01
974000 -- (-425.741) (-430.830) (-429.264) [-426.522] * [-428.382] (-428.421) (-426.882) (-428.552) -- 0:00:01
974500 -- (-430.512) (-431.190) (-425.501) [-428.726] * (-427.123) (-429.319) [-432.114] (-428.289) -- 0:00:01
975000 -- (-426.272) (-428.261) (-428.504) [-429.676] * (-427.012) [-431.819] (-426.734) (-432.570) -- 0:00:01
Average standard deviation of split frequencies: 0.008501
975500 -- (-427.864) (-431.084) (-429.128) [-425.579] * [-428.351] (-429.436) (-427.622) (-431.366) -- 0:00:01
976000 -- (-427.605) [-427.543] (-426.682) (-428.890) * (-432.188) (-430.073) (-431.770) [-429.591] -- 0:00:01
976500 -- (-428.664) (-428.372) (-425.829) [-425.369] * (-430.085) (-427.130) (-431.864) [-432.390] -- 0:00:01
977000 -- (-429.392) (-430.899) (-427.632) [-427.502] * (-427.355) (-428.079) (-430.912) [-429.006] -- 0:00:01
977500 -- (-427.370) (-429.802) [-427.644] (-426.752) * (-428.020) [-429.124] (-432.425) (-429.613) -- 0:00:01
978000 -- [-427.758] (-428.928) (-428.051) (-427.534) * (-428.655) (-431.606) [-430.198] (-426.485) -- 0:00:01
978500 -- (-426.647) (-431.603) (-431.102) [-427.432] * [-427.383] (-428.845) (-429.257) (-431.378) -- 0:00:01
979000 -- (-429.422) (-427.212) [-427.854] (-431.021) * (-425.064) (-428.177) (-428.263) [-427.806] -- 0:00:01
979500 -- (-431.317) [-429.359] (-428.236) (-428.253) * (-431.171) (-427.448) (-429.301) [-425.752] -- 0:00:01
980000 -- [-428.454] (-429.351) (-427.745) (-432.484) * (-424.266) (-428.916) (-428.481) [-428.267] -- 0:00:01
Average standard deviation of split frequencies: 0.008460
980500 -- (-430.776) (-426.881) (-428.982) [-428.032] * (-427.072) [-426.621] (-427.459) (-432.649) -- 0:00:01
981000 -- (-426.273) (-430.112) [-431.579] (-429.838) * [-429.839] (-429.805) (-429.341) (-433.766) -- 0:00:01
981500 -- (-429.997) (-428.574) (-430.378) [-430.518] * (-426.870) (-427.654) [-427.919] (-425.333) -- 0:00:01
982000 -- (-427.020) [-427.312] (-430.787) (-428.046) * (-429.350) [-426.630] (-430.405) (-426.289) -- 0:00:01
982500 -- (-426.853) (-429.693) (-431.013) [-427.094] * (-429.783) (-432.903) (-429.153) [-428.104] -- 0:00:01
983000 -- (-428.946) [-429.152] (-428.456) (-432.559) * (-431.774) (-426.326) [-427.770] (-428.225) -- 0:00:01
983500 -- (-428.884) (-430.067) [-428.459] (-430.822) * [-428.877] (-427.234) (-428.143) (-425.703) -- 0:00:01
984000 -- (-428.114) (-427.263) (-431.271) [-430.450] * [-427.337] (-431.046) (-427.145) (-431.536) -- 0:00:01
984500 -- (-427.794) [-429.907] (-428.465) (-430.467) * (-427.213) (-427.705) [-429.247] (-435.125) -- 0:00:00
985000 -- (-429.126) [-427.100] (-429.484) (-426.474) * (-428.010) [-426.202] (-429.621) (-430.267) -- 0:00:00
Average standard deviation of split frequencies: 0.008606
985500 -- [-427.718] (-427.849) (-429.096) (-429.897) * (-431.610) [-426.811] (-431.279) (-432.089) -- 0:00:00
986000 -- (-428.671) (-425.748) [-429.003] (-428.451) * (-433.037) (-429.640) (-433.523) [-429.303] -- 0:00:00
986500 -- (-428.107) [-428.963] (-430.158) (-428.878) * (-426.943) [-429.798] (-428.307) (-428.467) -- 0:00:00
987000 -- (-429.482) (-427.465) (-427.907) [-426.125] * (-426.958) [-424.868] (-428.223) (-429.249) -- 0:00:00
987500 -- (-427.238) [-428.241] (-428.074) (-429.749) * [-428.340] (-427.244) (-429.704) (-431.416) -- 0:00:00
988000 -- (-428.385) [-427.296] (-427.579) (-427.769) * (-428.691) (-427.098) (-428.391) [-430.286] -- 0:00:00
988500 -- (-427.615) (-426.515) (-430.098) [-428.415] * (-426.214) (-428.300) (-427.648) [-428.695] -- 0:00:00
989000 -- [-426.869] (-425.216) (-433.766) (-436.671) * (-427.091) (-429.559) (-428.382) [-428.402] -- 0:00:00
989500 -- (-433.510) (-427.260) [-430.131] (-429.484) * (-430.419) (-427.583) (-430.636) [-428.468] -- 0:00:00
990000 -- (-429.431) (-431.842) (-431.026) [-432.932] * (-436.902) (-426.513) [-432.187] (-426.891) -- 0:00:00
Average standard deviation of split frequencies: 0.009009
990500 -- (-425.826) (-431.257) [-426.746] (-429.683) * (-434.016) (-426.392) [-428.403] (-428.458) -- 0:00:00
991000 -- (-430.893) (-431.199) [-426.272] (-436.799) * (-430.353) [-429.467] (-427.776) (-426.251) -- 0:00:00
991500 -- [-430.960] (-427.165) (-426.706) (-434.504) * [-427.678] (-425.432) (-430.566) (-427.546) -- 0:00:00
992000 -- (-430.499) (-430.066) (-430.094) [-428.861] * (-427.989) [-426.829] (-426.206) (-427.633) -- 0:00:00
992500 -- (-426.858) (-429.990) [-428.421] (-428.747) * [-427.773] (-426.817) (-428.527) (-427.819) -- 0:00:00
993000 -- (-433.175) (-430.600) [-427.764] (-427.535) * (-428.140) [-427.816] (-432.604) (-428.246) -- 0:00:00
993500 -- [-431.338] (-429.131) (-430.460) (-427.959) * [-425.502] (-425.896) (-430.756) (-430.363) -- 0:00:00
994000 -- [-427.902] (-429.143) (-432.496) (-431.502) * (-424.375) (-427.121) [-430.026] (-425.765) -- 0:00:00
994500 -- (-434.107) (-430.885) [-432.419] (-427.333) * (-425.598) (-426.726) [-427.915] (-429.317) -- 0:00:00
995000 -- [-426.804] (-429.891) (-433.068) (-426.488) * (-427.604) (-429.291) [-428.080] (-425.930) -- 0:00:00
Average standard deviation of split frequencies: 0.008866
995500 -- [-429.312] (-432.980) (-427.967) (-426.821) * (-426.227) [-427.002] (-429.794) (-425.805) -- 0:00:00
996000 -- [-427.171] (-430.102) (-428.523) (-427.824) * [-430.134] (-434.817) (-429.864) (-426.532) -- 0:00:00
996500 -- (-427.314) (-436.167) [-429.842] (-427.906) * (-429.170) (-427.540) (-429.159) [-429.075] -- 0:00:00
997000 -- [-428.985] (-428.142) (-431.633) (-427.559) * (-431.720) (-430.608) (-430.795) [-427.458] -- 0:00:00
997500 -- [-427.108] (-428.094) (-431.128) (-427.056) * [-432.454] (-429.557) (-428.859) (-429.804) -- 0:00:00
998000 -- (-428.033) (-429.428) (-430.322) [-425.633] * (-431.133) (-428.250) [-430.505] (-429.711) -- 0:00:00
998500 -- (-425.978) (-436.827) [-429.686] (-434.371) * (-427.666) (-429.874) (-428.611) [-430.705] -- 0:00:00
999000 -- (-429.267) (-427.730) [-426.266] (-427.978) * (-430.485) [-430.081] (-434.066) (-431.517) -- 0:00:00
999500 -- (-428.645) (-426.707) (-425.423) [-428.111] * [-429.132] (-430.090) (-427.459) (-428.730) -- 0:00:00
1000000 -- (-427.301) (-427.696) (-425.615) [-428.405] * (-428.124) (-434.194) [-430.011] (-427.637) -- 0:00:00
Average standard deviation of split frequencies: 0.008762
Analysis completed in 1 mins 4 seconds
Analysis used 62.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -423.41
Likelihood of best state for "cold" chain of run 2 was -423.41
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 62 %) Dirichlet(Revmat{all})
97.6 % ( 97 %) Slider(Revmat{all})
39.0 % ( 35 %) Dirichlet(Pi{all})
38.8 % ( 37 %) Slider(Pi{all})
65.0 % ( 34 %) Multiplier(Alpha{1,2})
79.8 % ( 61 %) Multiplier(Alpha{3})
28.8 % ( 23 %) Slider(Pinvar{all})
97.2 % ( 95 %) ExtSPR(Tau{all},V{all})
69.0 % ( 60 %) ExtTBR(Tau{all},V{all})
98.1 % ( 99 %) NNI(Tau{all},V{all})
87.8 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
94.0 % ( 95 %) Nodeslider(V{all})
30.4 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 72 %) Dirichlet(Revmat{all})
98.0 % ( 98 %) Slider(Revmat{all})
39.5 % ( 28 %) Dirichlet(Pi{all})
39.3 % ( 27 %) Slider(Pi{all})
64.9 % ( 32 %) Multiplier(Alpha{1,2})
79.3 % ( 56 %) Multiplier(Alpha{3})
29.6 % ( 20 %) Slider(Pinvar{all})
97.2 % ( 97 %) ExtSPR(Tau{all},V{all})
68.9 % ( 71 %) ExtTBR(Tau{all},V{all})
98.1 % ( 98 %) NNI(Tau{all},V{all})
88.0 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
94.2 % ( 94 %) Nodeslider(V{all})
30.7 % ( 35 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166333 0.82 0.66
3 | 166029 166927 0.83
4 | 167364 166499 166848
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167085 0.82 0.66
3 | 166926 166335 0.83
4 | 166414 166350 166890
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -427.18
| 2 1 |
| 2 1 1 2 |
| 1 2 |
| 1 1 2 11 * |
| 21 1 11 1 112 |
| 2 2 2 2 221 2 1 1 2 2 1 22 |
| 2 * 2 1 1 1 2 2 1 211 1 |
| 1 1 2 21 2 1 22 2 2 1 1 12* |
| 1 1 2 1 1 2 11 221 2 2 2 1 |
| 2 2 * 1 2 2 1 1 1 1 1|
| 1 1 1 12 1 22 1 |
| 2 2 2 2 2 2|
|* 12 2 |
| 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -429.40
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -427.07 -432.88
2 -427.11 -430.64
--------------------------------------
TOTAL -427.09 -432.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.857618 0.086071 0.345309 1.450751 0.825310 1478.95 1489.98 1.003
r(A<->C){all} 0.131906 0.014708 0.000033 0.378651 0.095153 194.40 213.37 1.000
r(A<->G){all} 0.158995 0.019132 0.000029 0.441055 0.121193 135.69 145.02 1.011
r(A<->T){all} 0.179164 0.024235 0.000048 0.499330 0.134549 139.40 195.47 1.002
r(C<->G){all} 0.123027 0.013727 0.000004 0.368758 0.085249 118.79 215.82 1.003
r(C<->T){all} 0.227077 0.024126 0.000212 0.524120 0.205034 161.81 167.99 1.000
r(G<->T){all} 0.179830 0.021444 0.000063 0.462343 0.141717 145.69 278.44 1.006
pi(A){all} 0.244666 0.000600 0.200105 0.294233 0.244560 1084.23 1225.57 1.000
pi(C){all} 0.219234 0.000566 0.173483 0.264406 0.218744 1212.54 1215.52 1.000
pi(G){all} 0.287859 0.000669 0.237618 0.340223 0.286969 1165.14 1248.60 1.000
pi(T){all} 0.248241 0.000627 0.202559 0.298092 0.247843 1165.19 1273.85 1.000
alpha{1,2} 0.275860 0.086622 0.001379 0.807832 0.186442 1081.92 1194.22 1.000
alpha{3} 0.387095 0.206534 0.000262 1.315246 0.228126 1431.37 1464.78 1.000
pinvar{all} 0.987066 0.000111 0.966077 0.999685 0.989904 1306.55 1327.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .****.
9 -- ....**
10 -- .**.**
11 -- ..*.*.
12 -- .**...
13 -- ...*.*
14 -- ..****
15 -- .*...*
16 -- .*..*.
17 -- ..*..*
18 -- .*.***
19 -- .*.*..
20 -- ..**..
21 -- .***.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 479 0.159560 0.012719 0.150566 0.168554 2
8 450 0.149900 0.003769 0.147235 0.152565 2
9 443 0.147568 0.013662 0.137908 0.157229 2
10 436 0.145237 0.005653 0.141239 0.149234 2
11 434 0.144570 0.016017 0.133245 0.155896 2
12 433 0.144237 0.016488 0.132578 0.155896 2
13 432 0.143904 0.007537 0.138574 0.149234 2
14 430 0.143238 0.001884 0.141905 0.144570 2
15 424 0.141239 0.016017 0.129913 0.152565 2
16 421 0.140240 0.003298 0.137908 0.142572 2
17 419 0.139574 0.013662 0.129913 0.149234 2
18 415 0.138241 0.005182 0.134577 0.141905 2
19 401 0.133578 0.006124 0.129247 0.137908 2
20 399 0.132911 0.004240 0.129913 0.135909 2
21 397 0.132245 0.005182 0.128581 0.135909 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.087784 0.008107 0.000009 0.269818 0.060193 1.001 2
length{all}[2] 0.153684 0.014752 0.000175 0.394759 0.124153 1.000 2
length{all}[3] 0.088545 0.008326 0.000010 0.259721 0.059477 1.002 2
length{all}[4] 0.086572 0.008279 0.000004 0.275183 0.056898 1.001 2
length{all}[5] 0.089935 0.008892 0.000147 0.277928 0.061519 1.000 2
length{all}[6] 0.084949 0.007630 0.000018 0.265624 0.058438 1.001 2
length{all}[7] 0.094963 0.008066 0.000046 0.259829 0.066617 1.000 2
length{all}[8] 0.085951 0.006458 0.000047 0.245198 0.064569 0.998 2
length{all}[9] 0.085737 0.007392 0.000114 0.252182 0.056879 0.999 2
length{all}[10] 0.082431 0.006151 0.000376 0.236465 0.054566 0.998 2
length{all}[11] 0.086725 0.007649 0.000744 0.241251 0.060559 1.007 2
length{all}[12] 0.082192 0.007101 0.000636 0.225382 0.058842 0.998 2
length{all}[13] 0.086007 0.007777 0.000364 0.268873 0.057896 0.998 2
length{all}[14] 0.090553 0.009373 0.000060 0.280683 0.058631 0.999 2
length{all}[15] 0.093340 0.008296 0.000078 0.266196 0.063815 1.000 2
length{all}[16] 0.087044 0.007516 0.000012 0.249134 0.061211 0.998 2
length{all}[17] 0.091012 0.007989 0.000143 0.276392 0.059751 1.003 2
length{all}[18] 0.083962 0.008669 0.000013 0.256526 0.049104 0.998 2
length{all}[19] 0.091068 0.009149 0.000424 0.270074 0.059383 1.005 2
length{all}[20] 0.088645 0.009261 0.000053 0.288230 0.055559 0.998 2
length{all}[21] 0.093206 0.010187 0.000029 0.274744 0.059390 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008762
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------- C3 (3)
+
|--------------------------------- C4 (4)
|
|------------------------------------ C5 (5)
|
\---------------------------------- C6 (6)
|----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 300
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 100 / 100 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 100 / 100 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.087323 0.045438 0.069784 0.016497 0.046909 0.068073 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -440.950527
Iterating by ming2
Initial: fx= 440.950527
x= 0.08732 0.04544 0.06978 0.01650 0.04691 0.06807 0.30000 1.30000
1 h-m-p 0.0000 0.0002 233.0778 +++ 431.950722 m 0.0002 14 | 1/8
2 h-m-p 0.0000 0.0000 2216.5977 ++ 419.676438 m 0.0000 25 | 2/8
3 h-m-p 0.0005 0.0023 37.0732 ++ 412.743241 m 0.0023 36 | 3/8
4 h-m-p 0.0000 0.0001 52.8044 ++ 412.382932 m 0.0001 47 | 4/8
5 h-m-p 0.0001 0.0066 29.6951 ++++ 410.274959 m 0.0066 60 | 5/8
6 h-m-p 0.1183 3.3036 1.6546 +CYC 409.888194 2 0.3859 75 | 5/8
7 h-m-p 0.3604 1.8022 0.4013 +YCYCCC 409.366281 5 1.0339 95 | 5/8
8 h-m-p 0.8952 8.0000 0.4634 ++ 408.893282 m 8.0000 109 | 5/8
9 h-m-p 0.5985 2.9927 0.7619 YCYCCC 408.596943 5 1.4598 131 | 5/8
10 h-m-p 1.3681 8.0000 0.8130 ++ 408.376593 m 8.0000 145 | 5/8
11 h-m-p 0.9693 4.8463 3.3425 CYCCC 408.294642 4 1.3876 166 | 5/8
12 h-m-p 1.4512 8.0000 3.1959 +YCCC 408.207476 3 4.1156 183 | 5/8
13 h-m-p 1.6000 8.0000 4.6933 CCCC 408.154466 3 2.6745 200 | 5/8
14 h-m-p 1.6000 8.0000 6.2397 +YCCC 408.118629 3 4.4231 217 | 5/8
15 h-m-p 1.6000 8.0000 11.2807 CCC 408.095016 2 2.5859 232 | 5/8
16 h-m-p 1.6000 8.0000 14.5825 +YCCC 408.078761 3 4.1661 249 | 5/8
17 h-m-p 1.6000 8.0000 24.7368 YC 408.068392 1 2.6450 261 | 5/8
18 h-m-p 1.6000 8.0000 33.4724 +YCCC 408.060761 3 4.3262 278 | 5/8
19 h-m-p 1.6000 8.0000 54.7729 YC 408.056361 1 2.5737 290 | 5/8
20 h-m-p 1.6000 8.0000 73.9347 +YC 408.052926 1 4.5976 303 | 5/8
21 h-m-p 0.6836 3.4178 120.4275 +CC 408.051042 1 2.4169 317 | 5/8
22 h-m-p 0.1478 0.7388 163.1656 ++ 408.050549 m 0.7388 328 | 6/8
23 h-m-p 0.1409 0.7047 319.4321 ++ 408.049758 m 0.7047 339 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 Y 408.049755 0 1.0188 350 | 7/8
25 h-m-p 1.6000 8.0000 0.0000 ---------N 408.049755 0 0.0000 371
Out..
lnL = -408.049755
372 lfun, 372 eigenQcodon, 2232 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.076762 0.088332 0.105091 0.047006 0.058952 0.053527 999.000000 0.674856 0.545006
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.024095
np = 9
lnL0 = -446.646337
Iterating by ming2
Initial: fx= 446.646337
x= 0.07676 0.08833 0.10509 0.04701 0.05895 0.05353 951.42857 0.67486 0.54501
1 h-m-p 0.0000 0.0005 225.6091 +++ 421.219111 m 0.0005 15 | 1/9
2 h-m-p 0.0000 0.0000 3908.4844 ++ 417.959653 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0001 82.2665 ++ 416.268391 m 0.0001 39 | 3/9
4 h-m-p 0.0002 0.0012 49.0308 ++ 411.853488 m 0.0012 51 | 4/9
5 h-m-p 0.0001 0.0004 66.1591 ++ 409.021986 m 0.0004 63 | 5/9
6 h-m-p 0.0410 0.8190 0.2319 +YCYCCC 408.593604 5 0.4502 84 | 5/9
7 h-m-p 0.2217 1.1435 0.4708 ++ 408.485798 m 1.1435 100 | 6/9
8 h-m-p 1.3252 6.6259 0.0307 YC 408.479521 1 0.6675 117 | 6/9
9 h-m-p 1.6000 8.0000 0.0008 YC 408.479512 1 0.8963 133 | 6/9
10 h-m-p 1.6000 8.0000 0.0000 ---C 408.479512 0 0.0063 151
Out..
lnL = -408.479512
152 lfun, 456 eigenQcodon, 1824 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.037073 0.033637 0.069759 0.101427 0.011682 0.082727 951.428578 1.330168 0.182379 0.343801 1141.088387
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000181
np = 11
lnL0 = -421.272694
Iterating by ming2
Initial: fx= 421.272694
x= 0.03707 0.03364 0.06976 0.10143 0.01168 0.08273 951.42858 1.33017 0.18238 0.34380 951.42857
1 h-m-p 0.0000 0.0005 45.8221 +++ 420.135753 m 0.0005 17 | 1/11
2 h-m-p 0.0002 0.0009 82.7898 ++ 418.062314 m 0.0009 31 | 2/11
3 h-m-p 0.0003 0.0013 55.0349 ++ 415.105774 m 0.0013 45 | 3/11
4 h-m-p 0.0079 0.0442 8.1602 ++ 412.796039 m 0.0442 59 | 4/11
5 h-m-p 0.0000 0.0000 19.2393 ++ 412.775325 m 0.0000 73 | 5/11
6 h-m-p 0.0001 0.0339 50.4811 ++++CYYCYYYCCC 408.084058 9 0.0315 105 | 5/11
7 h-m-p 1.6000 8.0000 0.0086 ---------------C 408.084058 0 0.0000 134 | 5/11
8 h-m-p 0.0160 8.0000 0.0360 +++++ 408.074480 m 8.0000 157 | 5/11
9 h-m-p 0.8484 8.0000 0.3396 +CYYC 408.067467 3 2.2348 183 | 5/11
10 h-m-p 1.6000 8.0000 0.0066 ++ 408.067130 m 8.0000 203 | 5/11
11 h-m-p 0.0086 0.0445 6.1991 ++ 408.065459 m 0.0445 223 | 6/11
12 h-m-p 0.0295 2.1512 3.0721 ++YYCC 408.054081 3 0.3765 243 | 6/11
13 h-m-p 1.6000 8.0000 0.1223 ++ 408.052163 m 8.0000 257 | 6/11
14 h-m-p 1.6000 8.0000 0.4880 YCC 408.051105 2 0.9169 279 | 6/11
15 h-m-p 0.9124 8.0000 0.4904 +YC 408.050419 1 2.5463 300 | 6/11
16 h-m-p 1.6000 8.0000 0.3572 YC 408.050117 1 2.9131 320 | 6/11
17 h-m-p 1.6000 8.0000 0.5424 C 408.050000 0 1.9420 339 | 6/11
18 h-m-p 1.6000 8.0000 0.3974 YC 408.049941 1 3.6386 359 | 6/11
19 h-m-p 1.6000 8.0000 0.5125 C 408.049922 0 1.9391 378 | 6/11
20 h-m-p 1.6000 8.0000 0.4321 Y 408.049912 0 3.7324 397 | 6/11
21 h-m-p 1.6000 8.0000 0.5310 C 408.049909 0 2.0409 416 | 6/11
22 h-m-p 1.6000 8.0000 0.4965 Y 408.049907 0 3.5301 435 | 6/11
23 h-m-p 1.6000 8.0000 0.5912 C 408.049906 0 2.1705 454 | 6/11
24 h-m-p 1.6000 8.0000 0.5704 Y 408.049906 0 3.1791 473 | 6/11
25 h-m-p 1.6000 8.0000 0.6569 C 408.049906 0 2.3617 492 | 6/11
26 h-m-p 1.6000 8.0000 0.6248 Y 408.049906 0 2.7044 511 | 6/11
27 h-m-p 1.6000 8.0000 0.7343 Y 408.049906 0 2.9002 530 | 6/11
28 h-m-p 1.6000 8.0000 0.6327 C 408.049906 0 2.0067 549 | 6/11
29 h-m-p 1.4684 8.0000 0.8646 ++ 408.049906 m 8.0000 568 | 6/11
30 h-m-p 1.6000 8.0000 1.2123 C 408.049906 0 1.5411 587 | 6/11
31 h-m-p 0.0190 0.8805 98.4220 Y 408.049906 0 0.0025 601 | 6/11
32 h-m-p 1.6000 8.0000 0.0237 C 408.049906 0 2.2648 615 | 6/11
33 h-m-p 0.9501 8.0000 0.0564 +Y 408.049906 0 2.6291 635 | 6/11
34 h-m-p 0.6641 8.0000 0.2234 Y 408.049906 0 1.2036 654 | 6/11
35 h-m-p 0.5148 8.0000 0.5223 +Y 408.049906 0 1.7383 674 | 6/11
36 h-m-p 0.6710 8.0000 1.3532 +C 408.049906 0 3.2384 694 | 6/11
37 h-m-p 1.6000 8.0000 1.7114 ++ 408.049906 m 8.0000 708 | 6/11
38 h-m-p 0.3439 1.7194 39.0105 ++ 408.049906 m 1.7194 722 | 6/11
39 h-m-p -0.0000 -0.0000 133.5281
h-m-p: -0.00000000e+00 -0.00000000e+00 1.33528102e+02 408.049906
.. | 6/11
40 h-m-p 0.0160 8.0000 0.0188 ---Y 408.049906 0 0.0001 750 | 6/11
41 h-m-p 0.8245 8.0000 0.0000 -C 408.049906 0 0.0515 770
Out..
lnL = -408.049906
771 lfun, 3084 eigenQcodon, 13878 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -412.991141 S = -411.552310 -2.367379
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:05
did 20 / 45 patterns 0:05
did 30 / 45 patterns 0:05
did 40 / 45 patterns 0:05
did 45 / 45 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.073276 0.100286 0.078430 0.100115 0.096706 0.022912 951.453314 1.179832 1.012073
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.027642
np = 9
lnL0 = -450.150666
Iterating by ming2
Initial: fx= 450.150666
x= 0.07328 0.10029 0.07843 0.10012 0.09671 0.02291 951.45331 1.17983 1.01207
1 h-m-p 0.0000 0.0002 220.3677 +++ 438.207094 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0005 159.3082 +YYYCCCYC 431.437200 7 0.0005 39 | 1/9
3 h-m-p 0.0052 0.0824 14.3469 ------------.. | 1/9
4 h-m-p 0.0000 0.0005 190.5063 +++ 414.719534 m 0.0005 74 | 2/9
5 h-m-p 0.0000 0.0000 11316.4393 ++ 413.214425 m 0.0000 86 | 3/9
6 h-m-p 0.0030 0.0784 2.4890 --Y 413.214420 0 0.0001 100 | 3/9
7 h-m-p 0.1492 8.0000 0.0014 ---------------.. | 3/9
8 h-m-p 0.0000 0.0002 147.4393 +++ 409.118474 m 0.0002 144 | 4/9
9 h-m-p 0.0000 0.0000 478.7719 ++ 408.767461 m 0.0000 156 | 5/9
10 h-m-p 0.0112 5.5840 0.2384 ++++YCCC 408.646418 3 1.9144 177 | 5/9
11 h-m-p 0.2406 1.2031 0.6776 ++ 408.480022 m 1.2031 193 | 6/9
12 h-m-p 1.6000 8.0000 0.0032 CC 408.479512 1 1.2875 211 | 6/9
13 h-m-p 1.6000 8.0000 0.0000 C 408.479512 0 1.3594 226
Out..
lnL = -408.479512
227 lfun, 2497 eigenQcodon, 13620 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.096133 0.060061 0.068068 0.088083 0.024883 0.092554 951.453330 0.900000 0.425661 1.150003 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000302
np = 11
lnL0 = -418.170364
Iterating by ming2
Initial: fx= 418.170364
x= 0.09613 0.06006 0.06807 0.08808 0.02488 0.09255 951.45333 0.90000 0.42566 1.15000 951.42857
1 h-m-p 0.0000 0.0016 64.9733 +++YCYYYYCYCY 412.528266 10 0.0014 32 | 0/11
2 h-m-p 0.0002 0.0011 17.7445 ++ 412.240315 m 0.0011 46 | 1/11
3 h-m-p 0.0011 0.0167 15.8938 +YCYCCCC 411.510953 6 0.0068 71 | 1/11
4 h-m-p 0.0013 0.0063 13.1492 ++ 410.060696 m 0.0063 85 | 2/11
5 h-m-p 0.0007 0.0034 1.3488 ++ 410.032212 m 0.0034 99 | 3/11
6 h-m-p 0.0000 0.0002 12.4921 ++ 409.986679 m 0.0002 113 | 4/11
7 h-m-p 0.0007 0.2328 1.3806 ++CYC 409.933734 2 0.0086 132 | 4/11
8 h-m-p 0.0195 0.4462 0.6124 +++ 409.586255 m 0.4462 147 | 5/11
9 h-m-p 0.4217 2.3542 0.6475 +YYYYCYYCYC 408.229354 9 2.1580 181 | 5/11
10 h-m-p 1.6000 8.0000 0.0559 -CC 408.227409 1 0.0990 204 | 5/11
11 h-m-p 0.0122 2.0242 0.4527 +++
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
+ 408.121420 m 2.0242 226
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79051, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
12 h-m-p 1.6000 8.0000 0.2749
QuantileBeta(0.85, 3.23033, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.54980, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.70298, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 3.71401, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 4.13191, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75425, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.94308, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
C 408.091911 3 3.5163 251
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75726, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75694, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.75710, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
13 h-m-p 1.6000 8.0000 0.5280
QuantileBeta(0.85, 4.60181, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.13596, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.30493, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 4.26061, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 4.00885, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24329, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 4.12607, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
C 408.079003 3 0.9178 275
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24149, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.24166, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
14 h-m-p 1.2106 8.0000 0.4003
QuantileBeta(0.85, 4.72623, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17995, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 7.44374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.72071, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 5.79685, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 5.98840, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
C 408.067157 2 3.9347 298
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81679, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81638, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.81658, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
15 h-m-p 1.6000 8.0000 0.5234
QuantileBeta(0.85, 6.65399, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.16621, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.10913, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 8.13767, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99858, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
C 408.062206 2 2.2385 320
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98837, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98792, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.98814, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
16 h-m-p 1.1545 8.0000 1.0149
QuantileBeta(0.85, 8.15971, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.67439, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.93748, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 9.05186, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 10.36313, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.13328, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 9.74820, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
C 408.058126 3 2.1233 344
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.14289, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
17 h-m-p 1.6000 8.0000 0.9619
QuantileBeta(0.85, 10.68177, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.29841, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 16.83729, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.80331, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 12.74254, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.52297, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 13.63276, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
C 408.054510 2 5.5471 363
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47772, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.47807, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
18 h-m-p 1.6000 8.0000 2.6154
QuantileBeta(0.85, 18.66238, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 31.21531, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.13362, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 17.39991, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 18.03114, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
C 408.053019 2 1.1354 385
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.44743, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
19 h-m-p 1.6000 8.0000 1.6121
QuantileBeta(0.85, 20.02663, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.76425, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
+ 408.051234 m 8.0000 399
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34348, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 30.34346, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
20 h-m-p 1.6000 8.0000 4.2545
QuantileBeta(0.85, 37.15018, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 57.88116, 0.00500) = 1.000000e+00 2000 rounds
C 408.050476 0 6.4000 414
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 57.57035, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
21 h-m-p 0.4623 2.3116 11.9883 YC 408.050063 1 1.0627 429 | 6/11
22 h-m-p 0.4400 2.2001 6.8043 ++ 408.049913 m 2.2001 443 | 7/11
23 h-m-p 0.0624 0.3120 43.9741 --------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.3582 ---Y 408.049906 0 0.0001 486 | 7/11
25 h-m-p 1.6000 8.0000 0.0000 ---C 408.049906 0 0.0063 507
Out..
lnL = -408.049906
508 lfun, 6096 eigenQcodon, 33528 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -412.729984 S = -411.552248 -1.981194
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:20
did 20 / 45 patterns 0:20
did 30 / 45 patterns 0:20
did 40 / 45 patterns 0:20
did 45 / 45 patterns 0:20
Time used: 0:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=100
NC_011896_1_WP_012634415_1_421_MLBR_RS02010 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
NC_002677_1_NP_301390_1_262_ML0410 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK
**************************************************
NC_011896_1_WP_012634415_1_421_MLBR_RS02010 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
NC_002677_1_NP_301390_1_262_ML0410 LVSQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270 LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
*.************************************************
>NC_011896_1_WP_012634415_1_421_MLBR_RS02010 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT >NC_002677_1_NP_301390_1_262_ML0410 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG CTAGTATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT >NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT >NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT >NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT >NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270 ATGTCCTTTTTTCTGAGAGTAGAAGTAGGTGGGTTGATGATGGCAGCCGG CAGATTGGAGCGCATTACCTCCGAGTCTATGGCATGCAATGCCAAGCTTA CTCCTGTAACCACCAAGGTTGTCCCACCGGCCGCCGACCAAGTGTCGAAG CTAGCATCGCAGGTATTTAGTTCCTACGGGAAGCAGTACGAGGGGTATGC CGCTCAGGGTGTAGACCAGAGTCGGTTGTTTGTCCAGAGTCTGAAAGATG CCGCAGGTGATTATATGGACAGTGATCATATGTATCTAAACACAGAGGAT
>NC_011896_1_WP_012634415_1_421_MLBR_RS02010 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED >NC_002677_1_NP_301390_1_262_ML0410 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK LVSQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED >NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED >NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED >NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED >NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270 MSFFLRVEVGGLMMAAGRLERITSESMACNAKLTPVTTKVVPPAADQVSK LASQVFSSYGKQYEGYAAQGVDQSRLFVQSLKDAAGDYMDSDHMYLNTED
#NEXUS
[ID: 1309755838]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_012634415_1_421_MLBR_RS02010
NC_002677_1_NP_301390_1_262_ML0410
NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840
NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610
NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180
NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634415_1_421_MLBR_RS02010,
2 NC_002677_1_NP_301390_1_262_ML0410,
3 NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840,
4 NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610,
5 NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180,
6 NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06019286,2:0.1241535,3:0.05947701,4:0.05689802,5:0.06151888,6:0.05843765);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06019286,2:0.1241535,3:0.05947701,4:0.05689802,5:0.06151888,6:0.05843765);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -427.07 -432.88
2 -427.11 -430.64
--------------------------------------
TOTAL -427.09 -432.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0410/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.857618 0.086071 0.345309 1.450751 0.825310 1478.95 1489.98 1.003
r(A<->C){all} 0.131906 0.014708 0.000033 0.378651 0.095153 194.40 213.37 1.000
r(A<->G){all} 0.158995 0.019132 0.000029 0.441055 0.121193 135.69 145.02 1.011
r(A<->T){all} 0.179164 0.024235 0.000048 0.499330 0.134549 139.40 195.47 1.002
r(C<->G){all} 0.123027 0.013727 0.000004 0.368758 0.085249 118.79 215.82 1.003
r(C<->T){all} 0.227077 0.024126 0.000212 0.524120 0.205034 161.81 167.99 1.000
r(G<->T){all} 0.179830 0.021444 0.000063 0.462343 0.141717 145.69 278.44 1.006
pi(A){all} 0.244666 0.000600 0.200105 0.294233 0.244560 1084.23 1225.57 1.000
pi(C){all} 0.219234 0.000566 0.173483 0.264406 0.218744 1212.54 1215.52 1.000
pi(G){all} 0.287859 0.000669 0.237618 0.340223 0.286969 1165.14 1248.60 1.000
pi(T){all} 0.248241 0.000627 0.202559 0.298092 0.247843 1165.19 1273.85 1.000
alpha{1,2} 0.275860 0.086622 0.001379 0.807832 0.186442 1081.92 1194.22 1.000
alpha{3} 0.387095 0.206534 0.000262 1.315246 0.228126 1431.37 1464.78 1.000
pinvar{all} 0.987066 0.000111 0.966077 0.999685 0.989904 1306.55 1327.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0410/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 100
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 3 3 3 3 3 3 | TAC 2 2 2 2 2 2 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 5 5 5 5 5 5 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 4 4 4 4 4 4
ATC 0 0 0 0 0 0 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 2 2 2 2 2 2
Met ATG 6 6 6 6 6 6 | ACG 0 0 0 0 0 0 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 4 4 4 4 4 4 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 6 6 6 6 6 6 | GAC 3 3 3 3 3 3 | GGC 1 1 1 1 1 1
GTA 5 6 5 5 5 5 | GCA 4 3 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 4 4 4 4 4 4 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634415_1_421_MLBR_RS02010
position 1: T:0.19000 C:0.17000 A:0.25000 G:0.39000
position 2: T:0.28000 C:0.25000 A:0.31000 G:0.16000
position 3: T:0.27000 C:0.23000 A:0.18000 G:0.32000
Average T:0.24667 C:0.21667 A:0.24667 G:0.29000
#2: NC_002677_1_NP_301390_1_262_ML0410
position 1: T:0.19000 C:0.17000 A:0.25000 G:0.39000
position 2: T:0.29000 C:0.24000 A:0.31000 G:0.16000
position 3: T:0.27000 C:0.23000 A:0.18000 G:0.32000
Average T:0.25000 C:0.21333 A:0.24667 G:0.29000
#3: NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840
position 1: T:0.19000 C:0.17000 A:0.25000 G:0.39000
position 2: T:0.28000 C:0.25000 A:0.31000 G:0.16000
position 3: T:0.27000 C:0.23000 A:0.18000 G:0.32000
Average T:0.24667 C:0.21667 A:0.24667 G:0.29000
#4: NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610
position 1: T:0.19000 C:0.17000 A:0.25000 G:0.39000
position 2: T:0.28000 C:0.25000 A:0.31000 G:0.16000
position 3: T:0.27000 C:0.23000 A:0.18000 G:0.32000
Average T:0.24667 C:0.21667 A:0.24667 G:0.29000
#5: NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180
position 1: T:0.19000 C:0.17000 A:0.25000 G:0.39000
position 2: T:0.28000 C:0.25000 A:0.31000 G:0.16000
position 3: T:0.27000 C:0.23000 A:0.18000 G:0.32000
Average T:0.24667 C:0.21667 A:0.24667 G:0.29000
#6: NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270
position 1: T:0.19000 C:0.17000 A:0.25000 G:0.39000
position 2: T:0.28000 C:0.25000 A:0.31000 G:0.16000
position 3: T:0.27000 C:0.23000 A:0.18000 G:0.32000
Average T:0.24667 C:0.21667 A:0.24667 G:0.29000
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 24 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 0
TTC 0 | TCC 18 | TAC 12 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 0
CTC 0 | CCC 0 | CAC 0 | CGC 6
CTA 12 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 12 | CCG 6 | CAG 30 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 24
ATC 0 | ACC 18 | AAC 6 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 12
Met M ATG 36 | ACG 0 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 24 | Gly G GGT 18
GTC 12 | GCC 36 | GAC 18 | GGC 6
GTA 31 | GCA 23 | Glu E GAA 6 | GGA 0
GTG 6 | GCG 0 | GAG 24 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19000 C:0.17000 A:0.25000 G:0.39000
position 2: T:0.28167 C:0.24833 A:0.31000 G:0.16000
position 3: T:0.27000 C:0.23000 A:0.18000 G:0.32000
Average T:0.24722 C:0.21611 A:0.24667 G:0.29000
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -408.049755 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.010480 0.000004 0.000004 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.010500
(1: 0.000004, 2: 0.010480, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634415_1_421_MLBR_RS02010: 0.000004, NC_002677_1_NP_301390_1_262_ML0410: 0.010480, NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840: 0.000004, NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610: 0.000004, NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180: 0.000004, NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 198.7 101.3 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.010 198.7 101.3 999.0000 0.0053 0.0000 1.0 0.0
7..3 0.000 198.7 101.3 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 198.7 101.3 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 198.7 101.3 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 198.7 101.3 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0053
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -408.479512 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.010279 0.000004 0.000004 0.000004 0.000004 951.428578 0.249986 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.010299
(1: 0.000004, 2: 0.010279, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634415_1_421_MLBR_RS02010: 0.000004, NC_002677_1_NP_301390_1_262_ML0410: 0.010279, NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840: 0.000004, NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610: 0.000004, NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180: 0.000004, NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.24999 0.75001
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.010 198.7 101.3 1.0000 0.0034 0.0034 0.7 0.3
7..3 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -408.049906 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.010480 0.000004 0.000004 0.000004 0.000004 951.453314 0.000000 0.000000 0.000001 951.504292
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.010500
(1: 0.000004, 2: 0.010480, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634415_1_421_MLBR_RS02010: 0.000004, NC_002677_1_NP_301390_1_262_ML0410: 0.010480, NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840: 0.000004, NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610: 0.000004, NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180: 0.000004, NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.45331
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 951.50429
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 198.7 101.3 951.5043 0.0000 0.0000 0.0 0.0
7..2 0.010 198.7 101.3 951.5043 0.0053 0.0000 1.0 0.0
7..3 0.000 198.7 101.3 951.5043 0.0000 0.0000 0.0 0.0
7..4 0.000 198.7 101.3 951.5043 0.0000 0.0000 0.0 0.0
7..5 0.000 198.7 101.3 951.5043 0.0000 0.0000 0.0 0.0
7..6 0.000 198.7 101.3 951.5043 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634415_1_421_MLBR_RS02010)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.504
2 S 1.000** 951.504
3 F 1.000** 951.504
4 F 1.000** 951.504
5 L 1.000** 951.504
6 R 1.000** 951.504
7 V 1.000** 951.504
8 E 1.000** 951.504
9 V 1.000** 951.504
10 G 1.000** 951.504
11 G 1.000** 951.504
12 L 1.000** 951.504
13 M 1.000** 951.504
14 M 1.000** 951.504
15 A 1.000** 951.504
16 A 1.000** 951.504
17 G 1.000** 951.504
18 R 1.000** 951.504
19 L 1.000** 951.504
20 E 1.000** 951.504
21 R 1.000** 951.504
22 I 1.000** 951.504
23 T 1.000** 951.504
24 S 1.000** 951.504
25 E 1.000** 951.504
26 S 1.000** 951.504
27 M 1.000** 951.504
28 A 1.000** 951.504
29 C 1.000** 951.504
30 N 1.000** 951.504
31 A 1.000** 951.504
32 K 1.000** 951.504
33 L 1.000** 951.504
34 T 1.000** 951.504
35 P 1.000** 951.504
36 V 1.000** 951.504
37 T 1.000** 951.504
38 T 1.000** 951.504
39 K 1.000** 951.504
40 V 1.000** 951.504
41 V 1.000** 951.504
42 P 1.000** 951.504
43 P 1.000** 951.504
44 A 1.000** 951.504
45 A 1.000** 951.504
46 D 1.000** 951.504
47 Q 1.000** 951.504
48 V 1.000** 951.504
49 S 1.000** 951.504
50 K 1.000** 951.504
51 L 1.000** 951.504
52 A 1.000** 951.504
53 S 1.000** 951.504
54 Q 1.000** 951.504
55 V 1.000** 951.504
56 F 1.000** 951.504
57 S 1.000** 951.504
58 S 1.000** 951.504
59 Y 1.000** 951.504
60 G 1.000** 951.504
61 K 1.000** 951.504
62 Q 1.000** 951.504
63 Y 1.000** 951.504
64 E 1.000** 951.504
65 G 1.000** 951.504
66 Y 1.000** 951.504
67 A 1.000** 951.504
68 A 1.000** 951.504
69 Q 1.000** 951.504
70 G 1.000** 951.504
71 V 1.000** 951.504
72 D 1.000** 951.504
73 Q 1.000** 951.504
74 S 1.000** 951.504
75 R 1.000** 951.504
76 L 1.000** 951.504
77 F 1.000** 951.504
78 V 1.000** 951.504
79 Q 1.000** 951.504
80 S 1.000** 951.504
81 L 1.000** 951.504
82 K 1.000** 951.504
83 D 1.000** 951.504
84 A 1.000** 951.504
85 A 1.000** 951.504
86 G 1.000** 951.504
87 D 1.000** 951.504
88 Y 1.000** 951.504
89 M 1.000** 951.504
90 D 1.000** 951.504
91 S 1.000** 951.504
92 D 1.000** 951.504
93 H 1.000** 951.504
94 M 1.000** 951.504
95 Y 1.000** 951.504
96 L 1.000** 951.504
97 N 1.000** 951.504
98 T 1.000** 951.504
99 E 1.000** 951.504
100 D 1.000** 951.504
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634415_1_421_MLBR_RS02010)
Pr(w>1) post mean +- SE for w
52 A 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -408.479512 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.010279 0.000004 0.000004 0.000004 0.000004 951.453330 1.948598 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.010299
(1: 0.000004, 2: 0.010279, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634415_1_421_MLBR_RS02010: 0.000004, NC_002677_1_NP_301390_1_262_ML0410: 0.010279, NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840: 0.000004, NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610: 0.000004, NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180: 0.000004, NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.45333
Parameters in M7 (beta):
p = 1.94860 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.010 198.7 101.3 1.0000 0.0034 0.0034 0.7 0.3
7..3 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 198.7 101.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -408.049906 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.010480 0.000004 0.000004 0.000004 0.000004 951.461784 0.000010 85.278952 0.005000 951.460870
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.010500
(1: 0.000004, 2: 0.010480, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634415_1_421_MLBR_RS02010: 0.000004, NC_002677_1_NP_301390_1_262_ML0410: 0.010480, NZ_LVXE01000036_1_WP_012634415_1_1605_A3216_RS09840: 0.000004, NZ_LYPH01000040_1_WP_012634415_1_1590_A8144_RS07610: 0.000004, NZ_CP029543_1_WP_012634415_1_426_DIJ64_RS02180: 0.000004, NZ_AP014567_1_WP_012634415_1_444_JK2ML_RS02270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.46178
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 85.27895 q = 0.00500
(p1 = 0.99999) w = 951.46087
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 951.46087
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 198.7 101.3 951.4514 0.0000 0.0000 0.0 0.0
7..2 0.010 198.7 101.3 951.4514 0.0053 0.0000 1.0 0.0
7..3 0.000 198.7 101.3 951.4514 0.0000 0.0000 0.0 0.0
7..4 0.000 198.7 101.3 951.4514 0.0000 0.0000 0.0 0.0
7..5 0.000 198.7 101.3 951.4514 0.0000 0.0000 0.0 0.0
7..6 0.000 198.7 101.3 951.4514 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634415_1_421_MLBR_RS02010)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.451
2 S 1.000** 951.451
3 F 1.000** 951.451
4 F 1.000** 951.451
5 L 1.000** 951.451
6 R 1.000** 951.451
7 V 1.000** 951.451
8 E 1.000** 951.451
9 V 1.000** 951.451
10 G 1.000** 951.451
11 G 1.000** 951.451
12 L 1.000** 951.451
13 M 1.000** 951.451
14 M 1.000** 951.451
15 A 1.000** 951.451
16 A 1.000** 951.451
17 G 1.000** 951.451
18 R 1.000** 951.451
19 L 1.000** 951.451
20 E 1.000** 951.451
21 R 1.000** 951.451
22 I 1.000** 951.451
23 T 1.000** 951.451
24 S 1.000** 951.451
25 E 1.000** 951.451
26 S 1.000** 951.451
27 M 1.000** 951.451
28 A 1.000** 951.451
29 C 1.000** 951.451
30 N 1.000** 951.451
31 A 1.000** 951.451
32 K 1.000** 951.451
33 L 1.000** 951.451
34 T 1.000** 951.451
35 P 1.000** 951.451
36 V 1.000** 951.451
37 T 1.000** 951.451
38 T 1.000** 951.451
39 K 1.000** 951.451
40 V 1.000** 951.451
41 V 1.000** 951.451
42 P 1.000** 951.451
43 P 1.000** 951.451
44 A 1.000** 951.451
45 A 1.000** 951.451
46 D 1.000** 951.451
47 Q 1.000** 951.451
48 V 1.000** 951.451
49 S 1.000** 951.451
50 K 1.000** 951.451
51 L 1.000** 951.451
52 A 1.000** 951.461
53 S 1.000** 951.451
54 Q 1.000** 951.451
55 V 1.000** 951.451
56 F 1.000** 951.451
57 S 1.000** 951.451
58 S 1.000** 951.451
59 Y 1.000** 951.451
60 G 1.000** 951.451
61 K 1.000** 951.451
62 Q 1.000** 951.451
63 Y 1.000** 951.451
64 E 1.000** 951.451
65 G 1.000** 951.451
66 Y 1.000** 951.451
67 A 1.000** 951.451
68 A 1.000** 951.451
69 Q 1.000** 951.451
70 G 1.000** 951.451
71 V 1.000** 951.451
72 D 1.000** 951.451
73 Q 1.000** 951.451
74 S 1.000** 951.451
75 R 1.000** 951.451
76 L 1.000** 951.451
77 F 1.000** 951.451
78 V 1.000** 951.451
79 Q 1.000** 951.451
80 S 1.000** 951.451
81 L 1.000** 951.451
82 K 1.000** 951.451
83 D 1.000** 951.451
84 A 1.000** 951.451
85 A 1.000** 951.451
86 G 1.000** 951.451
87 D 1.000** 951.451
88 Y 1.000** 951.451
89 M 1.000** 951.451
90 D 1.000** 951.451
91 S 1.000** 951.451
92 D 1.000** 951.451
93 H 1.000** 951.451
94 M 1.000** 951.451
95 Y 1.000** 951.451
96 L 1.000** 951.451
97 N 1.000** 951.451
98 T 1.000** 951.451
99 E 1.000** 951.451
100 D 1.000** 951.451
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634415_1_421_MLBR_RS02010)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 S 0.639 4.860 +- 3.856
3 F 0.639 4.860 +- 3.856
4 F 0.639 4.860 +- 3.856
5 L 0.639 4.860 +- 3.856
6 R 0.639 4.860 +- 3.856
7 V 0.639 4.860 +- 3.856
8 E 0.639 4.860 +- 3.856
9 V 0.639 4.860 +- 3.856
10 G 0.639 4.860 +- 3.856
11 G 0.639 4.860 +- 3.856
12 L 0.639 4.860 +- 3.856
13 M 0.639 4.860 +- 3.856
14 M 0.639 4.860 +- 3.856
15 A 0.639 4.860 +- 3.856
16 A 0.639 4.860 +- 3.856
17 G 0.639 4.860 +- 3.856
18 R 0.639 4.860 +- 3.856
19 L 0.639 4.860 +- 3.856
20 E 0.639 4.860 +- 3.856
21 R 0.639 4.860 +- 3.856
22 I 0.639 4.860 +- 3.856
23 T 0.639 4.860 +- 3.856
24 S 0.639 4.860 +- 3.856
25 E 0.639 4.860 +- 3.856
26 S 0.639 4.860 +- 3.856
27 M 0.639 4.860 +- 3.856
28 A 0.639 4.860 +- 3.856
29 C 0.639 4.860 +- 3.856
30 N 0.639 4.860 +- 3.856
31 A 0.639 4.860 +- 3.856
32 K 0.639 4.860 +- 3.856
33 L 0.639 4.860 +- 3.856
34 T 0.639 4.860 +- 3.856
35 P 0.639 4.860 +- 3.856
36 V 0.639 4.860 +- 3.856
37 T 0.639 4.860 +- 3.856
38 T 0.639 4.860 +- 3.856
39 K 0.639 4.860 +- 3.856
40 V 0.639 4.860 +- 3.856
41 V 0.639 4.860 +- 3.856
42 P 0.639 4.860 +- 3.856
43 P 0.639 4.860 +- 3.856
44 A 0.639 4.860 +- 3.856
45 A 0.639 4.860 +- 3.856
46 D 0.639 4.860 +- 3.856
47 Q 0.639 4.860 +- 3.856
48 V 0.639 4.860 +- 3.856
49 S 0.639 4.860 +- 3.856
50 K 0.639 4.860 +- 3.856
51 L 0.639 4.860 +- 3.856
52 A 0.923 6.858 +- 3.003
53 S 0.639 4.860 +- 3.856
54 Q 0.639 4.860 +- 3.856
55 V 0.639 4.860 +- 3.856
56 F 0.639 4.860 +- 3.856
57 S 0.639 4.860 +- 3.856
58 S 0.639 4.860 +- 3.856
59 Y 0.639 4.860 +- 3.856
60 G 0.639 4.860 +- 3.856
61 K 0.639 4.860 +- 3.856
62 Q 0.639 4.860 +- 3.856
63 Y 0.639 4.860 +- 3.856
64 E 0.639 4.860 +- 3.856
65 G 0.639 4.860 +- 3.856
66 Y 0.639 4.860 +- 3.856
67 A 0.639 4.860 +- 3.856
68 A 0.639 4.860 +- 3.856
69 Q 0.639 4.860 +- 3.856
70 G 0.639 4.860 +- 3.856
71 V 0.639 4.860 +- 3.856
72 D 0.639 4.860 +- 3.856
73 Q 0.639 4.860 +- 3.856
74 S 0.639 4.860 +- 3.856
75 R 0.639 4.860 +- 3.856
76 L 0.639 4.860 +- 3.856
77 F 0.639 4.860 +- 3.856
78 V 0.639 4.860 +- 3.856
79 Q 0.639 4.860 +- 3.856
80 S 0.639 4.860 +- 3.856
81 L 0.639 4.860 +- 3.856
82 K 0.639 4.860 +- 3.856
83 D 0.639 4.860 +- 3.856
84 A 0.639 4.860 +- 3.856
85 A 0.639 4.860 +- 3.856
86 G 0.639 4.860 +- 3.856
87 D 0.639 4.860 +- 3.856
88 Y 0.639 4.860 +- 3.856
89 M 0.639 4.860 +- 3.856
90 D 0.639 4.860 +- 3.856
91 S 0.639 4.860 +- 3.856
92 D 0.639 4.860 +- 3.856
93 H 0.639 4.860 +- 3.856
94 M 0.639 4.860 +- 3.856
95 Y 0.639 4.860 +- 3.856
96 L 0.639 4.860 +- 3.856
97 N 0.639 4.860 +- 3.856
98 T 0.639 4.860 +- 3.856
99 E 0.639 4.860 +- 3.856
100 D 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:20
Model 1: NearlyNeutral -408.479512 Model 2: PositiveSelection -408.049906 Model 0: one-ratio -408.049755 Model 7: beta -408.479512 Model 8: beta&w>1 -408.049906 Model 0 vs 1 0.8595139999999901 Model 2 vs 1 0.8592119999999568 Model 8 vs 7 0.8592119999999568
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
